F410148
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 330 | 246 | 660 | 171 |
Family's Representative Sequence
| Representative Sequence | 3300030521|Ga0307511_10001570|Ga0307511_1000157013 |
| Length | 195 |
| Sequence | MAGAGALRHNPAMDLHQLSRNFARPGRLAQILLRPAHRALAREVQSAIALAGRGLQGDRTGDRPPTQAGGGKRQVTLIQAEHLPVIAALTGHAHIDAAGPRRNLVIEGLNLLAARSLFKDQPLVLRIGPEVVLEVTGPCEPCSRMEELLGPGGYNAMRGHGGITARVLTGGALNVGDLVYCELEPAMASAQASLL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 37 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 38 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 39 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 40 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 41 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 43 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 63 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 64 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 65 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 66 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 97 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 101 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 103 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 104 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 105 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 106 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 107 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 108 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 109 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 110 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 111 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 112 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 113 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 114 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 115 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 116 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 117 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 119 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 120 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 121 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 123 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 124 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 125 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 126 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 127 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 128 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 129 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 130 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 131 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 132 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 133 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 134 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 135 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 136 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 137 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 138 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 139 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 140 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 141 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 142 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 143 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 144 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 145 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 146 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 147 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 148 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 149 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 150 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 151 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 152 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 153 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 154 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 155 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 156 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 157 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 177 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 178 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 179 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 180 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 183 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 184 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 185 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 186 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 187 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 188 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 189 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 190 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 191 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 192 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 207 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 208 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 209 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 210 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 215 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 216 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 217 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 218 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 219 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 220 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 222 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 223 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 224 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 225 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 226 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 227 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 228 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 229 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 230 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 231 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 232 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 233 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 234 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 235 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 236 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 239 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 240 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 241 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 242 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 243 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 244 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 245 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 246 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.27 |
| Metatranscriptomes | 0.61 |
| Isolates | 2.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.09 |
| Nodule | 0.61 |
| Rhizoplane | 8.18 |
| Rhizosphere | 61.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307511_10001570 | 3300030521 | Bacteria | 24239 |
| 2 | JGI25155J39150_1000002 | 3300002704 | Bacteria | 292156 |
| 3 | JGI25156J39149_1000003 | 3300002705 | Bacteria | 305434 |
| 4 | JGI25154J39366_1000009 | 3300002738 | Bacteria | 305408 |
| 5 | JGI25157J39369_1000002 | 3300002741 | Bacteria | 305434 |
| 6 | rootH1_10003602 | 3300003316 | Bacteria | 5550 |
| 7 | rootH2_10017766 | 3300003320 | Bacteria | 41125 |
| 8 | rootL2_10001705 | 3300003322 | Bacteria | 24471 |
| 9 | rootL2_10001745 | 3300003322 | Bacteria | 8104 |
| 10 | rootL2_10005015 | 3300003322 | Bacteria | 1848 |
| 11 | rootL2_10031533 | 3300003322 | Bacteria | 4806 |
| 12 | rootH1_10009037 | 3300003323 | Bacteria | 29976 |
| 13 | rootH1_10129979 | 3300003323 | Bacteria | 4013 |
| 14 | rootH1_10225941 | 3300003323 | Unclassified | 1267 |
| 15 | Ga0055537_1017157 | 3300003773 | Bacteria | 1200 |
| 16 | Ga0055524_1000139 | 3300003775 | Bacteria | 86430 |
| 17 | Ga0055536_1014941 | 3300003781 | Bacteria | 2688 |
| 18 | Ga0055534_1000726 | 3300003784 | Bacteria | 15931 |
| 19 | Ga0055530_10001272 | 3300003791 | Bacteria | 19049 |
| 20 | Ga0055530_10023303 | 3300003791 | Bacteria | 1782 |
| 21 | Ga0055540_1000090 | 3300003792 | Bacteria | 99454 |
| 22 | Ga0055540_1000091 | 3300003792 | Bacteria | 99089 |
| 23 | Ga0055540_1003052 | 3300003792 | Bacteria | 8339 |
| 24 | Ga0055531_10008196 | 3300003794 | Bacteria | 5562 |
| 25 | Ga0065165_1000873 | 3300005262 | Bacteria | 39246 |
| 26 | Ga0070690_100409112 | 3300005330 | Bacteria | 998 |
| 27 | Ga0070666_10245442 | 3300005335 | Unclassified | 1267 |
| 28 | Ga0068868_100097915 | 3300005338 | Bacteria | 2371 |
| 29 | Ga0070671_100020763 | 3300005355 | Bacteria | 5357 |
| 30 | Ga0070671_100044313 | 3300005355 | Unclassified | 3697 |
| 31 | Ga0070673_100356012 | 3300005364 | Bacteria | 1300 |
| 32 | Ga0070688_100464845 | 3300005365 | Bacteria | 948 |
| 33 | Ga0070667_100025363 | 3300005367 | Bacteria | 4929 |
| 34 | Ga0070700_100184572 | 3300005441 | Bacteria | 1454 |
| 35 | Ga0070663_100280694 | 3300005455 | Bacteria | 1327 |
| 36 | Ga0070678_100455525 | 3300005456 | Bacteria | 1121 |
| 37 | Ga0070665_100289735 | 3300005548 | Bacteria | 1639 |
| 38 | Ga0070664_100345172 | 3300005564 | Bacteria | 1353 |
| 39 | Ga0070664_101319290 | 3300005564 | Bacteria | 682 |
| 40 | Ga0068859_100002402 | 3300005617 | Bacteria | 19068 |
| 41 | Ga0068864_100096008 | 3300005618 | Bacteria | 2623 |
| 42 | Ga0068863_100019876 | 3300005841 | Bacteria | 6424 |
| 43 | Ga0068858_100000113 | 3300005842 | Bacteria | 84912 |
| 44 | Ga0068858_100478419 | 3300005842 | Bacteria | 1202 |
| 45 | Ga0068860_100127499 | 3300005843 | Unclassified | 2439 |
| 46 | Ga0081455_10176539 | 3300005937 | Bacteria | 1621 |
| 47 | Ga0075364_10113037 | 3300006051 | Bacteria | 1813 |
| 48 | Ga0075362_10052421 | 3300006177 | Bacteria | 1828 |
| 49 | Ga0075367_10004087 | 3300006178 | Bacteria | 7066 |
| 50 | Ga0075369_10002759 | 3300006186 | Bacteria | 6304 |
| 51 | Ga0075366_10003646 | 3300006195 | Bacteria | 8163 |
| 52 | Ga0097620_100002402 | 3300006931 | Bacteria | 19068 |
| 53 | Ga0079104_1000916 | 3300006946 | Bacteria | 23741 |
| 54 | Ga0105250_10033729 | 3300009092 | Unclassified | 2056 |
| 55 | Ga0105240_10002128 | 3300009093 | Bacteria | 32334 |
| 56 | Ga0105245_10224193 | 3300009098 | Bacteria | 1815 |
| 57 | Ga0105247_10000445 | 3300009101 | Bacteria | 34975 |
| 58 | Ga0105243_10006992 | 3300009148 | Bacteria | 8689 |
| 59 | Ga0105248_10156004 | 3300009177 | Unclassified | 2576 |
| 60 | Ga0105248_10638638 | 3300009177 | Bacteria | 1201 |
| 61 | Ga0105237_10007938 | 3300009545 | Bacteria | 11564 |
| 62 | Ga0105237_10081814 | 3300009545 | Bacteria | 3220 |
| 63 | Ga0105238_10000830 | 3300009551 | Bacteria | 31988 |
| 64 | Ga0105249_10213099 | 3300009553 | Bacteria | 1897 |
| 65 | Ga0105239_10110491 | 3300010375 | Bacteria | 3047 |
| 66 | Ga0105239_10163026 | 3300010375 | Bacteria | 2491 |
| 67 | Ga0157370_10011683 | 3300013104 | Bacteria | 9166 |
| 68 | Ga0157374_10348110 | 3300013296 | Bacteria | 1472 |
| 69 | Ga0163162_10291432 | 3300013306 | Bacteria | 1764 |
| 70 | Ga0157375_10147765 | 3300013308 | Bacteria | 2482 |
| 71 | Ga0157375_10222212 | 3300013308 | Bacteria | 2047 |
| 72 | Ga0163163_10004816 | 3300014325 | Bacteria | 11592 |
| 73 | Ga0163163_10139344 | 3300014325 | Bacteria | 2468 |
| 74 | Ga0163163_10209743 | 3300014325 | Bacteria | 1997 |
| 75 | Ga0157380_10065030 | 3300014326 | Bacteria | 2930 |
| 76 | Ga0157379_10032641 | 3300014968 | Bacteria | 4642 |
| 77 | Ga0157379_10426550 | 3300014968 | Bacteria | 1222 |
| 78 | Ga0157379_10646833 | 3300014968 | Bacteria | 990 |
| 79 | Ga0163161_10000180 | 3300017792 | Bacteria | 57748 |
| 80 | Ga0224712_10284580 | 3300022467 | Unclassified | 770 |
| 81 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 82 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 83 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 84 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 85 | Ga0209129_1007630 | 3300025258 | Bacteria | 3173 |
| 86 | Ga0209565_1000407 | 3300025263 | Bacteria | 35850 |
| 87 | Ga0209130_1003048 | 3300025284 | Bacteria | 7552 |
| 88 | Ga0209675_1001101 | 3300025291 | Bacteria | 16548 |
| 89 | Ga0209675_1001324 | 3300025291 | Bacteria | 14690 |
| 90 | Ga0209675_1025528 | 3300025291 | Bacteria | 1488 |
| 91 | Ga0209676_1000293 | 3300025292 | Bacteria | 101210 |
| 92 | Ga0209676_1008235 | 3300025292 | Bacteria | 4691 |
| 93 | Ga0209025_1000133 | 3300025294 | Bacteria | 195885 |
| 94 | Ga0209025_1003720 | 3300025294 | Bacteria | 14007 |
| 95 | Ga0209025_1031822 | 3300025294 | Bacteria | 2484 |
| 96 | Ga0209564_1002323 | 3300025295 | Bacteria | 15406 |
| 97 | Ga0209050_1000326 | 3300025298 | Bacteria | 95495 |
| 98 | Ga0209050_1000967 | 3300025298 | Bacteria | 36985 |
| 99 | Ga0209050_1003038 | 3300025298 | Bacteria | 12940 |
| 100 | Ga0209050_1013473 | 3300025298 | Bacteria | 3624 |
| 101 | Ga0209050_1036185 | 3300025298 | Bacteria | 1446 |
| 102 | Ga0209256_1000019 | 3300025299 | Bacteria | 558627 |
| 103 | Ga0209051_1000130 | 3300025303 | Bacteria | 141656 |
| 104 | Ga0209051_1000133 | 3300025303 | Bacteria | 139014 |
| 105 | Ga0209257_1000038 | 3300025304 | Bacteria | 609032 |
| 106 | Ga0209257_1013959 | 3300025304 | Bacteria | 3506 |
| 107 | Ga0207696_1018304 | 3300025711 | Unclassified | 2302 |
| 108 | Ga0207642_10204940 | 3300025899 | Bacteria | 1092 |
| 109 | Ga0207710_10000334 | 3300025900 | Bacteria | 35251 |
| 110 | Ga0207695_10041823 | 3300025913 | Bacteria | 4902 |
| 111 | Ga0207671_10014755 | 3300025914 | Bacteria | 6159 |
| 112 | Ga0207671_10357057 | 3300025914 | Bacteria | 1159 |
| 113 | Ga0207694_10105375 | 3300025924 | Bacteria | 2238 |
| 114 | Ga0207644_10009476 | 3300025931 | Bacteria | 6396 |
| 115 | Ga0207709_10000191 | 3300025935 | Bacteria | 82020 |
| 116 | Ga0207691_10555611 | 3300025940 | Bacteria | 973 |
| 117 | Ga0207711_10384144 | 3300025941 | Bacteria | 1303 |
| 118 | Ga0207679_10064184 | 3300025945 | Bacteria | 2744 |
| 119 | Ga0207668_10455400 | 3300025972 | Bacteria | 1093 |
| 120 | Ga0207658_10009188 | 3300025986 | Bacteria | 6704 |
| 121 | Ga0207703_10007828 | 3300026035 | Bacteria | 8451 |
| 122 | Ga0207639_10449871 | 3300026041 | Bacteria | 1169 |
| 123 | Ga0207639_10751887 | 3300026041 | Bacteria | 906 |
| 124 | Ga0207678_10235785 | 3300026067 | Unclassified | 1567 |
| 125 | Ga0207641_10104176 | 3300026088 | Unclassified | 2504 |
| 126 | Ga0207674_10412781 | 3300026116 | Bacteria | 1305 |
| 127 | Ga0207698_10536440 | 3300026142 | Bacteria | 1144 |
| 128 | Ga0209281_1000935 | 3300027111 | Bacteria | 24025 |
| 129 | Ga0268266_10091594 | 3300028379 | Unclassified | 2666 |
| 130 | Ga0268266_10170400 | 3300028379 | Bacteria | 1976 |
| 131 | Ga0268266_10876661 | 3300028379 | Bacteria | 868 |
| 132 | Ga0268265_10299604 | 3300028380 | Bacteria | 1447 |
| 133 | Ga0268264_10007153 | 3300028381 | Bacteria | 9351 |
| 134 | Ga0316182_1173201 | 3300030745 | Bacteria | 3653 |
| 135 | Ga0265332_10262778 | 3300031238 | Unclassified | 714 |
| 136 | Ga0307513_10016333 | 3300031456 | Bacteria | 8961 |
| 137 | Ga0307513_10107570 | 3300031456 | Unclassified | 2791 |
| 138 | Ga0307513_10190975 | 3300031456 | Bacteria | 1900 |
| 139 | Ga0307408_100279251 | 3300031548 | Bacteria | 1390 |
| 140 | Ga0307514_10000330 | 3300031649 | Bacteria | 113231 |
| 141 | Ga0316575_10030378 | 3300031665 | Bacteria | 2112 |
| 142 | Ga0316575_10188480 | 3300031665 | Bacteria | 857 |
| 143 | Ga0316579_10020191 | 3300031691 | Bacteria | 2951 |
| 144 | Ga0316579_10165879 | 3300031691 | Bacteria | 1067 |
| 145 | Ga0316576_10029389 | 3300031727 | Bacteria | 3885 |
| 146 | Ga0316576_10593467 | 3300031727 | Unclassified | 809 |
| 147 | Ga0316578_10054758 | 3300031728 | Bacteria | 2340 |
| 148 | Ga0316578_10325966 | 3300031728 | Bacteria | 916 |
| 149 | Ga0307405_10169429 | 3300031731 | Bacteria | 1556 |
| 150 | Ga0307405_10252683 | 3300031731 | Bacteria | 1312 |
| 151 | Ga0316577_10150507 | 3300031733 | Bacteria | 1311 |
| 152 | Ga0316577_10276910 | 3300031733 | Bacteria | 950 |
| 153 | Ga0316577_10295947 | 3300031733 | Bacteria | 917 |
| 154 | Ga0307412_10041945 | 3300031911 | Bacteria | 2969 |
| 155 | Ga0307416_100128363 | 3300032002 | Bacteria | 2276 |
| 156 | Ga0307411_10120687 | 3300032005 | Bacteria | 1896 |
| 157 | Ga0316583_10148243 | 3300032133 | Bacteria | 817 |
| 158 | Ga0316583_10174833 | 3300032133 | Unclassified | 747 |
| 159 | Ga0316585_10096945 | 3300032137 | Unclassified | 966 |
| 160 | Ga0316580_10035104 | 3300032139 | Bacteria | 1552 |
| 161 | Ga0316580_10040208 | 3300032139 | Bacteria | 1445 |
| 162 | Ga0316588_1000471 | 3300033528 | Bacteria | 5443 |
| 163 | Ga0316574_0005573 | 3300035398 | Bacteria | 6727 |
| 164 | Ga0316574_0199476 | 3300035398 | Bacteria | 1285 |
| 165 | Ga0316574_0258011 | 3300035398 | Bacteria | 1113 |
| 166 | Ga0316574_0375069 | 3300035398 | Bacteria | 898 |
| 167 | Ga0316574_0575345 | 3300035398 | Bacteria | 697 |
| 168 | Ga0316582_0065565 | 3300036647 | Bacteria | 2338 |
| 169 | Ga0316582_0068827 | 3300036647 | Unclassified | 2287 |
| 170 | Ga0316582_0440069 | 3300036647 | Bacteria | 898 |
| 171 | Ga0316584_0011964 | 3300036712 | Bacteria | 6113 |
| 172 | Ga0316584_0126827 | 3300036712 | Unclassified | 1906 |
| 173 | Ga0316584_0170828 | 3300036712 | Bacteria | 1613 |
| 174 | Ga0316584_0368451 | 3300036712 | Bacteria | 1028 |
| 175 | Ga0316584_0501755 | 3300036712 | Unclassified | 852 |
| 176 | Ga0373925_0382798 | 3300037068 | Bacteria | 1146 |
| 177 | Ga0395905_0111062 | 3300037471 | Bacteria | 2574 |
| 178 | Ga0316581_0152319 | 3300037588 | Unclassified | 713 |
| 179 | Ga0451791_1692606 | 3300041451 | Bacteria | 810 |
| 180 | Ga0451798_1067716 | 3300041458 | Bacteria | 962 |
| 181 | Ga0451835_0594784 | 3300041492 | Bacteria | 538 |
| 182 | Ga0451839_1225651 | 3300041496 | Bacteria | 663 |
| 183 | Ga0451841_1060093 | 3300041498 | Bacteria | 1037 |
| 184 | Ga0451851_0153605 | 3300041507 | Bacteria | 958 |
| 185 | Ga0451853_0887354 | 3300041512 | Bacteria | 891 |
| 186 | Ga0439431_0170527 | 3300041997 | Bacteria | 625 |
| 187 | Ga0439437_000086 | 3300042000 | Bacteria | 6646 |
| 188 | Ga0439455_0019013 | 3300042012 | Bacteria | 1616 |
| 189 | Ga0439456_005434 | 3300042013 | Bacteria | 2586 |
| 190 | Ga0450911_000006 | 3300042115 | Bacteria | 222143 |
| 191 | Ga0450892_010781 | 3300042130 | Bacteria | 804 |
| 192 | Ga0450903_003391 | 3300042138 | Bacteria | 2761 |
| 193 | Ga0450904_000006 | 3300042139 | Bacteria | 59554 |
| 194 | Ga0439446_0053200 | 3300042156 | Bacteria | 1213 |
| 195 | Ga0439434_0032156 | 3300042435 | Bacteria | 1596 |
| 196 | Ga0439434_0369763 | 3300042435 | Bacteria | 502 |
| 197 | Ga0439435_0053148 | 3300042436 | Bacteria | 1164 |
| 198 | Ga0439459_0095892 | 3300042438 | Bacteria | 719 |
| 199 | Ga0439460_0197399 | 3300042461 | Bacteria | 685 |
| 200 | Ga0450893_0024530 | 3300042532 | Bacteria | 1053 |
| 201 | Ga0450893_0047354 | 3300042532 | Unclassified | 799 |
| 202 | Ga0466969_0103677 | 3300044656 | Bacteria | 1336 |
| 203 | Ga0466972_0076192 | 3300044658 | Bacteria | 1598 |
| 204 | Ga0466966_0019262 | 3300044684 | Bacteria | 4492 |
| 205 | Ga0466961_0027432 | 3300044693 | Bacteria | 3662 |
| 206 | Ga0466964_0015707 | 3300044706 | Bacteria | 2882 |
| 207 | Ga0453684_1219055 | 3300044712 | Unclassified | 789 |
| 208 | Ga0466971_0027849 | 3300044719 | Bacteria | 2530 |
| 209 | Ga0466970_0126360 | 3300044765 | Bacteria | 1402 |
| 210 | Ga0466957_1084046 | 3300044842 | Unclassified | 577 |
| 211 | Ga0451576_0884613 | 3300045051 | Bacteria | 937 |
| 212 | Ga0451576_1102378 | 3300045051 | Unclassified | 831 |
| 213 | Ga0466958_0559383 | 3300045836 | Unclassified | 743 |
| 214 | Ga0466967_0114364 | 3300045976 | Bacteria | 2484 |
| 215 | Ga0495629_0656231 | 3300046459 | Bacteria | 699 |
| 216 | Ga0495638_0000004 | 3300046460 | Bacteria | 700795 |
| 217 | Ga0495653_0512785 | 3300046463 | Unclassified | 746 |
| 218 | Ga0495650_0017971 | 3300046471 | Bacteria | 3529 |
| 219 | Ga0495630_0008561 | 3300046517 | Bacteria | 7340 |
| 220 | Ga0495632_0112201 | 3300046519 | Bacteria | 1279 |
| 221 | Ga0495632_0115528 | 3300046519 | Bacteria | 1257 |
| 222 | Ga0495643_0147404 | 3300046522 | Bacteria | 1168 |
| 223 | Ga0495643_0267536 | 3300046522 | Bacteria | 791 |
| 224 | Ga0495642_0042451 | 3300046528 | Bacteria | 1853 |
| 225 | Ga0495654_0002265 | 3300046530 | Bacteria | 12449 |
| 226 | Ga0495621_0064589 | 3300046539 | Bacteria | 1336 |
| 227 | Ga0495611_0013987 | 3300046648 | Bacteria | 3424 |
| 228 | Ga0495669_0168781 | 3300046684 | Bacteria | 1040 |
| 229 | Ga0495624_0027574 | 3300046690 | Bacteria | 3718 |
| 230 | Ga0495674_0008260 | 3300047319 | Bacteria | 9932 |
| 231 | Ga0495674_0277552 | 3300047319 | Bacteria | 1374 |
| 232 | Ga0495676_0382388 | 3300047321 | Bacteria | 936 |
| 233 | Ga0495687_070740 | 3300047443 | Bacteria | 1400 |
| 234 | Ga0495602_0032791 | 3300048088 | Bacteria | 4886 |
| 235 | Ga0495614_0070615 | 3300048089 | Bacteria | 1505 |
| 236 | Ga0496101_0052121 | 3300048904 | Bacteria | 2950 |
| 237 | Ga0496102_0005583 | 3300048905 | Bacteria | 10683 |
| 238 | Ga0496102_0010570 | 3300048905 | Bacteria | 7950 |
| 239 | Ga0496102_0091837 | 3300048905 | Bacteria | 2811 |
| 240 | Ga0496102_0242672 | 3300048905 | Bacteria | 1699 |
| 241 | Ga0496103_0101333 | 3300048906 | Bacteria | 1823 |
| 242 | Ga0496106_0057564 | 3300048909 | Bacteria | 2940 |
| 243 | Ga0496106_0063401 | 3300048909 | Bacteria | 2809 |
| 244 | Ga0496106_0629158 | 3300048909 | Bacteria | 858 |
| 245 | Ga0496107_0187977 | 3300048910 | Bacteria | 1534 |
| 246 | Ga0496107_0742854 | 3300048910 | Bacteria | 720 |
| 247 | Ga0496108_0225368 | 3300048911 | Bacteria | 1629 |
| 248 | Ga0496109_0041522 | 3300048912 | Bacteria | 4166 |
| 249 | Ga0496109_0504690 | 3300048912 | Unclassified | 1142 |
| 250 | Ga0496110_0210080 | 3300048913 | Bacteria | 1769 |
| 251 | Ga0496110_0442585 | 3300048913 | Bacteria | 1184 |
| 252 | Ga0496111_0191888 | 3300048914 | Bacteria | 1519 |
| 253 | Ga0496112_0481634 | 3300048915 | Unclassified | 1177 |
| 254 | Ga0496112_0541374 | 3300048915 | Bacteria | 1098 |
| 255 | Ga0496113_0249087 | 3300048916 | Bacteria | 1418 |
| 256 | Ga0496113_0390484 | 3300048916 | Bacteria | 1117 |
| 257 | Ga0496113_0835322 | 3300048916 | Bacteria | 731 |
| 258 | Ga0496114_0010920 | 3300048917 | Bacteria | 7239 |
| 259 | Ga0496114_0036571 | 3300048917 | Bacteria | 4059 |
| 260 | Ga0496115_1003569 | 3300048918 | Bacteria | 638 |
| 261 | Ga0496118_0034101 | 3300048921 | Bacteria | 4161 |
| 262 | Ga0496121_0050656 | 3300048924 | Unclassified | 3505 |
| 263 | Ga0496121_0569058 | 3300048924 | Unclassified | 705 |
| 264 | Ga0496125_0047353 | 3300048928 | Unclassified | 3597 |
| 265 | Ga0496126_0717456 | 3300048929 | Bacteria | 775 |
| 266 | Ga0501036_0042055 | 3300049572 | Bacteria | 3868 |
| 267 | Ga0501037_0140704 | 3300049573 | Bacteria | 1727 |
| 268 | Ga0501037_0556886 | 3300049573 | Bacteria | 773 |
| 269 | Ga0501038_0154103 | 3300049574 | Bacteria | 1872 |
| 270 | Ga0501039_0002626 | 3300049575 | Bacteria | 13415 |
| 271 | Ga0501041_0018849 | 3300049577 | Bacteria | 4110 |
| 272 | Ga0501042_0054777 | 3300049578 | Bacteria | 2845 |
| 273 | Ga0501043_0759143 | 3300049579 | Bacteria | 704 |
| 274 | Ga0501046_0074474 | 3300049580 | Bacteria | 2634 |
| 275 | Ga0501046_0657534 | 3300049580 | Bacteria | 740 |
| 276 | Ga0501068_0031000 | 3300049584 | Bacteria | 3175 |
| 277 | Ga0501069_0399399 | 3300049585 | Bacteria | 813 |
| 278 | Ga0501072_0008329 | 3300049588 | Bacteria | 7876 |
| 279 | Ga0501075_0001378 | 3300049591 | Bacteria | 15819 |
| 280 | Ga0501075_0051602 | 3300049591 | Bacteria | 3093 |
| 281 | Ga0501076_0000031 | 3300049592 | Bacteria | 73431 |
| 282 | Ga0501076_0004285 | 3300049592 | Bacteria | 10110 |
| 283 | Ga0501077_0045359 | 3300049593 | Bacteria | 2792 |
| 284 | Ga0501217_000954 | 3300049661 | Bacteria | 5192 |
| 285 | Ga0501235_163736 | 3300049669 | Unclassified | 584 |
| 286 | Ga0501247_082268 | 3300049677 | Unclassified | 521 |
| 287 | Ga0501252_005105 | 3300049682 | Bacteria | 1417 |
| 288 | Ga0501079_0012355 | 3300049741 | Bacteria | 6516 |
| 289 | Ga0501080_0003854 | 3300049742 | Bacteria | 13255 |
| 290 | Ga0501081_0000191 | 3300049743 | Bacteria | 29657 |
| 291 | Ga0501045_0000383 | 3300049824 | Bacteria | 26686 |
| 292 | Ga0501045_0431201 | 3300049824 | Bacteria | 980 |
| 293 | Ga0501226_000004 | 3300049853 | Bacteria | 284656 |
| 294 | nmdc:mga03n38_13386_c1 | 3300050490 | Bacteria | 3115 |
| 295 | nmdc:mga0yw44_53533_c1 | 3300050492 | Bacteria | 2452 |
| 296 | nmdc:mga0k408_10191_c1 | 3300050493 | Bacteria | 5081 |
| 297 | nmdc:mga0k408_104380_c1 | 3300050493 | Bacteria | 1672 |
| 298 | nmdc:mga0k408_89870_c1 | 3300050493 | Bacteria | 1804 |
| 299 | nmdc:mga06z11_4763_c1 | 3300050494 | Bacteria | 5367 |
| 300 | nmdc:mga07m45_284686_c1 | 3300050496 | Bacteria | 961 |
| 301 | nmdc:mga07m45_549728_c1 | 3300050496 | Bacteria | 668 |
| 302 | nmdc:mga0qj67_1297372_c1 | 3300050509 | Unclassified | 564 |
| 303 | Ga0500644_0006260 | 3300053088 | Bacteria | 3039 |
| 304 | Ga0500583_0068668 | 3300053092 | Bacteria | 1690 |
| 305 | Ga0500583_0070027 | 3300053092 | Unclassified | 1675 |
| 306 | Ga0500583_0183986 | 3300053092 | Bacteria | 1040 |
| 307 | Ga0500641_0096086 | 3300053096 | Unclassified | 1268 |
| 308 | Ga0500557_007680 | 3300053105 | Bacteria | 2533 |
| 309 | Ga0500569_155419 | 3300053109 | Unclassified | 773 |
| 310 | Ga0500593_001913 | 3300053117 | Bacteria | 7503 |
| 311 | Ga0500594_0077461 | 3300053118 | Unclassified | 989 |
| 312 | Ga0500608_291058 | 3300053122 | Unclassified | 612 |
| 313 | Ga0500628_002571 | 3300053129 | Bacteria | 2993 |
| 314 | Ga0500642_0058370 | 3300053130 | Bacteria | 1725 |
| 315 | Ga0500655_002429 | 3300053133 | Bacteria | 3395 |
| 316 | Ga0500604_0000393 | 3300053151 | Bacteria | 12013 |
| 317 | Ga0500616_0000049 | 3300053153 | Bacteria | 303396 |
| 318 | Ga0500645_008419 | 3300053730 | Bacteria | 3524 |
| 319 | Ga0500656_026807 | 3300053732 | Unclassified | 746 |
| 320 | Ga0501084_0004406 | 3300054114 | Bacteria | 11484 |
| 321 | Ga0501082_0003366 | 3300060353 | Bacteria | 13956 |
| 322 | Ga0466962_0008023 | 3300061719 | Bacteria | 5063 |
| 323 | Ga0530510_0005597 | 3300061734 | Bacteria | 8706 |
| 324 | 2739251598 | 2738543013 | Bacteria | 5618633 |
| 325 | 2808906680 | 2808606373 | Bacteria | 4423627 |
| 326 | 2904547043 | 2904541872 | Bacteria | 8915136 |
| 327 | 2929164592 | 2929160207 | Bacteria | 9075316 |
| 328 | 2945910801 | 2945909444 | Bacteria | 7065066 |
| 329 | 2945987015 | 2945984333 | Bacteria | 7358892 |
| 330 | 2954771446 | 2954767861 | Bacteria | 5535784 |
| 331 | Ga0307511_10001570 | |||
| 332 | JGI25155J39150_1000002 | |||
| 333 | JGI25156J39149_1000003 | |||
| 334 | JGI25154J39366_1000009 | |||
| 335 | JGI25157J39369_1000002 | |||
| 336 | rootH1_10003602 | |||
| 337 | rootH2_10017766 | |||
| 338 | rootL2_10001705 | |||
| 339 | rootL2_10001745 | |||
| 340 | rootL2_10005015 | |||
| 341 | rootL2_10031533 | |||
| 342 | rootH1_10009037 | |||
| 343 | rootH1_10129979 | |||
| 344 | rootH1_10225941 | |||
| 345 | Ga0055537_1017157 | |||
| 346 | Ga0055524_1000139 | |||
| 347 | Ga0055536_1014941 | |||
| 348 | Ga0055534_1000726 | |||
| 349 | Ga0055530_10001272 | |||
| 350 | Ga0055530_10023303 | |||
| 351 | Ga0055540_1000090 | |||
| 352 | Ga0055540_1000091 | |||
| 353 | Ga0055540_1003052 | |||
| 354 | Ga0055531_10008196 | |||
| 355 | Ga0065165_1000873 | |||
| 356 | Ga0070690_100409112 | |||
| 357 | Ga0070666_10245442 | |||
| 358 | Ga0068868_100097915 | |||
| 359 | Ga0070671_100020763 | |||
| 360 | Ga0070671_100044313 | |||
| 361 | Ga0070673_100356012 | |||
| 362 | Ga0070688_100464845 | |||
| 363 | Ga0070667_100025363 | |||
| 364 | Ga0070700_100184572 | |||
| 365 | Ga0070663_100280694 | |||
| 366 | Ga0070678_100455525 | |||
| 367 | Ga0070665_100289735 | |||
| 368 | Ga0070664_100345172 | |||
| 369 | Ga0070664_101319290 | |||
| 370 | Ga0068859_100002402 | |||
| 371 | Ga0068864_100096008 | |||
| 372 | Ga0068863_100019876 | |||
| 373 | Ga0068858_100000113 | |||
| 374 | Ga0068858_100478419 | |||
| 375 | Ga0068860_100127499 | |||
| 376 | Ga0081455_10176539 | |||
| 377 | Ga0075364_10113037 | |||
| 378 | Ga0075362_10052421 | |||
| 379 | Ga0075367_10004087 | |||
| 380 | Ga0075369_10002759 | |||
| 381 | Ga0075366_10003646 | |||
| 382 | Ga0097620_100002402 | |||
| 383 | Ga0079104_1000916 | |||
| 384 | Ga0105250_10033729 | |||
| 385 | Ga0105240_10002128 | |||
| 386 | Ga0105245_10224193 | |||
| 387 | Ga0105247_10000445 | |||
| 388 | Ga0105243_10006992 | |||
| 389 | Ga0105248_10156004 | |||
| 390 | Ga0105248_10638638 | |||
| 391 | Ga0105237_10007938 | |||
| 392 | Ga0105237_10081814 | |||
| 393 | Ga0105238_10000830 | |||
| 394 | Ga0105249_10213099 | |||
| 395 | Ga0105239_10110491 | |||
| 396 | Ga0105239_10163026 | |||
| 397 | Ga0157370_10011683 | |||
| 398 | Ga0157374_10348110 | |||
| 399 | Ga0163162_10291432 | |||
| 400 | Ga0157375_10147765 | |||
| 401 | Ga0157375_10222212 | |||
| 402 | Ga0163163_10004816 | |||
| 403 | Ga0163163_10139344 | |||
| 404 | Ga0163163_10209743 | |||
| 405 | Ga0157380_10065030 | |||
| 406 | Ga0157379_10032641 | |||
| 407 | Ga0157379_10426550 | |||
| 408 | Ga0157379_10646833 | |||
| 409 | Ga0163161_10000180 | |||
| 410 | Ga0224712_10284580 | |||
| 411 | Ga0209435_100001 | |||
| 412 | Ga0209646_1000001 | |||
| 413 | Ga0209026_1000003 | |||
| 414 | Ga0209759_1000001 | |||
| 415 | Ga0209129_1007630 | |||
| 416 | Ga0209565_1000407 | |||
| 417 | Ga0209130_1003048 | |||
| 418 | Ga0209675_1001101 | |||
| 419 | Ga0209675_1001324 | |||
| 420 | Ga0209675_1025528 | |||
| 421 | Ga0209676_1000293 | |||
| 422 | Ga0209676_1008235 | |||
| 423 | Ga0209025_1000133 | |||
| 424 | Ga0209025_1003720 | |||
| 425 | Ga0209025_1031822 | |||
| 426 | Ga0209564_1002323 | |||
| 427 | Ga0209050_1000326 | |||
| 428 | Ga0209050_1000967 | |||
| 429 | Ga0209050_1003038 | |||
| 430 | Ga0209050_1013473 | |||
| 431 | Ga0209050_1036185 | |||
| 432 | Ga0209256_1000019 | |||
| 433 | Ga0209051_1000130 | |||
| 434 | Ga0209051_1000133 | |||
| 435 | Ga0209257_1000038 | |||
| 436 | Ga0209257_1013959 | |||
| 437 | Ga0207696_1018304 | |||
| 438 | Ga0207642_10204940 | |||
| 439 | Ga0207710_10000334 | |||
| 440 | Ga0207695_10041823 | |||
| 441 | Ga0207671_10014755 | |||
| 442 | Ga0207671_10357057 | |||
| 443 | Ga0207694_10105375 | |||
| 444 | Ga0207644_10009476 | |||
| 445 | Ga0207709_10000191 | |||
| 446 | Ga0207691_10555611 | |||
| 447 | Ga0207711_10384144 | |||
| 448 | Ga0207679_10064184 | |||
| 449 | Ga0207668_10455400 | |||
| 450 | Ga0207658_10009188 | |||
| 451 | Ga0207703_10007828 | |||
| 452 | Ga0207639_10449871 | |||
| 453 | Ga0207639_10751887 | |||
| 454 | Ga0207678_10235785 | |||
| 455 | Ga0207641_10104176 | |||
| 456 | Ga0207674_10412781 | |||
| 457 | Ga0207698_10536440 | |||
| 458 | Ga0209281_1000935 | |||
| 459 | Ga0268266_10091594 | |||
| 460 | Ga0268266_10170400 | |||
| 461 | Ga0268266_10876661 | |||
| 462 | Ga0268265_10299604 | |||
| 463 | Ga0268264_10007153 | |||
| 464 | Ga0316182_1173201 | |||
| 465 | Ga0265332_10262778 | |||
| 466 | Ga0307513_10016333 | |||
| 467 | Ga0307513_10107570 | |||
| 468 | Ga0307513_10190975 | |||
| 469 | Ga0307408_100279251 | |||
| 470 | Ga0307514_10000330 | |||
| 471 | Ga0316575_10030378 | |||
| 472 | Ga0316575_10188480 | |||
| 473 | Ga0316579_10020191 | |||
| 474 | Ga0316579_10165879 | |||
| 475 | Ga0316576_10029389 | |||
| 476 | Ga0316576_10593467 | |||
| 477 | Ga0316578_10054758 | |||
| 478 | Ga0316578_10325966 | |||
| 479 | Ga0307405_10169429 | |||
| 480 | Ga0307405_10252683 | |||
| 481 | Ga0316577_10150507 | |||
| 482 | Ga0316577_10276910 | |||
| 483 | Ga0316577_10295947 | |||
| 484 | Ga0307412_10041945 | |||
| 485 | Ga0307416_100128363 | |||
| 486 | Ga0307411_10120687 | |||
| 487 | Ga0316583_10148243 | |||
| 488 | Ga0316583_10174833 | |||
| 489 | Ga0316585_10096945 | |||
| 490 | Ga0316580_10035104 | |||
| 491 | Ga0316580_10040208 | |||
| 492 | Ga0316588_1000471 | |||
| 493 | Ga0316574_0005573 | |||
| 494 | Ga0316574_0199476 | |||
| 495 | Ga0316574_0258011 | |||
| 496 | Ga0316574_0375069 | |||
| 497 | Ga0316574_0575345 | |||
| 498 | Ga0316582_0065565 | |||
| 499 | Ga0316582_0068827 | |||
| 500 | Ga0316582_0440069 | |||
| 501 | Ga0316584_0011964 | |||
| 502 | Ga0316584_0126827 | |||
| 503 | Ga0316584_0170828 | |||
| 504 | Ga0316584_0368451 | |||
| 505 | Ga0316584_0501755 | |||
| 506 | Ga0373925_0382798 | |||
| 507 | Ga0395905_0111062 | |||
| 508 | Ga0316581_0152319 | |||
| 509 | Ga0451791_1692606 | |||
| 510 | Ga0451798_1067716 | |||
| 511 | Ga0451835_0594784 | |||
| 512 | Ga0451839_1225651 | |||
| 513 | Ga0451841_1060093 | |||
| 514 | Ga0451851_0153605 | |||
| 515 | Ga0451853_0887354 | |||
| 516 | Ga0439431_0170527 | |||
| 517 | Ga0439437_000086 | |||
| 518 | Ga0439455_0019013 | |||
| 519 | Ga0439456_005434 | |||
| 520 | Ga0450911_000006 | |||
| 521 | Ga0450892_010781 | |||
| 522 | Ga0450903_003391 | |||
| 523 | Ga0450904_000006 | |||
| 524 | Ga0439446_0053200 | |||
| 525 | Ga0439434_0032156 | |||
| 526 | Ga0439434_0369763 | |||
| 527 | Ga0439435_0053148 | |||
| 528 | Ga0439459_0095892 | |||
| 529 | Ga0439460_0197399 | |||
| 530 | Ga0450893_0024530 | |||
| 531 | Ga0450893_0047354 | |||
| 532 | Ga0466969_0103677 | |||
| 533 | Ga0466972_0076192 | |||
| 534 | Ga0466966_0019262 | |||
| 535 | Ga0466961_0027432 | |||
| 536 | Ga0466964_0015707 | |||
| 537 | Ga0453684_1219055 | |||
| 538 | Ga0466971_0027849 | |||
| 539 | Ga0466970_0126360 | |||
| 540 | Ga0466957_1084046 | |||
| 541 | Ga0451576_0884613 | |||
| 542 | Ga0451576_1102378 | |||
| 543 | Ga0466958_0559383 | |||
| 544 | Ga0466967_0114364 | |||
| 545 | Ga0495629_0656231 | |||
| 546 | Ga0495638_0000004 | |||
| 547 | Ga0495653_0512785 | |||
| 548 | Ga0495650_0017971 | |||
| 549 | Ga0495630_0008561 | |||
| 550 | Ga0495632_0112201 | |||
| 551 | Ga0495632_0115528 | |||
| 552 | Ga0495643_0147404 | |||
| 553 | Ga0495643_0267536 | |||
| 554 | Ga0495642_0042451 | |||
| 555 | Ga0495654_0002265 | |||
| 556 | Ga0495621_0064589 | |||
| 557 | Ga0495611_0013987 | |||
| 558 | Ga0495669_0168781 | |||
| 559 | Ga0495624_0027574 | |||
| 560 | Ga0495674_0008260 | |||
| 561 | Ga0495674_0277552 | |||
| 562 | Ga0495676_0382388 | |||
| 563 | Ga0495687_070740 | |||
| 564 | Ga0495602_0032791 | |||
| 565 | Ga0495614_0070615 | |||
| 566 | Ga0496101_0052121 | |||
| 567 | Ga0496102_0005583 | |||
| 568 | Ga0496102_0010570 | |||
| 569 | Ga0496102_0091837 | |||
| 570 | Ga0496102_0242672 | |||
| 571 | Ga0496103_0101333 | |||
| 572 | Ga0496106_0057564 | |||
| 573 | Ga0496106_0063401 | |||
| 574 | Ga0496106_0629158 | |||
| 575 | Ga0496107_0187977 | |||
| 576 | Ga0496107_0742854 | |||
| 577 | Ga0496108_0225368 | |||
| 578 | Ga0496109_0041522 | |||
| 579 | Ga0496109_0504690 | |||
| 580 | Ga0496110_0210080 | |||
| 581 | Ga0496110_0442585 | |||
| 582 | Ga0496111_0191888 | |||
| 583 | Ga0496112_0481634 | |||
| 584 | Ga0496112_0541374 | |||
| 585 | Ga0496113_0249087 | |||
| 586 | Ga0496113_0390484 | |||
| 587 | Ga0496113_0835322 | |||
| 588 | Ga0496114_0010920 | |||
| 589 | Ga0496114_0036571 | |||
| 590 | Ga0496115_1003569 | |||
| 591 | Ga0496118_0034101 | |||
| 592 | Ga0496121_0050656 | |||
| 593 | Ga0496121_0569058 | |||
| 594 | Ga0496125_0047353 | |||
| 595 | Ga0496126_0717456 | |||
| 596 | Ga0501036_0042055 | |||
| 597 | Ga0501037_0140704 | |||
| 598 | Ga0501037_0556886 | |||
| 599 | Ga0501038_0154103 | |||
| 600 | Ga0501039_0002626 | |||
| 601 | Ga0501041_0018849 | |||
| 602 | Ga0501042_0054777 | |||
| 603 | Ga0501043_0759143 | |||
| 604 | Ga0501046_0074474 | |||
| 605 | Ga0501046_0657534 | |||
| 606 | Ga0501068_0031000 | |||
| 607 | Ga0501069_0399399 | |||
| 608 | Ga0501072_0008329 | |||
| 609 | Ga0501075_0001378 | |||
| 610 | Ga0501075_0051602 | |||
| 611 | Ga0501076_0000031 | |||
| 612 | Ga0501076_0004285 | |||
| 613 | Ga0501077_0045359 | |||
| 614 | Ga0501217_000954 | |||
| 615 | Ga0501235_163736 | |||
| 616 | Ga0501247_082268 | |||
| 617 | Ga0501252_005105 | |||
| 618 | Ga0501079_0012355 | |||
| 619 | Ga0501080_0003854 | |||
| 620 | Ga0501081_0000191 | |||
| 621 | Ga0501045_0000383 | |||
| 622 | Ga0501045_0431201 | |||
| 623 | Ga0501226_000004 | |||
| 624 | nmdc:mga03n38_13386_c1 | |||
| 625 | nmdc:mga0yw44_53533_c1 | |||
| 626 | nmdc:mga0k408_10191_c1 | |||
| 627 | nmdc:mga0k408_104380_c1 | |||
| 628 | nmdc:mga0k408_89870_c1 | |||
| 629 | nmdc:mga06z11_4763_c1 | |||
| 630 | nmdc:mga07m45_284686_c1 | |||
| 631 | nmdc:mga07m45_549728_c1 | |||
| 632 | nmdc:mga0qj67_1297372_c1 | |||
| 633 | Ga0500644_0006260 | |||
| 634 | Ga0500583_0068668 | |||
| 635 | Ga0500583_0070027 | |||
| 636 | Ga0500583_0183986 | |||
| 637 | Ga0500641_0096086 | |||
| 638 | Ga0500557_007680 | |||
| 639 | Ga0500569_155419 | |||
| 640 | Ga0500593_001913 | |||
| 641 | Ga0500594_0077461 | |||
| 642 | Ga0500608_291058 | |||
| 643 | Ga0500628_002571 | |||
| 644 | Ga0500642_0058370 | |||
| 645 | Ga0500655_002429 | |||
| 646 | Ga0500604_0000393 | |||
| 647 | Ga0500616_0000049 | |||
| 648 | Ga0500645_008419 | |||
| 649 | Ga0500656_026807 | |||
| 650 | Ga0501084_0004406 | |||
| 651 | Ga0501082_0003366 | |||
| 652 | Ga0466962_0008023 | |||
| 653 | Ga0530510_0005597 | |||
| 654 | 2739251598 | |||
| 655 | 2808906680 | |||
| 656 | 2904547043 | |||
| 657 | 2929164592 | |||
| 658 | 2945910801 | |||
| 659 | 2945987015 | |||
| 660 | 2954771446 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1oru-assembly1.cif.gz_B | crystal structure of apc1665, yuad protein from bacillus subtilis | 0.8029 | 17 | 172 |
| 1o67-assembly1.cif.gz_A | crystal structure of an hypothetical protein | 0.7906 | 17 | 167 |
| 1o65-assembly2.cif.gz_B | crystal structure of an hypothetical protein | 0.7643 | 17 | 167 |
| 1o65-assembly1.cif.gz_A | crystal structure of an hypothetical protein | 0.7528 | 17 | 167 |
| 5yhi-assembly1.cif.gz_B | crystal structure of yiim from escherichia coli | 0.7488 | 20 | 172 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1oruB00 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.7811 | 18 | 172 | 2.40.33.20 |
| 5yhiA00 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.7552 | 20 | 172 | 2.40.33.20 |
| af_Q2FVS9_1_216_2.40.33.20 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.7537 | 20 | 168 | 2.40.33.20 |
| af_P95151_15_247_2.40.33.20 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.7437 | 14 | 168 | 2.40.33.20 |
| 1oruB00 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.7047 | 18 | 172 | 2.40.33.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A554RYV3-F1-model_v4 | MOSC domain-containing protein | 0.9955 | 5 | 172 |
GO:0003824
GO:0030151 GO:0030170 |
| AF-F5Y4T3-F1-model_v4 | MOSC domain-containing protein | 0.9938 | 5 | 171 |
GO:0003824
GO:0030151 GO:0030170 |
| AF-A0A2G6WUD8-F1-model_v4 | MOSC domain-containing protein | 0.993 | 1 | 172 |
GO:0003824
GO:0030151 GO:0030170 |
| AF-A0A2G6WUD8-F1-model_v4 | MOSC domain-containing protein | 0.9872 | 1 | 172 |
GO:0003824
GO:0030151 GO:0030170 |
| AF-A0A5B8CUL7-F1-model_v4 | MOSC domain-containing protein | 0.9834 | 4 | 169 |
GO:0003824
GO:0030151 GO:0030170 |