F410148

General Info

Members Datasets Scaffolds Average Seq Length
330 246 660 171

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10001570|Ga0307511_1000157013
Length 195
Sequence MAGAGALRHNPAMDLHQLSRNFARPGRLAQILLRPAHRALAREVQSAIALAGRGLQGDRTGDRPPTQAGGGKRQVTLIQAEHLPVIAALTGHAHIDAAGPRRNLVIEGLNLLAARSLFKDQPLVLRIGPEVVLEVTGPCEPCSRMEELLGPGGYNAMRGHGGITARVLTGGALNVGDLVYCELEPAMASAQASLL

Samples

Sample ID Description Type Environment
1 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
43 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
63 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
105 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
106 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
107 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
108 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
115 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
116 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
117 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
119 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
120 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
124 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
125 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
126 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
127 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
128 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
129 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
130 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
131 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
132 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
133 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
134 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
135 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
136 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
137 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
138 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
139 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
140 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
141 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
142 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
143 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
144 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
165 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
166 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
207 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
208 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
209 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
215 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
222 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
223 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
224 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
225 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
226 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
227 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
228 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
229 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
230 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
231 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
232 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
235 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
240 2738543013 Variovorax sp. BT01 Isolate Unclassified
241 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
242 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
243 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
244 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
245 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
246 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.27
Metatranscriptomes 0.61
Isolates 2.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.09
Nodule 0.61
Rhizoplane 8.18
Rhizosphere 61.52
Stem 0
Stem Tuber 0
Unclassified 12.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307511_10001570 3300030521 Bacteria 24239
2 JGI25155J39150_1000002 3300002704 Bacteria 292156
3 JGI25156J39149_1000003 3300002705 Bacteria 305434
4 JGI25154J39366_1000009 3300002738 Bacteria 305408
5 JGI25157J39369_1000002 3300002741 Bacteria 305434
6 rootH1_10003602 3300003316 Bacteria 5550
7 rootH2_10017766 3300003320 Bacteria 41125
8 rootL2_10001705 3300003322 Bacteria 24471
9 rootL2_10001745 3300003322 Bacteria 8104
10 rootL2_10005015 3300003322 Bacteria 1848
11 rootL2_10031533 3300003322 Bacteria 4806
12 rootH1_10009037 3300003323 Bacteria 29976
13 rootH1_10129979 3300003323 Bacteria 4013
14 rootH1_10225941 3300003323 Unclassified 1267
15 Ga0055537_1017157 3300003773 Bacteria 1200
16 Ga0055524_1000139 3300003775 Bacteria 86430
17 Ga0055536_1014941 3300003781 Bacteria 2688
18 Ga0055534_1000726 3300003784 Bacteria 15931
19 Ga0055530_10001272 3300003791 Bacteria 19049
20 Ga0055530_10023303 3300003791 Bacteria 1782
21 Ga0055540_1000090 3300003792 Bacteria 99454
22 Ga0055540_1000091 3300003792 Bacteria 99089
23 Ga0055540_1003052 3300003792 Bacteria 8339
24 Ga0055531_10008196 3300003794 Bacteria 5562
25 Ga0065165_1000873 3300005262 Bacteria 39246
26 Ga0070690_100409112 3300005330 Bacteria 998
27 Ga0070666_10245442 3300005335 Unclassified 1267
28 Ga0068868_100097915 3300005338 Bacteria 2371
29 Ga0070671_100020763 3300005355 Bacteria 5357
30 Ga0070671_100044313 3300005355 Unclassified 3697
31 Ga0070673_100356012 3300005364 Bacteria 1300
32 Ga0070688_100464845 3300005365 Bacteria 948
33 Ga0070667_100025363 3300005367 Bacteria 4929
34 Ga0070700_100184572 3300005441 Bacteria 1454
35 Ga0070663_100280694 3300005455 Bacteria 1327
36 Ga0070678_100455525 3300005456 Bacteria 1121
37 Ga0070665_100289735 3300005548 Bacteria 1639
38 Ga0070664_100345172 3300005564 Bacteria 1353
39 Ga0070664_101319290 3300005564 Bacteria 682
40 Ga0068859_100002402 3300005617 Bacteria 19068
41 Ga0068864_100096008 3300005618 Bacteria 2623
42 Ga0068863_100019876 3300005841 Bacteria 6424
43 Ga0068858_100000113 3300005842 Bacteria 84912
44 Ga0068858_100478419 3300005842 Bacteria 1202
45 Ga0068860_100127499 3300005843 Unclassified 2439
46 Ga0081455_10176539 3300005937 Bacteria 1621
47 Ga0075364_10113037 3300006051 Bacteria 1813
48 Ga0075362_10052421 3300006177 Bacteria 1828
49 Ga0075367_10004087 3300006178 Bacteria 7066
50 Ga0075369_10002759 3300006186 Bacteria 6304
51 Ga0075366_10003646 3300006195 Bacteria 8163
52 Ga0097620_100002402 3300006931 Bacteria 19068
53 Ga0079104_1000916 3300006946 Bacteria 23741
54 Ga0105250_10033729 3300009092 Unclassified 2056
55 Ga0105240_10002128 3300009093 Bacteria 32334
56 Ga0105245_10224193 3300009098 Bacteria 1815
57 Ga0105247_10000445 3300009101 Bacteria 34975
58 Ga0105243_10006992 3300009148 Bacteria 8689
59 Ga0105248_10156004 3300009177 Unclassified 2576
60 Ga0105248_10638638 3300009177 Bacteria 1201
61 Ga0105237_10007938 3300009545 Bacteria 11564
62 Ga0105237_10081814 3300009545 Bacteria 3220
63 Ga0105238_10000830 3300009551 Bacteria 31988
64 Ga0105249_10213099 3300009553 Bacteria 1897
65 Ga0105239_10110491 3300010375 Bacteria 3047
66 Ga0105239_10163026 3300010375 Bacteria 2491
67 Ga0157370_10011683 3300013104 Bacteria 9166
68 Ga0157374_10348110 3300013296 Bacteria 1472
69 Ga0163162_10291432 3300013306 Bacteria 1764
70 Ga0157375_10147765 3300013308 Bacteria 2482
71 Ga0157375_10222212 3300013308 Bacteria 2047
72 Ga0163163_10004816 3300014325 Bacteria 11592
73 Ga0163163_10139344 3300014325 Bacteria 2468
74 Ga0163163_10209743 3300014325 Bacteria 1997
75 Ga0157380_10065030 3300014326 Bacteria 2930
76 Ga0157379_10032641 3300014968 Bacteria 4642
77 Ga0157379_10426550 3300014968 Bacteria 1222
78 Ga0157379_10646833 3300014968 Bacteria 990
79 Ga0163161_10000180 3300017792 Bacteria 57748
80 Ga0224712_10284580 3300022467 Unclassified 770
81 Ga0209435_100001 3300025206 Bacteria 1424171
82 Ga0209646_1000001 3300025246 Bacteria 3092932
83 Ga0209026_1000003 3300025250 Bacteria 1060571
84 Ga0209759_1000001 3300025256 Bacteria 2799452
85 Ga0209129_1007630 3300025258 Bacteria 3173
86 Ga0209565_1000407 3300025263 Bacteria 35850
87 Ga0209130_1003048 3300025284 Bacteria 7552
88 Ga0209675_1001101 3300025291 Bacteria 16548
89 Ga0209675_1001324 3300025291 Bacteria 14690
90 Ga0209675_1025528 3300025291 Bacteria 1488
91 Ga0209676_1000293 3300025292 Bacteria 101210
92 Ga0209676_1008235 3300025292 Bacteria 4691
93 Ga0209025_1000133 3300025294 Bacteria 195885
94 Ga0209025_1003720 3300025294 Bacteria 14007
95 Ga0209025_1031822 3300025294 Bacteria 2484
96 Ga0209564_1002323 3300025295 Bacteria 15406
97 Ga0209050_1000326 3300025298 Bacteria 95495
98 Ga0209050_1000967 3300025298 Bacteria 36985
99 Ga0209050_1003038 3300025298 Bacteria 12940
100 Ga0209050_1013473 3300025298 Bacteria 3624
101 Ga0209050_1036185 3300025298 Bacteria 1446
102 Ga0209256_1000019 3300025299 Bacteria 558627
103 Ga0209051_1000130 3300025303 Bacteria 141656
104 Ga0209051_1000133 3300025303 Bacteria 139014
105 Ga0209257_1000038 3300025304 Bacteria 609032
106 Ga0209257_1013959 3300025304 Bacteria 3506
107 Ga0207696_1018304 3300025711 Unclassified 2302
108 Ga0207642_10204940 3300025899 Bacteria 1092
109 Ga0207710_10000334 3300025900 Bacteria 35251
110 Ga0207695_10041823 3300025913 Bacteria 4902
111 Ga0207671_10014755 3300025914 Bacteria 6159
112 Ga0207671_10357057 3300025914 Bacteria 1159
113 Ga0207694_10105375 3300025924 Bacteria 2238
114 Ga0207644_10009476 3300025931 Bacteria 6396
115 Ga0207709_10000191 3300025935 Bacteria 82020
116 Ga0207691_10555611 3300025940 Bacteria 973
117 Ga0207711_10384144 3300025941 Bacteria 1303
118 Ga0207679_10064184 3300025945 Bacteria 2744
119 Ga0207668_10455400 3300025972 Bacteria 1093
120 Ga0207658_10009188 3300025986 Bacteria 6704
121 Ga0207703_10007828 3300026035 Bacteria 8451
122 Ga0207639_10449871 3300026041 Bacteria 1169
123 Ga0207639_10751887 3300026041 Bacteria 906
124 Ga0207678_10235785 3300026067 Unclassified 1567
125 Ga0207641_10104176 3300026088 Unclassified 2504
126 Ga0207674_10412781 3300026116 Bacteria 1305
127 Ga0207698_10536440 3300026142 Bacteria 1144
128 Ga0209281_1000935 3300027111 Bacteria 24025
129 Ga0268266_10091594 3300028379 Unclassified 2666
130 Ga0268266_10170400 3300028379 Bacteria 1976
131 Ga0268266_10876661 3300028379 Bacteria 868
132 Ga0268265_10299604 3300028380 Bacteria 1447
133 Ga0268264_10007153 3300028381 Bacteria 9351
134 Ga0316182_1173201 3300030745 Bacteria 3653
135 Ga0265332_10262778 3300031238 Unclassified 714
136 Ga0307513_10016333 3300031456 Bacteria 8961
137 Ga0307513_10107570 3300031456 Unclassified 2791
138 Ga0307513_10190975 3300031456 Bacteria 1900
139 Ga0307408_100279251 3300031548 Bacteria 1390
140 Ga0307514_10000330 3300031649 Bacteria 113231
141 Ga0316575_10030378 3300031665 Bacteria 2112
142 Ga0316575_10188480 3300031665 Bacteria 857
143 Ga0316579_10020191 3300031691 Bacteria 2951
144 Ga0316579_10165879 3300031691 Bacteria 1067
145 Ga0316576_10029389 3300031727 Bacteria 3885
146 Ga0316576_10593467 3300031727 Unclassified 809
147 Ga0316578_10054758 3300031728 Bacteria 2340
148 Ga0316578_10325966 3300031728 Bacteria 916
149 Ga0307405_10169429 3300031731 Bacteria 1556
150 Ga0307405_10252683 3300031731 Bacteria 1312
151 Ga0316577_10150507 3300031733 Bacteria 1311
152 Ga0316577_10276910 3300031733 Bacteria 950
153 Ga0316577_10295947 3300031733 Bacteria 917
154 Ga0307412_10041945 3300031911 Bacteria 2969
155 Ga0307416_100128363 3300032002 Bacteria 2276
156 Ga0307411_10120687 3300032005 Bacteria 1896
157 Ga0316583_10148243 3300032133 Bacteria 817
158 Ga0316583_10174833 3300032133 Unclassified 747
159 Ga0316585_10096945 3300032137 Unclassified 966
160 Ga0316580_10035104 3300032139 Bacteria 1552
161 Ga0316580_10040208 3300032139 Bacteria 1445
162 Ga0316588_1000471 3300033528 Bacteria 5443
163 Ga0316574_0005573 3300035398 Bacteria 6727
164 Ga0316574_0199476 3300035398 Bacteria 1285
165 Ga0316574_0258011 3300035398 Bacteria 1113
166 Ga0316574_0375069 3300035398 Bacteria 898
167 Ga0316574_0575345 3300035398 Bacteria 697
168 Ga0316582_0065565 3300036647 Bacteria 2338
169 Ga0316582_0068827 3300036647 Unclassified 2287
170 Ga0316582_0440069 3300036647 Bacteria 898
171 Ga0316584_0011964 3300036712 Bacteria 6113
172 Ga0316584_0126827 3300036712 Unclassified 1906
173 Ga0316584_0170828 3300036712 Bacteria 1613
174 Ga0316584_0368451 3300036712 Bacteria 1028
175 Ga0316584_0501755 3300036712 Unclassified 852
176 Ga0373925_0382798 3300037068 Bacteria 1146
177 Ga0395905_0111062 3300037471 Bacteria 2574
178 Ga0316581_0152319 3300037588 Unclassified 713
179 Ga0451791_1692606 3300041451 Bacteria 810
180 Ga0451798_1067716 3300041458 Bacteria 962
181 Ga0451835_0594784 3300041492 Bacteria 538
182 Ga0451839_1225651 3300041496 Bacteria 663
183 Ga0451841_1060093 3300041498 Bacteria 1037
184 Ga0451851_0153605 3300041507 Bacteria 958
185 Ga0451853_0887354 3300041512 Bacteria 891
186 Ga0439431_0170527 3300041997 Bacteria 625
187 Ga0439437_000086 3300042000 Bacteria 6646
188 Ga0439455_0019013 3300042012 Bacteria 1616
189 Ga0439456_005434 3300042013 Bacteria 2586
190 Ga0450911_000006 3300042115 Bacteria 222143
191 Ga0450892_010781 3300042130 Bacteria 804
192 Ga0450903_003391 3300042138 Bacteria 2761
193 Ga0450904_000006 3300042139 Bacteria 59554
194 Ga0439446_0053200 3300042156 Bacteria 1213
195 Ga0439434_0032156 3300042435 Bacteria 1596
196 Ga0439434_0369763 3300042435 Bacteria 502
197 Ga0439435_0053148 3300042436 Bacteria 1164
198 Ga0439459_0095892 3300042438 Bacteria 719
199 Ga0439460_0197399 3300042461 Bacteria 685
200 Ga0450893_0024530 3300042532 Bacteria 1053
201 Ga0450893_0047354 3300042532 Unclassified 799
202 Ga0466969_0103677 3300044656 Bacteria 1336
203 Ga0466972_0076192 3300044658 Bacteria 1598
204 Ga0466966_0019262 3300044684 Bacteria 4492
205 Ga0466961_0027432 3300044693 Bacteria 3662
206 Ga0466964_0015707 3300044706 Bacteria 2882
207 Ga0453684_1219055 3300044712 Unclassified 789
208 Ga0466971_0027849 3300044719 Bacteria 2530
209 Ga0466970_0126360 3300044765 Bacteria 1402
210 Ga0466957_1084046 3300044842 Unclassified 577
211 Ga0451576_0884613 3300045051 Bacteria 937
212 Ga0451576_1102378 3300045051 Unclassified 831
213 Ga0466958_0559383 3300045836 Unclassified 743
214 Ga0466967_0114364 3300045976 Bacteria 2484
215 Ga0495629_0656231 3300046459 Bacteria 699
216 Ga0495638_0000004 3300046460 Bacteria 700795
217 Ga0495653_0512785 3300046463 Unclassified 746
218 Ga0495650_0017971 3300046471 Bacteria 3529
219 Ga0495630_0008561 3300046517 Bacteria 7340
220 Ga0495632_0112201 3300046519 Bacteria 1279
221 Ga0495632_0115528 3300046519 Bacteria 1257
222 Ga0495643_0147404 3300046522 Bacteria 1168
223 Ga0495643_0267536 3300046522 Bacteria 791
224 Ga0495642_0042451 3300046528 Bacteria 1853
225 Ga0495654_0002265 3300046530 Bacteria 12449
226 Ga0495621_0064589 3300046539 Bacteria 1336
227 Ga0495611_0013987 3300046648 Bacteria 3424
228 Ga0495669_0168781 3300046684 Bacteria 1040
229 Ga0495624_0027574 3300046690 Bacteria 3718
230 Ga0495674_0008260 3300047319 Bacteria 9932
231 Ga0495674_0277552 3300047319 Bacteria 1374
232 Ga0495676_0382388 3300047321 Bacteria 936
233 Ga0495687_070740 3300047443 Bacteria 1400
234 Ga0495602_0032791 3300048088 Bacteria 4886
235 Ga0495614_0070615 3300048089 Bacteria 1505
236 Ga0496101_0052121 3300048904 Bacteria 2950
237 Ga0496102_0005583 3300048905 Bacteria 10683
238 Ga0496102_0010570 3300048905 Bacteria 7950
239 Ga0496102_0091837 3300048905 Bacteria 2811
240 Ga0496102_0242672 3300048905 Bacteria 1699
241 Ga0496103_0101333 3300048906 Bacteria 1823
242 Ga0496106_0057564 3300048909 Bacteria 2940
243 Ga0496106_0063401 3300048909 Bacteria 2809
244 Ga0496106_0629158 3300048909 Bacteria 858
245 Ga0496107_0187977 3300048910 Bacteria 1534
246 Ga0496107_0742854 3300048910 Bacteria 720
247 Ga0496108_0225368 3300048911 Bacteria 1629
248 Ga0496109_0041522 3300048912 Bacteria 4166
249 Ga0496109_0504690 3300048912 Unclassified 1142
250 Ga0496110_0210080 3300048913 Bacteria 1769
251 Ga0496110_0442585 3300048913 Bacteria 1184
252 Ga0496111_0191888 3300048914 Bacteria 1519
253 Ga0496112_0481634 3300048915 Unclassified 1177
254 Ga0496112_0541374 3300048915 Bacteria 1098
255 Ga0496113_0249087 3300048916 Bacteria 1418
256 Ga0496113_0390484 3300048916 Bacteria 1117
257 Ga0496113_0835322 3300048916 Bacteria 731
258 Ga0496114_0010920 3300048917 Bacteria 7239
259 Ga0496114_0036571 3300048917 Bacteria 4059
260 Ga0496115_1003569 3300048918 Bacteria 638
261 Ga0496118_0034101 3300048921 Bacteria 4161
262 Ga0496121_0050656 3300048924 Unclassified 3505
263 Ga0496121_0569058 3300048924 Unclassified 705
264 Ga0496125_0047353 3300048928 Unclassified 3597
265 Ga0496126_0717456 3300048929 Bacteria 775
266 Ga0501036_0042055 3300049572 Bacteria 3868
267 Ga0501037_0140704 3300049573 Bacteria 1727
268 Ga0501037_0556886 3300049573 Bacteria 773
269 Ga0501038_0154103 3300049574 Bacteria 1872
270 Ga0501039_0002626 3300049575 Bacteria 13415
271 Ga0501041_0018849 3300049577 Bacteria 4110
272 Ga0501042_0054777 3300049578 Bacteria 2845
273 Ga0501043_0759143 3300049579 Bacteria 704
274 Ga0501046_0074474 3300049580 Bacteria 2634
275 Ga0501046_0657534 3300049580 Bacteria 740
276 Ga0501068_0031000 3300049584 Bacteria 3175
277 Ga0501069_0399399 3300049585 Bacteria 813
278 Ga0501072_0008329 3300049588 Bacteria 7876
279 Ga0501075_0001378 3300049591 Bacteria 15819
280 Ga0501075_0051602 3300049591 Bacteria 3093
281 Ga0501076_0000031 3300049592 Bacteria 73431
282 Ga0501076_0004285 3300049592 Bacteria 10110
283 Ga0501077_0045359 3300049593 Bacteria 2792
284 Ga0501217_000954 3300049661 Bacteria 5192
285 Ga0501235_163736 3300049669 Unclassified 584
286 Ga0501247_082268 3300049677 Unclassified 521
287 Ga0501252_005105 3300049682 Bacteria 1417
288 Ga0501079_0012355 3300049741 Bacteria 6516
289 Ga0501080_0003854 3300049742 Bacteria 13255
290 Ga0501081_0000191 3300049743 Bacteria 29657
291 Ga0501045_0000383 3300049824 Bacteria 26686
292 Ga0501045_0431201 3300049824 Bacteria 980
293 Ga0501226_000004 3300049853 Bacteria 284656
294 nmdc:mga03n38_13386_c1 3300050490 Bacteria 3115
295 nmdc:mga0yw44_53533_c1 3300050492 Bacteria 2452
296 nmdc:mga0k408_10191_c1 3300050493 Bacteria 5081
297 nmdc:mga0k408_104380_c1 3300050493 Bacteria 1672
298 nmdc:mga0k408_89870_c1 3300050493 Bacteria 1804
299 nmdc:mga06z11_4763_c1 3300050494 Bacteria 5367
300 nmdc:mga07m45_284686_c1 3300050496 Bacteria 961
301 nmdc:mga07m45_549728_c1 3300050496 Bacteria 668
302 nmdc:mga0qj67_1297372_c1 3300050509 Unclassified 564
303 Ga0500644_0006260 3300053088 Bacteria 3039
304 Ga0500583_0068668 3300053092 Bacteria 1690
305 Ga0500583_0070027 3300053092 Unclassified 1675
306 Ga0500583_0183986 3300053092 Bacteria 1040
307 Ga0500641_0096086 3300053096 Unclassified 1268
308 Ga0500557_007680 3300053105 Bacteria 2533
309 Ga0500569_155419 3300053109 Unclassified 773
310 Ga0500593_001913 3300053117 Bacteria 7503
311 Ga0500594_0077461 3300053118 Unclassified 989
312 Ga0500608_291058 3300053122 Unclassified 612
313 Ga0500628_002571 3300053129 Bacteria 2993
314 Ga0500642_0058370 3300053130 Bacteria 1725
315 Ga0500655_002429 3300053133 Bacteria 3395
316 Ga0500604_0000393 3300053151 Bacteria 12013
317 Ga0500616_0000049 3300053153 Bacteria 303396
318 Ga0500645_008419 3300053730 Bacteria 3524
319 Ga0500656_026807 3300053732 Unclassified 746
320 Ga0501084_0004406 3300054114 Bacteria 11484
321 Ga0501082_0003366 3300060353 Bacteria 13956
322 Ga0466962_0008023 3300061719 Bacteria 5063
323 Ga0530510_0005597 3300061734 Bacteria 8706
324 2739251598 2738543013 Bacteria 5618633
325 2808906680 2808606373 Bacteria 4423627
326 2904547043 2904541872 Bacteria 8915136
327 2929164592 2929160207 Bacteria 9075316
328 2945910801 2945909444 Bacteria 7065066
329 2945987015 2945984333 Bacteria 7358892
330 2954771446 2954767861 Bacteria 5535784
331 Ga0307511_10001570
332 JGI25155J39150_1000002
333 JGI25156J39149_1000003
334 JGI25154J39366_1000009
335 JGI25157J39369_1000002
336 rootH1_10003602
337 rootH2_10017766
338 rootL2_10001705
339 rootL2_10001745
340 rootL2_10005015
341 rootL2_10031533
342 rootH1_10009037
343 rootH1_10129979
344 rootH1_10225941
345 Ga0055537_1017157
346 Ga0055524_1000139
347 Ga0055536_1014941
348 Ga0055534_1000726
349 Ga0055530_10001272
350 Ga0055530_10023303
351 Ga0055540_1000090
352 Ga0055540_1000091
353 Ga0055540_1003052
354 Ga0055531_10008196
355 Ga0065165_1000873
356 Ga0070690_100409112
357 Ga0070666_10245442
358 Ga0068868_100097915
359 Ga0070671_100020763
360 Ga0070671_100044313
361 Ga0070673_100356012
362 Ga0070688_100464845
363 Ga0070667_100025363
364 Ga0070700_100184572
365 Ga0070663_100280694
366 Ga0070678_100455525
367 Ga0070665_100289735
368 Ga0070664_100345172
369 Ga0070664_101319290
370 Ga0068859_100002402
371 Ga0068864_100096008
372 Ga0068863_100019876
373 Ga0068858_100000113
374 Ga0068858_100478419
375 Ga0068860_100127499
376 Ga0081455_10176539
377 Ga0075364_10113037
378 Ga0075362_10052421
379 Ga0075367_10004087
380 Ga0075369_10002759
381 Ga0075366_10003646
382 Ga0097620_100002402
383 Ga0079104_1000916
384 Ga0105250_10033729
385 Ga0105240_10002128
386 Ga0105245_10224193
387 Ga0105247_10000445
388 Ga0105243_10006992
389 Ga0105248_10156004
390 Ga0105248_10638638
391 Ga0105237_10007938
392 Ga0105237_10081814
393 Ga0105238_10000830
394 Ga0105249_10213099
395 Ga0105239_10110491
396 Ga0105239_10163026
397 Ga0157370_10011683
398 Ga0157374_10348110
399 Ga0163162_10291432
400 Ga0157375_10147765
401 Ga0157375_10222212
402 Ga0163163_10004816
403 Ga0163163_10139344
404 Ga0163163_10209743
405 Ga0157380_10065030
406 Ga0157379_10032641
407 Ga0157379_10426550
408 Ga0157379_10646833
409 Ga0163161_10000180
410 Ga0224712_10284580
411 Ga0209435_100001
412 Ga0209646_1000001
413 Ga0209026_1000003
414 Ga0209759_1000001
415 Ga0209129_1007630
416 Ga0209565_1000407
417 Ga0209130_1003048
418 Ga0209675_1001101
419 Ga0209675_1001324
420 Ga0209675_1025528
421 Ga0209676_1000293
422 Ga0209676_1008235
423 Ga0209025_1000133
424 Ga0209025_1003720
425 Ga0209025_1031822
426 Ga0209564_1002323
427 Ga0209050_1000326
428 Ga0209050_1000967
429 Ga0209050_1003038
430 Ga0209050_1013473
431 Ga0209050_1036185
432 Ga0209256_1000019
433 Ga0209051_1000130
434 Ga0209051_1000133
435 Ga0209257_1000038
436 Ga0209257_1013959
437 Ga0207696_1018304
438 Ga0207642_10204940
439 Ga0207710_10000334
440 Ga0207695_10041823
441 Ga0207671_10014755
442 Ga0207671_10357057
443 Ga0207694_10105375
444 Ga0207644_10009476
445 Ga0207709_10000191
446 Ga0207691_10555611
447 Ga0207711_10384144
448 Ga0207679_10064184
449 Ga0207668_10455400
450 Ga0207658_10009188
451 Ga0207703_10007828
452 Ga0207639_10449871
453 Ga0207639_10751887
454 Ga0207678_10235785
455 Ga0207641_10104176
456 Ga0207674_10412781
457 Ga0207698_10536440
458 Ga0209281_1000935
459 Ga0268266_10091594
460 Ga0268266_10170400
461 Ga0268266_10876661
462 Ga0268265_10299604
463 Ga0268264_10007153
464 Ga0316182_1173201
465 Ga0265332_10262778
466 Ga0307513_10016333
467 Ga0307513_10107570
468 Ga0307513_10190975
469 Ga0307408_100279251
470 Ga0307514_10000330
471 Ga0316575_10030378
472 Ga0316575_10188480
473 Ga0316579_10020191
474 Ga0316579_10165879
475 Ga0316576_10029389
476 Ga0316576_10593467
477 Ga0316578_10054758
478 Ga0316578_10325966
479 Ga0307405_10169429
480 Ga0307405_10252683
481 Ga0316577_10150507
482 Ga0316577_10276910
483 Ga0316577_10295947
484 Ga0307412_10041945
485 Ga0307416_100128363
486 Ga0307411_10120687
487 Ga0316583_10148243
488 Ga0316583_10174833
489 Ga0316585_10096945
490 Ga0316580_10035104
491 Ga0316580_10040208
492 Ga0316588_1000471
493 Ga0316574_0005573
494 Ga0316574_0199476
495 Ga0316574_0258011
496 Ga0316574_0375069
497 Ga0316574_0575345
498 Ga0316582_0065565
499 Ga0316582_0068827
500 Ga0316582_0440069
501 Ga0316584_0011964
502 Ga0316584_0126827
503 Ga0316584_0170828
504 Ga0316584_0368451
505 Ga0316584_0501755
506 Ga0373925_0382798
507 Ga0395905_0111062
508 Ga0316581_0152319
509 Ga0451791_1692606
510 Ga0451798_1067716
511 Ga0451835_0594784
512 Ga0451839_1225651
513 Ga0451841_1060093
514 Ga0451851_0153605
515 Ga0451853_0887354
516 Ga0439431_0170527
517 Ga0439437_000086
518 Ga0439455_0019013
519 Ga0439456_005434
520 Ga0450911_000006
521 Ga0450892_010781
522 Ga0450903_003391
523 Ga0450904_000006
524 Ga0439446_0053200
525 Ga0439434_0032156
526 Ga0439434_0369763
527 Ga0439435_0053148
528 Ga0439459_0095892
529 Ga0439460_0197399
530 Ga0450893_0024530
531 Ga0450893_0047354
532 Ga0466969_0103677
533 Ga0466972_0076192
534 Ga0466966_0019262
535 Ga0466961_0027432
536 Ga0466964_0015707
537 Ga0453684_1219055
538 Ga0466971_0027849
539 Ga0466970_0126360
540 Ga0466957_1084046
541 Ga0451576_0884613
542 Ga0451576_1102378
543 Ga0466958_0559383
544 Ga0466967_0114364
545 Ga0495629_0656231
546 Ga0495638_0000004
547 Ga0495653_0512785
548 Ga0495650_0017971
549 Ga0495630_0008561
550 Ga0495632_0112201
551 Ga0495632_0115528
552 Ga0495643_0147404
553 Ga0495643_0267536
554 Ga0495642_0042451
555 Ga0495654_0002265
556 Ga0495621_0064589
557 Ga0495611_0013987
558 Ga0495669_0168781
559 Ga0495624_0027574
560 Ga0495674_0008260
561 Ga0495674_0277552
562 Ga0495676_0382388
563 Ga0495687_070740
564 Ga0495602_0032791
565 Ga0495614_0070615
566 Ga0496101_0052121
567 Ga0496102_0005583
568 Ga0496102_0010570
569 Ga0496102_0091837
570 Ga0496102_0242672
571 Ga0496103_0101333
572 Ga0496106_0057564
573 Ga0496106_0063401
574 Ga0496106_0629158
575 Ga0496107_0187977
576 Ga0496107_0742854
577 Ga0496108_0225368
578 Ga0496109_0041522
579 Ga0496109_0504690
580 Ga0496110_0210080
581 Ga0496110_0442585
582 Ga0496111_0191888
583 Ga0496112_0481634
584 Ga0496112_0541374
585 Ga0496113_0249087
586 Ga0496113_0390484
587 Ga0496113_0835322
588 Ga0496114_0010920
589 Ga0496114_0036571
590 Ga0496115_1003569
591 Ga0496118_0034101
592 Ga0496121_0050656
593 Ga0496121_0569058
594 Ga0496125_0047353
595 Ga0496126_0717456
596 Ga0501036_0042055
597 Ga0501037_0140704
598 Ga0501037_0556886
599 Ga0501038_0154103
600 Ga0501039_0002626
601 Ga0501041_0018849
602 Ga0501042_0054777
603 Ga0501043_0759143
604 Ga0501046_0074474
605 Ga0501046_0657534
606 Ga0501068_0031000
607 Ga0501069_0399399
608 Ga0501072_0008329
609 Ga0501075_0001378
610 Ga0501075_0051602
611 Ga0501076_0000031
612 Ga0501076_0004285
613 Ga0501077_0045359
614 Ga0501217_000954
615 Ga0501235_163736
616 Ga0501247_082268
617 Ga0501252_005105
618 Ga0501079_0012355
619 Ga0501080_0003854
620 Ga0501081_0000191
621 Ga0501045_0000383
622 Ga0501045_0431201
623 Ga0501226_000004
624 nmdc:mga03n38_13386_c1
625 nmdc:mga0yw44_53533_c1
626 nmdc:mga0k408_10191_c1
627 nmdc:mga0k408_104380_c1
628 nmdc:mga0k408_89870_c1
629 nmdc:mga06z11_4763_c1
630 nmdc:mga07m45_284686_c1
631 nmdc:mga07m45_549728_c1
632 nmdc:mga0qj67_1297372_c1
633 Ga0500644_0006260
634 Ga0500583_0068668
635 Ga0500583_0070027
636 Ga0500583_0183986
637 Ga0500641_0096086
638 Ga0500557_007680
639 Ga0500569_155419
640 Ga0500593_001913
641 Ga0500594_0077461
642 Ga0500608_291058
643 Ga0500628_002571
644 Ga0500642_0058370
645 Ga0500655_002429
646 Ga0500604_0000393
647 Ga0500616_0000049
648 Ga0500645_008419
649 Ga0500656_026807
650 Ga0501084_0004406
651 Ga0501082_0003366
652 Ga0466962_0008023
653 Ga0530510_0005597
654 2739251598
655 2808906680
656 2904547043
657 2929164592
658 2945910801
659 2945987015
660 2954771446

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03473

MOSC

MOSC domain

64

180

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oru-assembly1.cif.gz_B crystal structure of apc1665, yuad protein from bacillus subtilis 0.8029 17 172
1o67-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.7906 17 167
1o65-assembly2.cif.gz_B crystal structure of an hypothetical protein 0.7643 17 167
1o65-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.7528 17 167
5yhi-assembly1.cif.gz_B crystal structure of yiim from escherichia coli 0.7488 20 172
ID Description Score Start End Superfamily
1oruB00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7811 18 172 2.40.33.20
5yhiA00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7552 20 172 2.40.33.20
af_Q2FVS9_1_216_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7537 20 168 2.40.33.20
af_P95151_15_247_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7437 14 168 2.40.33.20
1oruB00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.7047 18 172 2.40.33.20
ID Description Score Start End GO Terms
AF-A0A554RYV3-F1-model_v4 MOSC domain-containing protein 0.9955 5 172 GO:0003824
GO:0030151
GO:0030170
AF-F5Y4T3-F1-model_v4 MOSC domain-containing protein 0.9938 5 171 GO:0003824
GO:0030151
GO:0030170
AF-A0A2G6WUD8-F1-model_v4 MOSC domain-containing protein 0.993 1 172 GO:0003824
GO:0030151
GO:0030170
AF-A0A2G6WUD8-F1-model_v4 MOSC domain-containing protein 0.9872 1 172 GO:0003824
GO:0030151
GO:0030170
AF-A0A5B8CUL7-F1-model_v4 MOSC domain-containing protein 0.9834 4 169 GO:0003824
GO:0030151
GO:0030170

Map