F410166
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 330 | 201 | 313 | 275 |
Family's Representative Sequence
| Representative Sequence | 3300032004|Ga0307414_10051141|Ga0307414_100511413 |
| Length | 306 |
| Sequence | MADQAPAAQPQTAPPVNGKPPEFVDPGAGRRFPPKGQPLIQGFNRIGLWSLYMKEVRRFLKVQTQTVWAPAITTLLFLVIFTVALGGPAGRGGRVVLGVSFATFVAPGLIMMGMMQNAFANSSFSLLAGKIQGTIIDLLMPPLTEAELMIGIIAASITRAVMVGAAVTLAMALWPGVDLMAAHPWAIVWFGLMGSTMLALLGLLASIWAEKFDHAAAVTNFVVAPLSLLSGTFYVIGNLSEPFQAISRANPFFYMISGFRFGFIGESDIGNTNEAVIGAAVGAGVLNLVLGFAAYRLLKSGWKIKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 4 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 5 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 6 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 7 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 8 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 9 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 10 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 11 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 12 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 13 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 14 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 15 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 16 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 17 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 18 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 19 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 56 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 59 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 62 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 63 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 82 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 118 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 120 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 121 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 122 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 123 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 124 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 125 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 126 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 127 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 128 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 129 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 130 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 131 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 132 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 133 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 150 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 151 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 152 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 153 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 154 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 156 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 157 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 158 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 159 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 160 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 161 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 162 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 163 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 164 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 165 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 166 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 167 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 168 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 169 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 170 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 171 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 176 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 179 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 180 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 181 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 182 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 183 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 184 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 185 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 186 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 187 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 188 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 189 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 190 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 191 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 192 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 193 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 194 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 195 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 196 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 197 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 198 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 199 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 200 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 201 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.85 |
| Metatranscriptomes | 0 |
| Isolates | 5.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.58 |
| Nodule | 0 |
| Rhizoplane | 5.15 |
| Rhizosphere | 65.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2924680 | 2162886007 | Bacteria | 1887 |
| 2 | SwRhRL2b_contig_3541668 | 2162886007 | Bacteria | 1869 |
| 3 | JGI24751J29686_10000299 | 3300002459 | Bacteria | 18728 |
| 4 | JGI24751J29686_10024934 | 3300002459 | Bacteria | 1241 |
| 5 | Ga0055530_10003245 | 3300003791 | Bacteria | 9487 |
| 6 | Ga0065704_10070806 | 3300005289 | Bacteria | 15903 |
| 7 | Ga0065704_10079185 | 3300005289 | Bacteria | 4236 |
| 8 | Ga0070658_10000124 | 3300005327 | Bacteria | 68224 |
| 9 | Ga0070658_10097055 | 3300005327 | Bacteria | 2433 |
| 10 | Ga0070658_10288700 | 3300005327 | Bacteria | 1398 |
| 11 | Ga0070690_100289624 | 3300005330 | Bacteria | 1171 |
| 12 | Ga0070670_100039326 | 3300005331 | Bacteria | 4067 |
| 13 | Ga0070666_10046639 | 3300005335 | Bacteria | 2907 |
| 14 | Ga0070666_10089738 | 3300005335 | Bacteria | 2110 |
| 15 | Ga0070680_100024370 | 3300005336 | Bacteria | 4833 |
| 16 | Ga0070680_100191118 | 3300005336 | Bacteria | 1725 |
| 17 | Ga0070682_100198390 | 3300005337 | Bacteria | 1414 |
| 18 | Ga0070660_100024232 | 3300005339 | Bacteria | 4502 |
| 19 | Ga0070689_100018286 | 3300005340 | Bacteria | 5161 |
| 20 | Ga0070661_100014008 | 3300005344 | Bacteria | 5638 |
| 21 | Ga0070668_100240293 | 3300005347 | Bacteria | 1500 |
| 22 | Ga0070669_100002298 | 3300005353 | Bacteria | 13851 |
| 23 | Ga0070669_100094923 | 3300005353 | Bacteria | 2242 |
| 24 | Ga0070669_100098928 | 3300005353 | Bacteria | 2198 |
| 25 | Ga0070671_100000545 | 3300005355 | Bacteria | 26618 |
| 26 | Ga0070671_100012194 | 3300005355 | Bacteria | 6918 |
| 27 | Ga0070671_100031293 | 3300005355 | Bacteria | 4395 |
| 28 | Ga0070671_100091685 | 3300005355 | Bacteria | 2545 |
| 29 | Ga0070659_100009671 | 3300005366 | Bacteria | 7085 |
| 30 | Ga0070659_100140540 | 3300005366 | Bacteria | 1966 |
| 31 | Ga0070659_100146865 | 3300005366 | Bacteria | 1922 |
| 32 | Ga0070667_100021758 | 3300005367 | Bacteria | 5321 |
| 33 | Ga0070667_100108965 | 3300005367 | Bacteria | 2400 |
| 34 | Ga0070662_100004063 | 3300005457 | Bacteria | 9193 |
| 35 | Ga0070681_10118923 | 3300005458 | Bacteria | 2578 |
| 36 | Ga0070685_10275305 | 3300005466 | Bacteria | 1125 |
| 37 | Ga0070679_100002641 | 3300005530 | Bacteria | 16306 |
| 38 | Ga0070679_100004736 | 3300005530 | Bacteria | 12550 |
| 39 | Ga0070679_100099296 | 3300005530 | Bacteria | 2898 |
| 40 | Ga0070684_100006396 | 3300005535 | Bacteria | 9111 |
| 41 | Ga0068853_100024528 | 3300005539 | Bacteria | 5057 |
| 42 | Ga0068853_100041290 | 3300005539 | Bacteria | 3939 |
| 43 | Ga0070665_100110826 | 3300005548 | Bacteria | 2747 |
| 44 | Ga0068855_100011815 | 3300005563 | Bacteria | 10558 |
| 45 | Ga0068855_100022295 | 3300005563 | Bacteria | 7589 |
| 46 | Ga0068855_100073002 | 3300005563 | Bacteria | 3987 |
| 47 | Ga0068855_100127907 | 3300005563 | Bacteria | 2903 |
| 48 | Ga0070664_100005668 | 3300005564 | Bacteria | 10053 |
| 49 | Ga0070664_100066251 | 3300005564 | Bacteria | 3084 |
| 50 | Ga0068857_100019462 | 3300005577 | Bacteria | 5962 |
| 51 | Ga0068857_100071026 | 3300005577 | Bacteria | 3102 |
| 52 | Ga0068854_100009241 | 3300005578 | Bacteria | 6359 |
| 53 | Ga0068854_100110533 | 3300005578 | Bacteria | 2072 |
| 54 | Ga0068856_100108820 | 3300005614 | Bacteria | 2767 |
| 55 | Ga0068856_100161135 | 3300005614 | Bacteria | 2254 |
| 56 | Ga0068856_100458871 | 3300005614 | Bacteria | 1295 |
| 57 | Ga0068852_100020817 | 3300005616 | Bacteria | 5220 |
| 58 | Ga0068852_100032319 | 3300005616 | Bacteria | 4332 |
| 59 | Ga0068852_100226964 | 3300005616 | Bacteria | 1779 |
| 60 | Ga0068859_100055635 | 3300005617 | Bacteria | 3981 |
| 61 | Ga0068859_100077010 | 3300005617 | Bacteria | 3376 |
| 62 | Ga0068851_10079343 | 3300005834 | Bacteria | 1712 |
| 63 | Ga0068863_100000006 | 3300005841 | Bacteria | 265379 |
| 64 | Ga0068863_100010974 | 3300005841 | Bacteria | 8785 |
| 65 | Ga0068858_100013874 | 3300005842 | Bacteria | 7602 |
| 66 | Ga0068858_100046090 | 3300005842 | Bacteria | 4042 |
| 67 | Ga0068858_100067582 | 3300005842 | Bacteria | 3311 |
| 68 | Ga0068860_100022768 | 3300005843 | Bacteria | 6058 |
| 69 | Ga0068860_100028274 | 3300005843 | Bacteria | 5396 |
| 70 | Ga0068862_100031787 | 3300005844 | Bacteria | 4458 |
| 71 | Ga0075368_10000893 | 3300006042 | Bacteria | 9254 |
| 72 | Ga0075363_100001685 | 3300006048 | Bacteria | 8567 |
| 73 | Ga0075363_100044645 | 3300006048 | Bacteria | 2348 |
| 74 | Ga0075364_10067654 | 3300006051 | Bacteria | 2348 |
| 75 | Ga0075432_10005801 | 3300006058 | Bacteria | 4200 |
| 76 | Ga0075362_10000003 | 3300006177 | Bacteria | 171099 |
| 77 | Ga0075362_10005149 | 3300006177 | Bacteria | 4762 |
| 78 | Ga0075362_10166165 | 3300006177 | Bacteria | 1064 |
| 79 | Ga0075367_10002046 | 3300006178 | Bacteria | 9023 |
| 80 | Ga0075369_10007219 | 3300006186 | Bacteria | 4224 |
| 81 | Ga0075369_10009614 | 3300006186 | Bacteria | 3762 |
| 82 | Ga0075369_10018793 | 3300006186 | Bacteria | 2817 |
| 83 | Ga0075366_10000006 | 3300006195 | Bacteria | 106522 |
| 84 | Ga0075366_10005726 | 3300006195 | Bacteria | 6745 |
| 85 | Ga0075366_10106012 | 3300006195 | Bacteria | 1689 |
| 86 | Ga0075370_10000088 | 3300006353 | Bacteria | 28442 |
| 87 | Ga0075370_10030243 | 3300006353 | Bacteria | 3020 |
| 88 | Ga0075370_10065894 | 3300006353 | Bacteria | 2066 |
| 89 | Ga0097620_100055637 | 3300006931 | Bacteria | 3981 |
| 90 | Ga0097620_100077010 | 3300006931 | Bacteria | 3376 |
| 91 | Ga0105250_10004007 | 3300009092 | Bacteria | 6870 |
| 92 | Ga0105240_10002395 | 3300009093 | Bacteria | 30188 |
| 93 | Ga0105240_10005088 | 3300009093 | Bacteria | 19700 |
| 94 | Ga0111539_10564142 | 3300009094 | Bacteria | 1326 |
| 95 | Ga0105247_10306519 | 3300009101 | Bacteria | 1103 |
| 96 | Ga0105248_10527975 | 3300009177 | Bacteria | 1331 |
| 97 | Ga0105238_10324810 | 3300009551 | Bacteria | 1525 |
| 98 | Ga0105249_10167167 | 3300009553 | Bacteria | 2130 |
| 99 | Ga0105246_10000333 | 3300011119 | Bacteria | 25060 |
| 100 | Ga0157373_10013141 | 3300013100 | Bacteria | 6078 |
| 101 | Ga0157373_10026951 | 3300013100 | Bacteria | 4147 |
| 102 | Ga0157371_10007116 | 3300013102 | Bacteria | 9091 |
| 103 | Ga0157371_10028906 | 3300013102 | Bacteria | 4014 |
| 104 | Ga0157371_10070098 | 3300013102 | Bacteria | 2482 |
| 105 | Ga0157370_10055946 | 3300013104 | Bacteria | 3755 |
| 106 | Ga0157370_10231582 | 3300013104 | Bacteria | 1710 |
| 107 | Ga0157369_10013298 | 3300013105 | Bacteria | 9312 |
| 108 | Ga0157369_10337042 | 3300013105 | Bacteria | 1567 |
| 109 | Ga0163162_10095034 | 3300013306 | Bacteria | 3067 |
| 110 | Ga0157372_10155331 | 3300013307 | Bacteria | 2643 |
| 111 | Ga0157372_10278762 | 3300013307 | Bacteria | 1943 |
| 112 | Ga0163163_10080189 | 3300014325 | Bacteria | 3264 |
| 113 | Ga0163161_10270220 | 3300017792 | Bacteria | 1330 |
| 114 | Ga0213872_10011295 | 3300021361 | Bacteria | 4230 |
| 115 | Ga0209050_1000277 | 3300025298 | Bacteria | 109132 |
| 116 | Ga0207697_10017352 | 3300025315 | Bacteria | 2958 |
| 117 | Ga0207656_10056310 | 3300025321 | Bacteria | 1714 |
| 118 | Ga0207696_1009011 | 3300025711 | Bacteria | 3751 |
| 119 | Ga0207710_10106059 | 3300025900 | Bacteria | 1330 |
| 120 | Ga0207647_10058696 | 3300025904 | Bacteria | 2356 |
| 121 | Ga0207647_10085482 | 3300025904 | Bacteria | 1887 |
| 122 | Ga0207705_10000009 | 3300025909 | Bacteria | 576128 |
| 123 | Ga0207705_10069936 | 3300025909 | Bacteria | 2543 |
| 124 | Ga0207654_10094128 | 3300025911 | Bacteria | 1833 |
| 125 | Ga0207707_10251784 | 3300025912 | Bacteria | 1534 |
| 126 | Ga0207695_10027935 | 3300025913 | Bacteria | 6271 |
| 127 | Ga0207695_10076639 | 3300025913 | Bacteria | 3398 |
| 128 | Ga0207657_10007000 | 3300025919 | Bacteria | 11609 |
| 129 | Ga0207649_10102463 | 3300025920 | Bacteria | 1897 |
| 130 | Ga0207649_10378502 | 3300025920 | Bacteria | 1054 |
| 131 | Ga0207652_10012692 | 3300025921 | Bacteria | 6813 |
| 132 | Ga0207652_10043276 | 3300025921 | Bacteria | 3835 |
| 133 | Ga0207681_10000137 | 3300025923 | Bacteria | 60426 |
| 134 | Ga0207681_10001319 | 3300025923 | Bacteria | 16007 |
| 135 | Ga0207681_10103229 | 3300025923 | Bacteria | 2060 |
| 136 | Ga0207694_10343247 | 3300025924 | Bacteria | 1235 |
| 137 | Ga0207644_10000053 | 3300025931 | Bacteria | 90831 |
| 138 | Ga0207644_10022873 | 3300025931 | Bacteria | 4274 |
| 139 | Ga0207644_10027868 | 3300025931 | Bacteria | 3905 |
| 140 | Ga0207690_10002987 | 3300025932 | Bacteria | 10186 |
| 141 | Ga0207706_10004487 | 3300025933 | Bacteria | 13106 |
| 142 | Ga0207706_10066315 | 3300025933 | Bacteria | 3177 |
| 143 | Ga0207709_10061655 | 3300025935 | Bacteria | 2344 |
| 144 | Ga0207670_10135855 | 3300025936 | Bacteria | 1807 |
| 145 | Ga0207711_10049535 | 3300025941 | Bacteria | 3596 |
| 146 | Ga0207711_10109757 | 3300025941 | Bacteria | 2452 |
| 147 | Ga0207661_10035165 | 3300025944 | Bacteria | 3901 |
| 148 | Ga0207679_10105119 | 3300025945 | Bacteria | 2217 |
| 149 | Ga0207679_10357020 | 3300025945 | Bacteria | 1275 |
| 150 | Ga0207667_10020048 | 3300025949 | Bacteria | 7445 |
| 151 | Ga0207667_10026720 | 3300025949 | Bacteria | 6301 |
| 152 | Ga0207667_10117253 | 3300025949 | Bacteria | 2744 |
| 153 | Ga0207667_10294569 | 3300025949 | Bacteria | 1658 |
| 154 | Ga0207668_10008565 | 3300025972 | Bacteria | 6102 |
| 155 | Ga0207640_10017316 | 3300025981 | Bacteria | 4215 |
| 156 | Ga0207640_10065025 | 3300025981 | Bacteria | 2432 |
| 157 | Ga0207658_10007296 | 3300025986 | Bacteria | 7539 |
| 158 | Ga0207658_10014837 | 3300025986 | Bacteria | 5339 |
| 159 | Ga0207658_10020496 | 3300025986 | Bacteria | 4578 |
| 160 | Ga0207703_10022146 | 3300026035 | Bacteria | 4981 |
| 161 | Ga0207703_10038642 | 3300026035 | Bacteria | 3811 |
| 162 | Ga0207639_10003549 | 3300026041 | Bacteria | 10481 |
| 163 | Ga0207639_10013056 | 3300026041 | Bacteria | 5800 |
| 164 | Ga0207702_10008724 | 3300026078 | Bacteria | 8548 |
| 165 | Ga0207702_10091538 | 3300026078 | Bacteria | 2663 |
| 166 | Ga0207641_10000054 | 3300026088 | Bacteria | 170887 |
| 167 | Ga0207641_10056095 | 3300026088 | Bacteria | 3347 |
| 168 | Ga0207641_10275454 | 3300026088 | Bacteria | 1580 |
| 169 | Ga0207676_10711850 | 3300026095 | Bacteria | 974 |
| 170 | Ga0207674_10011479 | 3300026116 | Bacteria | 9952 |
| 171 | Ga0207674_10056611 | 3300026116 | Bacteria | 3980 |
| 172 | Ga0207674_10160499 | 3300026116 | Bacteria | 2203 |
| 173 | Ga0207698_10000111 | 3300026142 | Bacteria | 50675 |
| 174 | Ga0207698_10167373 | 3300026142 | Bacteria | 1931 |
| 175 | Ga0207698_10327813 | 3300026142 | Bacteria | 1437 |
| 176 | Ga0209813_10000243 | 3300027866 | Bacteria | 16043 |
| 177 | Ga0207428_10158288 | 3300027907 | Bacteria | 1721 |
| 178 | Ga0268265_10015588 | 3300028380 | Bacteria | 5203 |
| 179 | Ga0307405_10020490 | 3300031731 | Bacteria | 3696 |
| 180 | Ga0307410_10067504 | 3300031852 | Bacteria | 2467 |
| 181 | Ga0307406_10019699 | 3300031901 | Bacteria | 3963 |
| 182 | Ga0307412_10073356 | 3300031911 | Bacteria | 2341 |
| 183 | Ga0307412_10109232 | 3300031911 | Bacteria | 1971 |
| 184 | Ga0307412_10142979 | 3300031911 | Bacteria | 1755 |
| 185 | Ga0307416_100175626 | 3300032002 | Bacteria | 2000 |
| 186 | Ga0307416_100733811 | 3300032002 | Bacteria | 1079 |
| 187 | Ga0307414_10051141 | 3300032004 | Bacteria | 2866 |
| 188 | Ga0307414_10073922 | 3300032004 | Bacteria | 2467 |
| 189 | Ga0307414_10100799 | 3300032004 | Bacteria | 2173 |
| 190 | Ga0307414_10125310 | 3300032004 | Bacteria | 1983 |
| 191 | Ga0307414_10190702 | 3300032004 | Bacteria | 1658 |
| 192 | Ga0307414_10227360 | 3300032004 | Bacteria | 1536 |
| 193 | Ga0307411_10215040 | 3300032005 | Bacteria | 1487 |
| 194 | Ga0307411_10409658 | 3300032005 | Bacteria | 1123 |
| 195 | Ga0307415_100167265 | 3300032126 | Bacteria | 1711 |
| 196 | Ga0316583_10001801 | 3300032133 | Bacteria | 7284 |
| 197 | Ga0436364_0669604 | 3300037853 | Bacteria | 763 |
| 198 | Ga0436361_0551543 | 3300039447 | Bacteria | 18800 |
| 199 | Ga0439462_0000040 | 3300042015 | Bacteria | 18378 |
| 200 | Ga0450912_000154 | 3300042116 | Bacteria | 2670 |
| 201 | Ga0453684_0065976 | 3300044712 | Bacteria | 4612 |
| 202 | Ga0495638_0097704 | 3300046460 | Bacteria | 1760 |
| 203 | Ga0495638_0104851 | 3300046460 | Bacteria | 1686 |
| 204 | Ga0495638_0125247 | 3300046460 | Bacteria | 1515 |
| 205 | Ga0495650_0091029 | 3300046471 | Bacteria | 1160 |
| 206 | Ga0495596_0001908 | 3300046500 | Bacteria | 11575 |
| 207 | Ga0495607_0007418 | 3300046501 | Bacteria | 7592 |
| 208 | Ga0495606_0005638 | 3300046507 | Bacteria | 11870 |
| 209 | Ga0495606_0010708 | 3300046507 | Bacteria | 7566 |
| 210 | Ga0495610_0000015 | 3300046512 | Bacteria | 391489 |
| 211 | Ga0495610_0000300 | 3300046512 | Bacteria | 52078 |
| 212 | Ga0495620_0043177 | 3300046515 | Bacteria | 1965 |
| 213 | Ga0495632_0001359 | 3300046519 | Bacteria | 20574 |
| 214 | Ga0495643_0000023 | 3300046522 | Bacteria | 288590 |
| 215 | Ga0495643_0008645 | 3300046522 | Bacteria | 6425 |
| 216 | Ga0495643_0098066 | 3300046522 | Bacteria | 1505 |
| 217 | Ga0495633_0051267 | 3300046558 | Bacteria | 1945 |
| 218 | Ga0495625_0044676 | 3300046660 | Bacteria | 3206 |
| 219 | Ga0495670_0197526 | 3300046691 | Bacteria | 1065 |
| 220 | Ga0495686_0115879 | 3300047472 | Bacteria | 1602 |
| 221 | Ga0495615_0000041 | 3300048090 | Bacteria | 43189 |
| 222 | Ga0495626_0005484 | 3300048091 | Bacteria | 7394 |
| 223 | Ga0496100_0152528 | 3300048903 | Bacteria | 1649 |
| 224 | Ga0496102_0001387 | 3300048905 | Bacteria | 21558 |
| 225 | Ga0496102_0041759 | 3300048905 | Bacteria | 4155 |
| 226 | Ga0496103_0000482 | 3300048906 | Bacteria | 33508 |
| 227 | Ga0496103_0105884 | 3300048906 | Bacteria | 1783 |
| 228 | Ga0496104_0003250 | 3300048907 | Bacteria | 14008 |
| 229 | Ga0496104_0050534 | 3300048907 | Bacteria | 3922 |
| 230 | Ga0496105_0000549 | 3300048908 | Bacteria | 24748 |
| 231 | Ga0496106_0214345 | 3300048909 | Bacteria | 1534 |
| 232 | Ga0496108_0173887 | 3300048911 | Bacteria | 1864 |
| 233 | Ga0496110_0064368 | 3300048913 | Bacteria | 3240 |
| 234 | Ga0496111_0066199 | 3300048914 | Bacteria | 2623 |
| 235 | Ga0496111_0125301 | 3300048914 | Bacteria | 1898 |
| 236 | Ga0496113_0000100 | 3300048916 | Bacteria | 36225 |
| 237 | Ga0496113_0001390 | 3300048916 | Bacteria | 13452 |
| 238 | Ga0496114_0542365 | 3300048917 | Bacteria | 1028 |
| 239 | Ga0496115_0119234 | 3300048918 | Bacteria | 2170 |
| 240 | Ga0496116_0000017 | 3300048919 | Bacteria | 554463 |
| 241 | Ga0496116_0043827 | 3300048919 | Bacteria | 3044 |
| 242 | Ga0496117_0000566 | 3300048920 | Bacteria | 60778 |
| 243 | Ga0496118_0025169 | 3300048921 | Bacteria | 5113 |
| 244 | Ga0496118_0113240 | 3300048921 | Bacteria | 1793 |
| 245 | Ga0496119_0001659 | 3300048922 | Bacteria | 26156 |
| 246 | Ga0496120_0013870 | 3300048923 | Bacteria | 5396 |
| 247 | Ga0496121_0000031 | 3300048924 | Bacteria | 384119 |
| 248 | Ga0496121_0001344 | 3300048924 | Bacteria | 42068 |
| 249 | Ga0496121_0008806 | 3300048924 | Bacteria | 11756 |
| 250 | Ga0496121_0154156 | 3300048924 | Bacteria | 1687 |
| 251 | Ga0496122_0001874 | 3300048925 | Bacteria | 31963 |
| 252 | Ga0496122_0003911 | 3300048925 | Bacteria | 19065 |
| 253 | Ga0496123_0000984 | 3300048926 | Bacteria | 43992 |
| 254 | Ga0496123_0001801 | 3300048926 | Bacteria | 28191 |
| 255 | Ga0496123_0002940 | 3300048926 | Bacteria | 19911 |
| 256 | Ga0496124_0001679 | 3300048927 | Bacteria | 31447 |
| 257 | Ga0496124_0052927 | 3300048927 | Bacteria | 3446 |
| 258 | Ga0496124_0168785 | 3300048927 | Bacteria | 1697 |
| 259 | Ga0496125_0001603 | 3300048928 | Bacteria | 31974 |
| 260 | Ga0496125_0085292 | 3300048928 | Bacteria | 2393 |
| 261 | Ga0496126_0000543 | 3300048929 | Bacteria | 72785 |
| 262 | Ga0496126_0001625 | 3300048929 | Bacteria | 33995 |
| 263 | Ga0496126_0010177 | 3300048929 | Bacteria | 9897 |
| 264 | Ga0496126_0055011 | 3300048929 | Bacteria | 3602 |
| 265 | Ga0496126_0135212 | 3300048929 | Bacteria | 2127 |
| 266 | Ga0501031_0143405 | 3300049568 | Bacteria | 1561 |
| 267 | Ga0501034_0095190 | 3300049571 | Bacteria | 2975 |
| 268 | Ga0501034_0152676 | 3300049571 | Bacteria | 2285 |
| 269 | Ga0501036_0306860 | 3300049572 | Bacteria | 1327 |
| 270 | Ga0501047_0241581 | 3300049581 | Bacteria | 1657 |
| 271 | Ga0501249_000546 | 3300049679 | Bacteria | 9061 |
| 272 | Ga0501080_0317977 | 3300049742 | Bacteria | 1410 |
| 273 | Ga0501044_0000290 | 3300049823 | Bacteria | 63934 |
| 274 | Ga0501044_0189245 | 3300049823 | Bacteria | 2022 |
| 275 | Ga0501044_0199332 | 3300049823 | Bacteria | 1961 |
| 276 | nmdc:mga03683_22_c1 | 3300050489 | Bacteria | 82016 |
| 277 | nmdc:mga03683_373_c1 | 3300050489 | Bacteria | 12879 |
| 278 | nmdc:mga03683_4162_c1 | 3300050489 | Bacteria | 4762 |
| 279 | nmdc:mga03n38_11278_c1 | 3300050490 | Bacteria | 3323 |
| 280 | nmdc:mga00v17_28069_c1 | 3300050491 | Bacteria | 3293 |
| 281 | nmdc:mga00v17_7002_c1 | 3300050491 | Bacteria | 6001 |
| 282 | nmdc:mga0yw44_25503_c1 | 3300050492 | Bacteria | 3363 |
| 283 | nmdc:mga0k408_11023_c3 | 3300050493 | Bacteria | 1635 |
| 284 | nmdc:mga0k408_38827_c1 | 3300050493 | Bacteria | 2734 |
| 285 | nmdc:mga0k408_85248_c1 | 3300050493 | Bacteria | 1854 |
| 286 | nmdc:mga0k408_8_c1 | 3300050493 | Bacteria | 161211 |
| 287 | nmdc:mga06z11_349_c1 | 3300050494 | Bacteria | 17408 |
| 288 | nmdc:mga04h51_523_c1 | 3300050495 | Bacteria | 9109 |
| 289 | nmdc:mga07m45_110206_c1 | 3300050496 | Bacteria | 1585 |
| 290 | nmdc:mga07m45_15_c1 | 3300050496 | Bacteria | 152740 |
| 291 | nmdc:mga07m45_20_c1 | 3300050496 | Bacteria | 126269 |
| 292 | nmdc:mga0sz30_11928_c1 | 3300050516 | Bacteria | 3369 |
| 293 | nmdc:mga0sz30_12326_c1 | 3300050516 | Bacteria | 3325 |
| 294 | nmdc:mga0sz30_39_c1 | 3300050516 | Bacteria | 12429 |
| 295 | nmdc:mga0sz30_9129_c1 | 3300050516 | Bacteria | 3762 |
| 296 | Ga0500643_000004 | 3300053087 | Bacteria | 857484 |
| 297 | Ga0500646_0101228 | 3300053090 | Bacteria | 905 |
| 298 | Ga0500566_0172687 | 3300053094 | Bacteria | 1116 |
| 299 | Ga0500607_000231 | 3300053121 | Bacteria | 51561 |
| 300 | Ga0500607_001306 | 3300053121 | Bacteria | 22788 |
| 301 | Ga0500608_000175 | 3300053122 | Bacteria | 26374 |
| 302 | Ga0500614_009316 | 3300053123 | Bacteria | 2095 |
| 303 | Ga0500618_003935 | 3300053125 | Bacteria | 4927 |
| 304 | Ga0500559_0000228 | 3300053136 | Bacteria | 44687 |
| 305 | Ga0500559_0015428 | 3300053136 | Bacteria | 3225 |
| 306 | Ga0500559_0029253 | 3300053136 | Bacteria | 2358 |
| 307 | Ga0500564_015324 | 3300053138 | Bacteria | 3459 |
| 308 | Ga0500590_010576 | 3300053148 | Bacteria | 4663 |
| 309 | Ga0500616_0004004 | 3300053153 | Bacteria | 10744 |
| 310 | Ga0500637_0021671 | 3300053178 | Bacteria | 3493 |
| 311 | Ga0500567_002662 | 3300053723 | Bacteria | 7730 |
| 312 | Ga0500625_000002 | 3300053729 | Bacteria | 371909 |
| 313 | Ga0500645_037456 | 3300053730 | Bacteria | 1440 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037853 | Ga0436364_0669604 | Ga0436364_0669604_27_725 | 202 |
| 2 | iso_pu_bacteria | 2928100450 | 2928104631 | 214 |
| 3 | 3300048925 | Ga0496122_0003911 | Ga0496122_0003911_18237_19019 | 215 |
| 4 | 3300005335 | Ga0070666_10089738 | Ga0070666_100897383 | 217 |
| 5 | 3300009093 | Ga0105240_10002395 | Ga0105240_1000239511 | 217 |
| 6 | 3300025913 | Ga0207695_10027935 | Ga0207695_100279356 | 217 |
| 7 | 3300006353 | Ga0075370_10030243 | Ga0075370_100302431 | 225 |
| 8 | 3300046471 | Ga0495650_0091029 | Ga0495650_0091029_107_889 | 225 |
| 9 | iso_pu_bacteria | 2643221588 | 2643950156 | 227 |
| 10 | 3300002459 | JGI24751J29686_10024934 | JGI24751J29686_100249341 | 228 |
| 11 | 3300031852 | Ga0307410_10067504 | Ga0307410_100675045 | 231 |
| 12 | 3300026095 | Ga0207676_10711850 | Ga0207676_107118501 | 232 |
| 13 | 3300025904 | Ga0207647_10085482 | Ga0207647_100854822 | 234 |
| 14 | 3300031911 | Ga0307412_10073356 | Ga0307412_100733562 | 234 |
| 15 | 3300048929 | Ga0496126_0055011 | Ga0496126_0055011_300_1148 | 236 |
| 16 | 3300044712 | Ga0453684_0065976 | Ga0453684_0065976_1133_2014 | 239 |
| 17 | 3300021361 | Ga0213872_10011295 | Ga0213872_100112951 | 240 |
| 18 | 3300039447 | Ga0436361_0551543 | Ga0436361_0551543_5402_6220 | 240 |
| 19 | 3300049572 | Ga0501036_0306860 | Ga0501036_0306860_481_1311 | 240 |
| 20 | 3300026142 | Ga0207698_10327813 | Ga0207698_103278132 | 241 |
| 21 | 3300006177 | Ga0075362_10005149 | Ga0075362_100051492 | 242 |
| 22 | 3300025935 | Ga0207709_10061655 | Ga0207709_100616552 | 242 |
| 23 | 3300050489 | nmdc:mga03683_4162_c1 | nmdc:mga03683_4162_c1_3007_3885 | 242 |
| 24 | 3300050516 | nmdc:mga0sz30_11928_c1 | nmdc:mga0sz30_11928_c1_2151_3029 | 242 |
| 25 | 3300005347 | Ga0070668_100240293 | Ga0070668_1002402932 | 243 |
| 26 | 3300005355 | Ga0070671_100012194 | Ga0070671_1000121946 | 243 |
| 27 | 3300005617 | Ga0068859_100055635 | Ga0068859_1000556353 | 243 |
| 28 | 3300005842 | Ga0068858_100013874 | Ga0068858_1000138746 | 243 |
| 29 | 3300006931 | Ga0097620_100055637 | Ga0097620_1000556373 | 243 |
| 30 | 3300025931 | Ga0207644_10027868 | Ga0207644_100278681 | 243 |
| 31 | 3300025941 | Ga0207711_10049535 | Ga0207711_100495352 | 243 |
| 32 | 3300026035 | Ga0207703_10022146 | Ga0207703_100221464 | 243 |
| 33 | 3300049679 | Ga0501249_000546 | Ga0501249_000546_7965_8792 | 243 |
| 34 | 3300005327 | Ga0070658_10097055 | Ga0070658_100970553 | 244 |
| 35 | 3300005336 | Ga0070680_100024370 | Ga0070680_1000243703 | 244 |
| 36 | 3300005339 | Ga0070660_100024232 | Ga0070660_1000242325 | 244 |
| 37 | 3300005344 | Ga0070661_100014008 | Ga0070661_1000140081 | 244 |
| 38 | 3300005366 | Ga0070659_100009671 | Ga0070659_1000096715 | 244 |
| 39 | 3300005366 | Ga0070659_100146865 | Ga0070659_1001468652 | 244 |
| 40 | 3300005457 | Ga0070662_100004063 | Ga0070662_1000040637 | 244 |
| 41 | 3300005458 | Ga0070681_10118923 | Ga0070681_101189233 | 244 |
| 42 | 3300005530 | Ga0070679_100004736 | Ga0070679_10000473614 | 244 |
| 43 | 3300005539 | Ga0068853_100041290 | Ga0068853_1000412903 | 244 |
| 44 | 3300005563 | Ga0068855_100022295 | Ga0068855_1000222953 | 244 |
| 45 | 3300005563 | Ga0068855_100073002 | Ga0068855_1000730022 | 244 |
| 46 | 3300005564 | Ga0070664_100005668 | Ga0070664_10000566810 | 244 |
| 47 | 3300005614 | Ga0068856_100108820 | Ga0068856_1001088203 | 244 |
| 48 | 3300025909 | Ga0207705_10069936 | Ga0207705_100699362 | 244 |
| 49 | 3300025911 | Ga0207654_10094128 | Ga0207654_100941283 | 244 |
| 50 | 3300025912 | Ga0207707_10251784 | Ga0207707_102517841 | 244 |
| 51 | 3300025919 | Ga0207657_10007000 | Ga0207657_100070004 | 244 |
| 52 | 3300025920 | Ga0207649_10102463 | Ga0207649_101024631 | 244 |
| 53 | 3300025921 | Ga0207652_10012692 | Ga0207652_100126923 | 244 |
| 54 | 3300025932 | Ga0207690_10002987 | Ga0207690_100029873 | 244 |
| 55 | 3300025933 | Ga0207706_10004487 | Ga0207706_100044873 | 244 |
| 56 | 3300025944 | Ga0207661_10035165 | Ga0207661_100351653 | 244 |
| 57 | 3300025945 | Ga0207679_10357020 | Ga0207679_103570202 | 244 |
| 58 | 3300025949 | Ga0207667_10020048 | Ga0207667_100200488 | 244 |
| 59 | 3300025949 | Ga0207667_10294569 | Ga0207667_102945692 | 244 |
| 60 | 3300026041 | Ga0207639_10013056 | Ga0207639_100130564 | 244 |
| 61 | 3300026078 | Ga0207702_10091538 | Ga0207702_100915383 | 244 |
| 62 | 3300026116 | Ga0207674_10056611 | Ga0207674_100566116 | 244 |
| 63 | 3300053090 | Ga0500646_0101228 | Ga0500646_0101228_35_868 | 245 |
| 64 | 3300005563 | Ga0068855_100011815 | Ga0068855_10001181510 | 246 |
| 65 | 3300011119 | Ga0105246_10000333 | Ga0105246_1000033328 | 246 |
| 66 | 3300013100 | Ga0157373_10013141 | Ga0157373_100131416 | 246 |
| 67 | 3300025949 | Ga0207667_10026720 | Ga0207667_100267205 | 246 |
| 68 | 3300005539 | Ga0068853_100024528 | Ga0068853_1000245285 | 249 |
| 69 | 3300005577 | Ga0068857_100019462 | Ga0068857_1000194623 | 249 |
| 70 | 3300005614 | Ga0068856_100458871 | Ga0068856_1004588711 | 249 |
| 71 | 3300005616 | Ga0068852_100032319 | Ga0068852_1000323195 | 249 |
| 72 | 3300005834 | Ga0068851_10079343 | Ga0068851_100793433 | 249 |
| 73 | 3300025321 | Ga0207656_10056310 | Ga0207656_100563101 | 249 |
| 74 | 3300026041 | Ga0207639_10003549 | Ga0207639_100035498 | 249 |
| 75 | 3300026116 | Ga0207674_10011479 | Ga0207674_100114795 | 249 |
| 76 | 3300046460 | Ga0495638_0097704 | Ga0495638_0097704_885_1730 | 249 |
| 77 | 3300003791 | Ga0055530_10003245 | Ga0055530_100032454 | 250 |
| 78 | 3300005331 | Ga0070670_100039326 | Ga0070670_1000393265 | 250 |
| 79 | 3300005353 | Ga0070669_100094923 | Ga0070669_1000949232 | 250 |
| 80 | 3300005577 | Ga0068857_100071026 | Ga0068857_1000710264 | 250 |
| 81 | 3300005578 | Ga0068854_100009241 | Ga0068854_1000092412 | 250 |
| 82 | 3300025298 | Ga0209050_1000277 | Ga0209050_100027736 | 250 |
| 83 | 3300025923 | Ga0207681_10103229 | Ga0207681_101032292 | 250 |
| 84 | 3300025981 | Ga0207640_10017316 | Ga0207640_100173167 | 250 |
| 85 | 3300049568 | Ga0501031_0143405 | Ga0501031_0143405_464_1324 | 250 |
| 86 | 3300049571 | Ga0501034_0095190 | Ga0501034_0095190_979_1839 | 250 |
| 87 | 3300049742 | Ga0501080_0317977 | Ga0501080_0317977_171_1031 | 250 |
| 88 | 3300005530 | Ga0070679_100002641 | Ga0070679_1000026418 | 251 |
| 89 | 3300025921 | Ga0207652_10043276 | Ga0207652_100432766 | 251 |
| 90 | 3300048919 | Ga0496116_0000017 | Ga0496116_0000017_494156_495061 | 251 |
| 91 | 3300048921 | Ga0496118_0113240 | Ga0496118_0113240_508_1413 | 251 |
| 92 | 3300048924 | Ga0496121_0000031 | Ga0496121_0000031_25812_26684 | 251 |
| 93 | 3300048926 | Ga0496123_0002940 | Ga0496123_0002940_13282_14187 | 251 |
| 94 | 3300048927 | Ga0496124_0168785 | Ga0496124_0168785_700_1605 | 251 |
| 95 | 3300048928 | Ga0496125_0085292 | Ga0496125_0085292_412_1317 | 251 |
| 96 | 3300048929 | Ga0496126_0000543 | Ga0496126_0000543_59721_60626 | 251 |
| 97 | 3300025920 | Ga0207649_10378502 | Ga0207649_103785021 | 252 |
| 98 | 3300049581 | Ga0501047_0241581 | Ga0501047_0241581_334_1194 | 252 |
| 99 | 3300009177 | Ga0105248_10527975 | Ga0105248_105279751 | 253 |
| 100 | 3300048921 | Ga0496118_0025169 | Ga0496118_0025169_3701_4558 | 253 |
| 101 | 3300048924 | Ga0496121_0001344 | Ga0496121_0001344_28411_29268 | 253 |
| 102 | iso_pu_bacteria | 2848297114 | 2848298836 | 253 |
| 103 | 3300050496 | nmdc:mga07m45_110206_c1 | nmdc:mga07m45_110206_c1_664_1545 | 254 |
| 104 | 3300053094 | Ga0500566_0172687 | Ga0500566_0172687_27_908 | 254 |
| 105 | 3300053121 | Ga0500607_000231 | Ga0500607_000231_352_1233 | 254 |
| 106 | 3300053125 | Ga0500618_003935 | Ga0500618_003935_347_1240 | 254 |
| 107 | 3300053136 | Ga0500559_0000228 | Ga0500559_0000228_43455_44336 | 254 |
| 108 | 3300053136 | Ga0500559_0015428 | Ga0500559_0015428_1961_2842 | 254 |
| 109 | 3300053178 | Ga0500637_0021671 | Ga0500637_0021671_347_1228 | 254 |
| 110 | 3300053730 | Ga0500645_037456 | Ga0500645_037456_396_1277 | 254 |
| 111 | 3300048090 | Ga0495615_0000041 | Ga0495615_0000041_25703_26605 | 255 |
| 112 | 3300048926 | Ga0496123_0000984 | Ga0496123_0000984_3489_4391 | 255 |
| 113 | 3300048927 | Ga0496124_0052927 | Ga0496124_0052927_430_1332 | 255 |
| 114 | 3300005330 | Ga0070690_100289624 | Ga0070690_1002896242 | 256 |
| 115 | 3300005355 | Ga0070671_100000545 | Ga0070671_10000054518 | 256 |
| 116 | 3300005367 | Ga0070667_100108965 | Ga0070667_1001089652 | 256 |
| 117 | 3300005530 | Ga0070679_100099296 | Ga0070679_1000992962 | 256 |
| 118 | 3300006048 | Ga0075363_100001685 | Ga0075363_1000016855 | 256 |
| 119 | 3300006177 | Ga0075362_10000003 | Ga0075362_1000000352 | 256 |
| 120 | 3300006186 | Ga0075369_10018793 | Ga0075369_100187932 | 256 |
| 121 | 3300006195 | Ga0075366_10000006 | Ga0075366_10000006108 | 256 |
| 122 | 3300006353 | Ga0075370_10000088 | Ga0075370_100000882 | 256 |
| 123 | 3300025315 | Ga0207697_10017352 | Ga0207697_100173523 | 256 |
| 124 | 3300025931 | Ga0207644_10000053 | Ga0207644_1000005376 | 256 |
| 125 | 3300025986 | Ga0207658_10020496 | Ga0207658_100204964 | 256 |
| 126 | 3300026088 | Ga0207641_10056095 | Ga0207641_100560951 | 256 |
| 127 | 3300032133 | Ga0316583_10001801 | Ga0316583_100018012 | 256 |
| 128 | 3300048906 | Ga0496103_0105884 | Ga0496103_0105884_576_1448 | 256 |
| 129 | 3300048907 | Ga0496104_0050534 | Ga0496104_0050534_1036_1908 | 256 |
| 130 | 3300048914 | Ga0496111_0125301 | Ga0496111_0125301_40_912 | 256 |
| 131 | 3300050489 | nmdc:mga03683_22_c1 | nmdc:mga03683_22_c1_32378_33247 | 256 |
| 132 | 3300050493 | nmdc:mga0k408_11023_c3 | nmdc:mga0k408_11023_c3_716_1585 | 256 |
| 133 | 3300050493 | nmdc:mga0k408_8_c1 | nmdc:mga0k408_8_c1_160292_161161 | 256 |
| 134 | 3300050496 | nmdc:mga07m45_20_c1 | nmdc:mga07m45_20_c1_125002_125871 | 256 |
| 135 | 3300050516 | nmdc:mga0sz30_39_c1 | nmdc:mga0sz30_39_c1_1772_2641 | 256 |
| 136 | iso_pu_bacteria | 2739367865 | 2740030294 | 256 |
| 137 | 3300005563 | Ga0068855_100127907 | Ga0068855_1001279074 | 257 |
| 138 | 3300005842 | Ga0068858_100046090 | Ga0068858_1000460904 | 257 |
| 139 | 3300026035 | Ga0207703_10038642 | Ga0207703_100386424 | 257 |
| 140 | 3300032002 | Ga0307416_100175626 | Ga0307416_1001756262 | 257 |
| 141 | 3300032002 | Ga0307416_100733811 | Ga0307416_1007338112 | 257 |
| 142 | 3300032004 | Ga0307414_10227360 | Ga0307414_102273602 | 257 |
| 143 | 3300002459 | JGI24751J29686_10000299 | JGI24751J29686_1000029917 | 258 |
| 144 | 3300005335 | Ga0070666_10046639 | Ga0070666_100466392 | 258 |
| 145 | 3300005340 | Ga0070689_100018286 | Ga0070689_1000182863 | 258 |
| 146 | 3300005353 | Ga0070669_100002298 | Ga0070669_1000022983 | 258 |
| 147 | 3300005466 | Ga0070685_10275305 | Ga0070685_102753051 | 258 |
| 148 | 3300005548 | Ga0070665_100110826 | Ga0070665_1001108263 | 258 |
| 149 | 3300005617 | Ga0068859_100077010 | Ga0068859_1000770103 | 258 |
| 150 | 3300005842 | Ga0068858_100067582 | Ga0068858_1000675821 | 258 |
| 151 | 3300005843 | Ga0068860_100028274 | Ga0068860_1000282743 | 258 |
| 152 | 3300006195 | Ga0075366_10005726 | Ga0075366_100057262 | 258 |
| 153 | 3300006353 | Ga0075370_10065894 | Ga0075370_100658942 | 258 |
| 154 | 3300006931 | Ga0097620_100077010 | Ga0097620_1000770102 | 258 |
| 155 | 3300009101 | Ga0105247_10306519 | Ga0105247_103065191 | 258 |
| 156 | 3300009553 | Ga0105249_10167167 | Ga0105249_101671672 | 258 |
| 157 | 3300014325 | Ga0163163_10080189 | Ga0163163_100801892 | 258 |
| 158 | 3300025900 | Ga0207710_10106059 | Ga0207710_101060591 | 258 |
| 159 | 3300025923 | Ga0207681_10000137 | Ga0207681_1000013761 | 258 |
| 160 | 3300025936 | Ga0207670_10135855 | Ga0207670_101358552 | 258 |
| 161 | 3300025941 | Ga0207711_10109757 | Ga0207711_101097572 | 258 |
| 162 | 3300025949 | Ga0207667_10117253 | Ga0207667_101172532 | 258 |
| 163 | 3300025972 | Ga0207668_10008565 | Ga0207668_100085651 | 258 |
| 164 | 3300048903 | Ga0496100_0152528 | Ga0496100_0152528_231_1103 | 258 |
| 165 | 3300048905 | Ga0496102_0041759 | Ga0496102_0041759_2297_3169 | 258 |
| 166 | 3300048909 | Ga0496106_0214345 | Ga0496106_0214345_633_1505 | 258 |
| 167 | 3300048913 | Ga0496110_0064368 | Ga0496110_0064368_1675_2547 | 258 |
| 168 | 3300048916 | Ga0496113_0001390 | Ga0496113_0001390_6423_7295 | 258 |
| 169 | 3300048917 | Ga0496114_0542365 | Ga0496114_0542365_25_897 | 258 |
| 170 | 3300050493 | nmdc:mga0k408_38827_c1 | nmdc:mga0k408_38827_c1_392_1273 | 258 |
| 171 | 3300053122 | Ga0500608_000175 | Ga0500608_000175_1712_2596 | 258 |
| 172 | 3300053123 | Ga0500614_009316 | Ga0500614_009316_574_1458 | 258 |
| 173 | 3300053136 | Ga0500559_0029253 | Ga0500559_0029253_1229_2113 | 258 |
| 174 | 3300053138 | Ga0500564_015324 | Ga0500564_015324_2143_3027 | 258 |
| 175 | 3300053723 | Ga0500567_002662 | Ga0500567_002662_2951_3835 | 258 |
| 176 | 3300053729 | Ga0500625_000002 | Ga0500625_000002_281384_282268 | 258 |
| 177 | iso_pu_bacteria | 2895880812 | 2895888322 | 258 |
| 178 | iso_pu_bacteria | 2896184354 | 2896186946 | 258 |
| 179 | 2162886007 | SwRhRL2b_contig_3541668 | SwRhRL2b_0369.00005110 | 259 |
| 180 | 3300005289 | Ga0065704_10070806 | Ga0065704_1007080615 | 259 |
| 181 | 3300005355 | Ga0070671_100091685 | Ga0070671_1000916854 | 260 |
| 182 | 3300005841 | Ga0068863_100010974 | Ga0068863_1000109749 | 260 |
| 183 | 3300005843 | Ga0068860_100022768 | Ga0068860_1000227682 | 260 |
| 184 | 3300013102 | Ga0157371_10070098 | Ga0157371_100700983 | 260 |
| 185 | 3300025986 | Ga0207658_10007296 | Ga0207658_100072965 | 260 |
| 186 | 3300026088 | Ga0207641_10275454 | Ga0207641_102754542 | 260 |
| 187 | 3300031731 | Ga0307405_10020490 | Ga0307405_100204903 | 260 |
| 188 | 3300031911 | Ga0307412_10142979 | Ga0307412_101429791 | 260 |
| 189 | 3300032005 | Ga0307411_10215040 | Ga0307411_102150402 | 260 |
| 190 | 3300048929 | Ga0496126_0010177 | Ga0496126_0010177_1973_2857 | 260 |
| 191 | 3300049823 | Ga0501044_0189245 | Ga0501044_0189245_441_1328 | 260 |
| 192 | iso_pu_bacteria | 2896253425 | 2896254717 | 260 |
| 193 | 3300005841 | Ga0068863_100000006 | Ga0068863_100000006154 | 261 |
| 194 | 3300006042 | Ga0075368_10000893 | Ga0075368_100008933 | 261 |
| 195 | 3300006048 | Ga0075363_100044645 | Ga0075363_1000446452 | 261 |
| 196 | 3300006051 | Ga0075364_10067654 | Ga0075364_100676542 | 261 |
| 197 | 3300006178 | Ga0075367_10002046 | Ga0075367_100020464 | 261 |
| 198 | 3300006186 | Ga0075369_10007219 | Ga0075369_100072194 | 261 |
| 199 | 3300006195 | Ga0075366_10106012 | Ga0075366_101060122 | 261 |
| 200 | 3300026088 | Ga0207641_10000054 | Ga0207641_10000054105 | 261 |
| 201 | 3300027866 | Ga0209813_10000243 | Ga0209813_100002432 | 261 |
| 202 | 3300046460 | Ga0495638_0104851 | Ga0495638_0104851_324_1205 | 261 |
| 203 | 3300046660 | Ga0495625_0044676 | Ga0495625_0044676_101_982 | 261 |
| 204 | 3300046691 | Ga0495670_0197526 | Ga0495670_0197526_102_983 | 261 |
| 205 | 3300047472 | Ga0495686_0115879 | Ga0495686_0115879_234_1115 | 261 |
| 206 | 3300048911 | Ga0496108_0173887 | Ga0496108_0173887_108_992 | 261 |
| 207 | 3300048914 | Ga0496111_0066199 | Ga0496111_0066199_1182_2066 | 261 |
| 208 | 3300048924 | Ga0496121_0154156 | Ga0496121_0154156_639_1520 | 261 |
| 209 | 3300049571 | Ga0501034_0152676 | Ga0501034_0152676_893_1795 | 261 |
| 210 | 3300050489 | nmdc:mga03683_373_c1 | nmdc:mga03683_373_c1_8309_9190 | 261 |
| 211 | 3300050490 | nmdc:mga03n38_11278_c1 | nmdc:mga03n38_11278_c1_1793_2674 | 261 |
| 212 | 3300050491 | nmdc:mga00v17_28069_c1 | nmdc:mga00v17_28069_c1_2131_3012 | 261 |
| 213 | 3300050492 | nmdc:mga0yw44_25503_c1 | nmdc:mga0yw44_25503_c1_650_1531 | 261 |
| 214 | 3300050493 | nmdc:mga0k408_85248_c1 | nmdc:mga0k408_85248_c1_306_1187 | 261 |
| 215 | 3300050494 | nmdc:mga06z11_349_c1 | nmdc:mga06z11_349_c1_14735_15616 | 261 |
| 216 | 3300050495 | nmdc:mga04h51_523_c1 | nmdc:mga04h51_523_c1_2135_3016 | 261 |
| 217 | 3300050496 | nmdc:mga07m45_15_c1 | nmdc:mga07m45_15_c1_12719_13600 | 261 |
| 218 | 3300050516 | nmdc:mga0sz30_12326_c1 | nmdc:mga0sz30_12326_c1_2371_3252 | 261 |
| 219 | 3300053087 | Ga0500643_000004 | Ga0500643_000004_215719_216600 | 261 |
| 220 | 3300053121 | Ga0500607_001306 | Ga0500607_001306_18670_19551 | 261 |
| 221 | 3300053148 | Ga0500590_010576 | Ga0500590_010576_423_1328 | 261 |
| 222 | 3300053153 | Ga0500616_0004004 | Ga0500616_0004004_3735_4616 | 261 |
| 223 | 3300013306 | Ga0163162_10095034 | Ga0163162_100950344 | 262 |
| 224 | 3300046500 | Ga0495596_0001908 | Ga0495596_0001908_6712_7602 | 262 |
| 225 | 3300046507 | Ga0495606_0005638 | Ga0495606_0005638_1648_2538 | 262 |
| 226 | 3300046522 | Ga0495643_0098066 | Ga0495643_0098066_456_1346 | 262 |
| 227 | 3300048091 | Ga0495626_0005484 | Ga0495626_0005484_6133_7023 | 262 |
| 228 | 3300048929 | Ga0496126_0135212 | Ga0496126_0135212_287_1171 | 262 |
| 229 | iso_pu_bacteria | 2510917021 | 2511129755 | 262 |
| 230 | iso_pu_bacteria | 2818991438 | 2819553000 | 262 |
| 231 | 3300005336 | Ga0070680_100191118 | Ga0070680_1001911181 | 263 |
| 232 | 3300005366 | Ga0070659_100140540 | Ga0070659_1001405402 | 263 |
| 233 | 3300005535 | Ga0070684_100006396 | Ga0070684_1000063967 | 263 |
| 234 | 3300005564 | Ga0070664_100066251 | Ga0070664_1000662512 | 263 |
| 235 | 3300025933 | Ga0207706_10066315 | Ga0207706_100663153 | 263 |
| 236 | 3300025945 | Ga0207679_10105119 | Ga0207679_101051192 | 263 |
| 237 | 3300032004 | Ga0307414_10190702 | Ga0307414_101907022 | 263 |
| 238 | 3300046512 | Ga0495610_0000015 | Ga0495610_0000015_19302_20219 | 263 |
| 239 | 3300046512 | Ga0495610_0000300 | Ga0495610_0000300_45218_46111 | 263 |
| 240 | 3300046515 | Ga0495620_0043177 | Ga0495620_0043177_635_1552 | 263 |
| 241 | 3300046522 | Ga0495643_0000023 | Ga0495643_0000023_168584_169477 | 263 |
| 242 | 3300048924 | Ga0496121_0008806 | Ga0496121_0008806_5566_6471 | 263 |
| 243 | 3300005327 | Ga0070658_10000124 | Ga0070658_1000012470 | 264 |
| 244 | 3300005578 | Ga0068854_100110533 | Ga0068854_1001105333 | 264 |
| 245 | 3300005614 | Ga0068856_100161135 | Ga0068856_1001611352 | 264 |
| 246 | 3300005616 | Ga0068852_100020817 | Ga0068852_1000208173 | 264 |
| 247 | 3300009093 | Ga0105240_10005088 | Ga0105240_100050883 | 264 |
| 248 | 3300009551 | Ga0105238_10324810 | Ga0105238_103248102 | 264 |
| 249 | 3300025904 | Ga0207647_10058696 | Ga0207647_100586964 | 264 |
| 250 | 3300025909 | Ga0207705_10000009 | Ga0207705_10000009556 | 264 |
| 251 | 3300025913 | Ga0207695_10076639 | Ga0207695_100766393 | 264 |
| 252 | 3300025924 | Ga0207694_10343247 | Ga0207694_103432472 | 264 |
| 253 | 3300025981 | Ga0207640_10065025 | Ga0207640_100650254 | 264 |
| 254 | 3300026078 | Ga0207702_10008724 | Ga0207702_1000872410 | 264 |
| 255 | 3300026116 | Ga0207674_10160499 | Ga0207674_101604993 | 264 |
| 256 | 3300026142 | Ga0207698_10000111 | Ga0207698_1000011152 | 264 |
| 257 | 3300032004 | Ga0307414_10125310 | Ga0307414_101253102 | 264 |
| 258 | 3300042116 | Ga0450912_000154 | Ga0450912_000154_1594_2499 | 264 |
| 259 | 3300046519 | Ga0495632_0001359 | Ga0495632_0001359_15700_16617 | 264 |
| 260 | iso_pu_bacteria | 2882806704 | 2882807056 | 264 |
| 261 | iso_pu_bacteria | 3000865235 | 3000866427 | 264 |
| 262 | 3300006058 | Ga0075432_10005801 | Ga0075432_100058015 | 265 |
| 263 | 3300006177 | Ga0075362_10166165 | Ga0075362_101661651 | 265 |
| 264 | 3300006186 | Ga0075369_10009614 | Ga0075369_100096142 | 265 |
| 265 | 3300027907 | Ga0207428_10158288 | Ga0207428_101582882 | 265 |
| 266 | 3300046460 | Ga0495638_0125247 | Ga0495638_0125247_56_949 | 265 |
| 267 | 3300046558 | Ga0495633_0051267 | Ga0495633_0051267_662_1555 | 265 |
| 268 | 3300050491 | nmdc:mga00v17_7002_c1 | nmdc:mga00v17_7002_c1_280_1173 | 265 |
| 269 | 3300050516 | nmdc:mga0sz30_9129_c1 | nmdc:mga0sz30_9129_c1_2517_3410 | 265 |
| 270 | 3300005616 | Ga0068852_100226964 | Ga0068852_1002269643 | 266 |
| 271 | 3300013102 | Ga0157371_10028906 | Ga0157371_100289066 | 266 |
| 272 | 3300013104 | Ga0157370_10231582 | Ga0157370_102315822 | 266 |
| 273 | 3300013105 | Ga0157369_10337042 | Ga0157369_103370422 | 266 |
| 274 | 3300026142 | Ga0207698_10167373 | Ga0207698_101673732 | 266 |
| 275 | 3300031901 | Ga0307406_10019699 | Ga0307406_100196992 | 266 |
| 276 | 3300032126 | Ga0307415_100167265 | Ga0307415_1001672652 | 266 |
| 277 | 3300046501 | Ga0495607_0007418 | Ga0495607_0007418_1223_2128 | 266 |
| 278 | 3300046507 | Ga0495606_0010708 | Ga0495606_0010708_3730_4635 | 266 |
| 279 | 3300046522 | Ga0495643_0008645 | Ga0495643_0008645_2960_3865 | 266 |
| 280 | 3300049823 | Ga0501044_0000290 | Ga0501044_0000290_55599_56495 | 266 |
| 281 | 3300005337 | Ga0070682_100198390 | Ga0070682_1001983901 | 267 |
| 282 | 3300009094 | Ga0111539_10564142 | Ga0111539_105641421 | 267 |
| 283 | 3300017792 | Ga0163161_10270220 | Ga0163161_102702201 | 267 |
| 284 | 3300042015 | Ga0439462_0000040 | Ga0439462_0000040_10261_11160 | 267 |
| 285 | 3300013100 | Ga0157373_10026951 | Ga0157373_100269514 | 268 |
| 286 | 3300013102 | Ga0157371_10007116 | Ga0157371_100071163 | 268 |
| 287 | 3300013104 | Ga0157370_10055946 | Ga0157370_100559463 | 268 |
| 288 | 3300013105 | Ga0157369_10013298 | Ga0157369_100132987 | 268 |
| 289 | 3300013307 | Ga0157372_10155331 | Ga0157372_101553313 | 268 |
| 290 | 3300013307 | Ga0157372_10278762 | Ga0157372_102787622 | 268 |
| 291 | 3300031911 | Ga0307412_10109232 | Ga0307412_101092322 | 268 |
| 292 | 3300032004 | Ga0307414_10073922 | Ga0307414_100739222 | 268 |
| 293 | 3300032004 | Ga0307414_10100799 | Ga0307414_101007992 | 268 |
| 294 | 3300049823 | Ga0501044_0199332 | Ga0501044_0199332_444_1346 | 268 |
| 295 | 3300032005 | Ga0307411_10409658 | Ga0307411_104096582 | 269 |
| 296 | 3300005327 | Ga0070658_10288700 | Ga0070658_102887001 | 270 |
| 297 | 3300032004 | Ga0307414_10051141 | Ga0307414_100511413 | 270 |
| 298 | iso_pu_bacteria | 2738541275 | 2738712757 | 270 |
| 299 | iso_pu_bacteria | 2738541301 | 2738851181 | 270 |
| 300 | iso_pu_bacteria | 2738541304 | 2738866911 | 270 |
| 301 | iso_pu_bacteria | 2738543022 | 2739299428 | 270 |
| 302 | iso_pu_bacteria | 2738543033 | 2739361107 | 270 |
| 303 | iso_pu_bacteria | 2928959182 | 2928963023 | 270 |
| 304 | 2162886007 | SwRhRL2b_contig_2924680 | SwRhRL2b_0202.00000150 | 274 |
| 305 | 3300005289 | Ga0065704_10079185 | Ga0065704_100791852 | 274 |
| 306 | 3300005353 | Ga0070669_100098928 | Ga0070669_1000989282 | 274 |
| 307 | 3300005355 | Ga0070671_100031293 | Ga0070671_1000312934 | 274 |
| 308 | 3300005367 | Ga0070667_100021758 | Ga0070667_1000217583 | 274 |
| 309 | 3300005844 | Ga0068862_100031787 | Ga0068862_1000317873 | 274 |
| 310 | 3300009092 | Ga0105250_10004007 | Ga0105250_100040075 | 274 |
| 311 | 3300025711 | Ga0207696_1009011 | Ga0207696_10090112 | 274 |
| 312 | 3300025923 | Ga0207681_10001319 | Ga0207681_100013193 | 274 |
| 313 | 3300025931 | Ga0207644_10022873 | Ga0207644_100228734 | 274 |
| 314 | 3300025986 | Ga0207658_10014837 | Ga0207658_100148374 | 274 |
| 315 | 3300028380 | Ga0268265_10015588 | Ga0268265_100155885 | 274 |
| 316 | 3300048905 | Ga0496102_0001387 | Ga0496102_0001387_18915_19865 | 274 |
| 317 | 3300048906 | Ga0496103_0000482 | Ga0496103_0000482_12112_13062 | 274 |
| 318 | 3300048907 | Ga0496104_0003250 | Ga0496104_0003250_11793_12743 | 274 |
| 319 | 3300048908 | Ga0496105_0000549 | Ga0496105_0000549_18858_19808 | 274 |
| 320 | 3300048916 | Ga0496113_0000100 | Ga0496113_0000100_23574_24524 | 274 |
| 321 | 3300048918 | Ga0496115_0119234 | Ga0496115_0119234_1207_2157 | 274 |
| 322 | 3300048919 | Ga0496116_0043827 | Ga0496116_0043827_1508_2458 | 274 |
| 323 | 3300048920 | Ga0496117_0000566 | Ga0496117_0000566_47717_48667 | 274 |
| 324 | 3300048922 | Ga0496119_0001659 | Ga0496119_0001659_4617_5567 | 274 |
| 325 | 3300048923 | Ga0496120_0013870 | Ga0496120_0013870_715_1665 | 274 |
| 326 | 3300048925 | Ga0496122_0001874 | Ga0496122_0001874_12109_13059 | 274 |
| 327 | 3300048926 | Ga0496123_0001801 | Ga0496123_0001801_15133_16083 | 274 |
| 328 | 3300048927 | Ga0496124_0001679 | Ga0496124_0001679_25318_26238 | 274 |
| 329 | 3300048928 | Ga0496125_0001603 | Ga0496125_0001603_12109_13059 | 274 |
| 330 | 3300048929 | Ga0496126_0001625 | Ga0496126_0001625_20590_21540 | 274 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar