F410166

General Info

Members Datasets Scaffolds Average Seq Length
330 201 313 275

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10051141|Ga0307414_100511413
Length 306
Sequence MADQAPAAQPQTAPPVNGKPPEFVDPGAGRRFPPKGQPLIQGFNRIGLWSLYMKEVRRFLKVQTQTVWAPAITTLLFLVIFTVALGGPAGRGGRVVLGVSFATFVAPGLIMMGMMQNAFANSSFSLLAGKIQGTIIDLLMPPLTEAELMIGIIAASITRAVMVGAAVTLAMALWPGVDLMAAHPWAIVWFGLMGSTMLALLGLLASIWAEKFDHAAAVTNFVVAPLSLLSGTFYVIGNLSEPFQAISRANPFFYMISGFRFGFIGESDIGNTNEAVIGAAVGAGVLNLVLGFAAYRLLKSGWKIKS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
4 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
5 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
6 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
7 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
8 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
9 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
10 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
11 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
12 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
13 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
14 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
15 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
16 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
17 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
18 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
19 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
131 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
135 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
136 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
139 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
140 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
147 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
179 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
187 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
188 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
189 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
190 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
191 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
192 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
193 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
194 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
195 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
196 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
199 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
200 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
201 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.85
Metatranscriptomes 0
Isolates 5.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.58
Nodule 0
Rhizoplane 5.15
Rhizosphere 65.76
Stem 0
Stem Tuber 0
Unclassified 11.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2924680 2162886007 Bacteria 1887
2 SwRhRL2b_contig_3541668 2162886007 Bacteria 1869
3 JGI24751J29686_10000299 3300002459 Bacteria 18728
4 JGI24751J29686_10024934 3300002459 Bacteria 1241
5 Ga0055530_10003245 3300003791 Bacteria 9487
6 Ga0065704_10070806 3300005289 Bacteria 15903
7 Ga0065704_10079185 3300005289 Bacteria 4236
8 Ga0070658_10000124 3300005327 Bacteria 68224
9 Ga0070658_10097055 3300005327 Bacteria 2433
10 Ga0070658_10288700 3300005327 Bacteria 1398
11 Ga0070690_100289624 3300005330 Bacteria 1171
12 Ga0070670_100039326 3300005331 Bacteria 4067
13 Ga0070666_10046639 3300005335 Bacteria 2907
14 Ga0070666_10089738 3300005335 Bacteria 2110
15 Ga0070680_100024370 3300005336 Bacteria 4833
16 Ga0070680_100191118 3300005336 Bacteria 1725
17 Ga0070682_100198390 3300005337 Bacteria 1414
18 Ga0070660_100024232 3300005339 Bacteria 4502
19 Ga0070689_100018286 3300005340 Bacteria 5161
20 Ga0070661_100014008 3300005344 Bacteria 5638
21 Ga0070668_100240293 3300005347 Bacteria 1500
22 Ga0070669_100002298 3300005353 Bacteria 13851
23 Ga0070669_100094923 3300005353 Bacteria 2242
24 Ga0070669_100098928 3300005353 Bacteria 2198
25 Ga0070671_100000545 3300005355 Bacteria 26618
26 Ga0070671_100012194 3300005355 Bacteria 6918
27 Ga0070671_100031293 3300005355 Bacteria 4395
28 Ga0070671_100091685 3300005355 Bacteria 2545
29 Ga0070659_100009671 3300005366 Bacteria 7085
30 Ga0070659_100140540 3300005366 Bacteria 1966
31 Ga0070659_100146865 3300005366 Bacteria 1922
32 Ga0070667_100021758 3300005367 Bacteria 5321
33 Ga0070667_100108965 3300005367 Bacteria 2400
34 Ga0070662_100004063 3300005457 Bacteria 9193
35 Ga0070681_10118923 3300005458 Bacteria 2578
36 Ga0070685_10275305 3300005466 Bacteria 1125
37 Ga0070679_100002641 3300005530 Bacteria 16306
38 Ga0070679_100004736 3300005530 Bacteria 12550
39 Ga0070679_100099296 3300005530 Bacteria 2898
40 Ga0070684_100006396 3300005535 Bacteria 9111
41 Ga0068853_100024528 3300005539 Bacteria 5057
42 Ga0068853_100041290 3300005539 Bacteria 3939
43 Ga0070665_100110826 3300005548 Bacteria 2747
44 Ga0068855_100011815 3300005563 Bacteria 10558
45 Ga0068855_100022295 3300005563 Bacteria 7589
46 Ga0068855_100073002 3300005563 Bacteria 3987
47 Ga0068855_100127907 3300005563 Bacteria 2903
48 Ga0070664_100005668 3300005564 Bacteria 10053
49 Ga0070664_100066251 3300005564 Bacteria 3084
50 Ga0068857_100019462 3300005577 Bacteria 5962
51 Ga0068857_100071026 3300005577 Bacteria 3102
52 Ga0068854_100009241 3300005578 Bacteria 6359
53 Ga0068854_100110533 3300005578 Bacteria 2072
54 Ga0068856_100108820 3300005614 Bacteria 2767
55 Ga0068856_100161135 3300005614 Bacteria 2254
56 Ga0068856_100458871 3300005614 Bacteria 1295
57 Ga0068852_100020817 3300005616 Bacteria 5220
58 Ga0068852_100032319 3300005616 Bacteria 4332
59 Ga0068852_100226964 3300005616 Bacteria 1779
60 Ga0068859_100055635 3300005617 Bacteria 3981
61 Ga0068859_100077010 3300005617 Bacteria 3376
62 Ga0068851_10079343 3300005834 Bacteria 1712
63 Ga0068863_100000006 3300005841 Bacteria 265379
64 Ga0068863_100010974 3300005841 Bacteria 8785
65 Ga0068858_100013874 3300005842 Bacteria 7602
66 Ga0068858_100046090 3300005842 Bacteria 4042
67 Ga0068858_100067582 3300005842 Bacteria 3311
68 Ga0068860_100022768 3300005843 Bacteria 6058
69 Ga0068860_100028274 3300005843 Bacteria 5396
70 Ga0068862_100031787 3300005844 Bacteria 4458
71 Ga0075368_10000893 3300006042 Bacteria 9254
72 Ga0075363_100001685 3300006048 Bacteria 8567
73 Ga0075363_100044645 3300006048 Bacteria 2348
74 Ga0075364_10067654 3300006051 Bacteria 2348
75 Ga0075432_10005801 3300006058 Bacteria 4200
76 Ga0075362_10000003 3300006177 Bacteria 171099
77 Ga0075362_10005149 3300006177 Bacteria 4762
78 Ga0075362_10166165 3300006177 Bacteria 1064
79 Ga0075367_10002046 3300006178 Bacteria 9023
80 Ga0075369_10007219 3300006186 Bacteria 4224
81 Ga0075369_10009614 3300006186 Bacteria 3762
82 Ga0075369_10018793 3300006186 Bacteria 2817
83 Ga0075366_10000006 3300006195 Bacteria 106522
84 Ga0075366_10005726 3300006195 Bacteria 6745
85 Ga0075366_10106012 3300006195 Bacteria 1689
86 Ga0075370_10000088 3300006353 Bacteria 28442
87 Ga0075370_10030243 3300006353 Bacteria 3020
88 Ga0075370_10065894 3300006353 Bacteria 2066
89 Ga0097620_100055637 3300006931 Bacteria 3981
90 Ga0097620_100077010 3300006931 Bacteria 3376
91 Ga0105250_10004007 3300009092 Bacteria 6870
92 Ga0105240_10002395 3300009093 Bacteria 30188
93 Ga0105240_10005088 3300009093 Bacteria 19700
94 Ga0111539_10564142 3300009094 Bacteria 1326
95 Ga0105247_10306519 3300009101 Bacteria 1103
96 Ga0105248_10527975 3300009177 Bacteria 1331
97 Ga0105238_10324810 3300009551 Bacteria 1525
98 Ga0105249_10167167 3300009553 Bacteria 2130
99 Ga0105246_10000333 3300011119 Bacteria 25060
100 Ga0157373_10013141 3300013100 Bacteria 6078
101 Ga0157373_10026951 3300013100 Bacteria 4147
102 Ga0157371_10007116 3300013102 Bacteria 9091
103 Ga0157371_10028906 3300013102 Bacteria 4014
104 Ga0157371_10070098 3300013102 Bacteria 2482
105 Ga0157370_10055946 3300013104 Bacteria 3755
106 Ga0157370_10231582 3300013104 Bacteria 1710
107 Ga0157369_10013298 3300013105 Bacteria 9312
108 Ga0157369_10337042 3300013105 Bacteria 1567
109 Ga0163162_10095034 3300013306 Bacteria 3067
110 Ga0157372_10155331 3300013307 Bacteria 2643
111 Ga0157372_10278762 3300013307 Bacteria 1943
112 Ga0163163_10080189 3300014325 Bacteria 3264
113 Ga0163161_10270220 3300017792 Bacteria 1330
114 Ga0213872_10011295 3300021361 Bacteria 4230
115 Ga0209050_1000277 3300025298 Bacteria 109132
116 Ga0207697_10017352 3300025315 Bacteria 2958
117 Ga0207656_10056310 3300025321 Bacteria 1714
118 Ga0207696_1009011 3300025711 Bacteria 3751
119 Ga0207710_10106059 3300025900 Bacteria 1330
120 Ga0207647_10058696 3300025904 Bacteria 2356
121 Ga0207647_10085482 3300025904 Bacteria 1887
122 Ga0207705_10000009 3300025909 Bacteria 576128
123 Ga0207705_10069936 3300025909 Bacteria 2543
124 Ga0207654_10094128 3300025911 Bacteria 1833
125 Ga0207707_10251784 3300025912 Bacteria 1534
126 Ga0207695_10027935 3300025913 Bacteria 6271
127 Ga0207695_10076639 3300025913 Bacteria 3398
128 Ga0207657_10007000 3300025919 Bacteria 11609
129 Ga0207649_10102463 3300025920 Bacteria 1897
130 Ga0207649_10378502 3300025920 Bacteria 1054
131 Ga0207652_10012692 3300025921 Bacteria 6813
132 Ga0207652_10043276 3300025921 Bacteria 3835
133 Ga0207681_10000137 3300025923 Bacteria 60426
134 Ga0207681_10001319 3300025923 Bacteria 16007
135 Ga0207681_10103229 3300025923 Bacteria 2060
136 Ga0207694_10343247 3300025924 Bacteria 1235
137 Ga0207644_10000053 3300025931 Bacteria 90831
138 Ga0207644_10022873 3300025931 Bacteria 4274
139 Ga0207644_10027868 3300025931 Bacteria 3905
140 Ga0207690_10002987 3300025932 Bacteria 10186
141 Ga0207706_10004487 3300025933 Bacteria 13106
142 Ga0207706_10066315 3300025933 Bacteria 3177
143 Ga0207709_10061655 3300025935 Bacteria 2344
144 Ga0207670_10135855 3300025936 Bacteria 1807
145 Ga0207711_10049535 3300025941 Bacteria 3596
146 Ga0207711_10109757 3300025941 Bacteria 2452
147 Ga0207661_10035165 3300025944 Bacteria 3901
148 Ga0207679_10105119 3300025945 Bacteria 2217
149 Ga0207679_10357020 3300025945 Bacteria 1275
150 Ga0207667_10020048 3300025949 Bacteria 7445
151 Ga0207667_10026720 3300025949 Bacteria 6301
152 Ga0207667_10117253 3300025949 Bacteria 2744
153 Ga0207667_10294569 3300025949 Bacteria 1658
154 Ga0207668_10008565 3300025972 Bacteria 6102
155 Ga0207640_10017316 3300025981 Bacteria 4215
156 Ga0207640_10065025 3300025981 Bacteria 2432
157 Ga0207658_10007296 3300025986 Bacteria 7539
158 Ga0207658_10014837 3300025986 Bacteria 5339
159 Ga0207658_10020496 3300025986 Bacteria 4578
160 Ga0207703_10022146 3300026035 Bacteria 4981
161 Ga0207703_10038642 3300026035 Bacteria 3811
162 Ga0207639_10003549 3300026041 Bacteria 10481
163 Ga0207639_10013056 3300026041 Bacteria 5800
164 Ga0207702_10008724 3300026078 Bacteria 8548
165 Ga0207702_10091538 3300026078 Bacteria 2663
166 Ga0207641_10000054 3300026088 Bacteria 170887
167 Ga0207641_10056095 3300026088 Bacteria 3347
168 Ga0207641_10275454 3300026088 Bacteria 1580
169 Ga0207676_10711850 3300026095 Bacteria 974
170 Ga0207674_10011479 3300026116 Bacteria 9952
171 Ga0207674_10056611 3300026116 Bacteria 3980
172 Ga0207674_10160499 3300026116 Bacteria 2203
173 Ga0207698_10000111 3300026142 Bacteria 50675
174 Ga0207698_10167373 3300026142 Bacteria 1931
175 Ga0207698_10327813 3300026142 Bacteria 1437
176 Ga0209813_10000243 3300027866 Bacteria 16043
177 Ga0207428_10158288 3300027907 Bacteria 1721
178 Ga0268265_10015588 3300028380 Bacteria 5203
179 Ga0307405_10020490 3300031731 Bacteria 3696
180 Ga0307410_10067504 3300031852 Bacteria 2467
181 Ga0307406_10019699 3300031901 Bacteria 3963
182 Ga0307412_10073356 3300031911 Bacteria 2341
183 Ga0307412_10109232 3300031911 Bacteria 1971
184 Ga0307412_10142979 3300031911 Bacteria 1755
185 Ga0307416_100175626 3300032002 Bacteria 2000
186 Ga0307416_100733811 3300032002 Bacteria 1079
187 Ga0307414_10051141 3300032004 Bacteria 2866
188 Ga0307414_10073922 3300032004 Bacteria 2467
189 Ga0307414_10100799 3300032004 Bacteria 2173
190 Ga0307414_10125310 3300032004 Bacteria 1983
191 Ga0307414_10190702 3300032004 Bacteria 1658
192 Ga0307414_10227360 3300032004 Bacteria 1536
193 Ga0307411_10215040 3300032005 Bacteria 1487
194 Ga0307411_10409658 3300032005 Bacteria 1123
195 Ga0307415_100167265 3300032126 Bacteria 1711
196 Ga0316583_10001801 3300032133 Bacteria 7284
197 Ga0436364_0669604 3300037853 Bacteria 763
198 Ga0436361_0551543 3300039447 Bacteria 18800
199 Ga0439462_0000040 3300042015 Bacteria 18378
200 Ga0450912_000154 3300042116 Bacteria 2670
201 Ga0453684_0065976 3300044712 Bacteria 4612
202 Ga0495638_0097704 3300046460 Bacteria 1760
203 Ga0495638_0104851 3300046460 Bacteria 1686
204 Ga0495638_0125247 3300046460 Bacteria 1515
205 Ga0495650_0091029 3300046471 Bacteria 1160
206 Ga0495596_0001908 3300046500 Bacteria 11575
207 Ga0495607_0007418 3300046501 Bacteria 7592
208 Ga0495606_0005638 3300046507 Bacteria 11870
209 Ga0495606_0010708 3300046507 Bacteria 7566
210 Ga0495610_0000015 3300046512 Bacteria 391489
211 Ga0495610_0000300 3300046512 Bacteria 52078
212 Ga0495620_0043177 3300046515 Bacteria 1965
213 Ga0495632_0001359 3300046519 Bacteria 20574
214 Ga0495643_0000023 3300046522 Bacteria 288590
215 Ga0495643_0008645 3300046522 Bacteria 6425
216 Ga0495643_0098066 3300046522 Bacteria 1505
217 Ga0495633_0051267 3300046558 Bacteria 1945
218 Ga0495625_0044676 3300046660 Bacteria 3206
219 Ga0495670_0197526 3300046691 Bacteria 1065
220 Ga0495686_0115879 3300047472 Bacteria 1602
221 Ga0495615_0000041 3300048090 Bacteria 43189
222 Ga0495626_0005484 3300048091 Bacteria 7394
223 Ga0496100_0152528 3300048903 Bacteria 1649
224 Ga0496102_0001387 3300048905 Bacteria 21558
225 Ga0496102_0041759 3300048905 Bacteria 4155
226 Ga0496103_0000482 3300048906 Bacteria 33508
227 Ga0496103_0105884 3300048906 Bacteria 1783
228 Ga0496104_0003250 3300048907 Bacteria 14008
229 Ga0496104_0050534 3300048907 Bacteria 3922
230 Ga0496105_0000549 3300048908 Bacteria 24748
231 Ga0496106_0214345 3300048909 Bacteria 1534
232 Ga0496108_0173887 3300048911 Bacteria 1864
233 Ga0496110_0064368 3300048913 Bacteria 3240
234 Ga0496111_0066199 3300048914 Bacteria 2623
235 Ga0496111_0125301 3300048914 Bacteria 1898
236 Ga0496113_0000100 3300048916 Bacteria 36225
237 Ga0496113_0001390 3300048916 Bacteria 13452
238 Ga0496114_0542365 3300048917 Bacteria 1028
239 Ga0496115_0119234 3300048918 Bacteria 2170
240 Ga0496116_0000017 3300048919 Bacteria 554463
241 Ga0496116_0043827 3300048919 Bacteria 3044
242 Ga0496117_0000566 3300048920 Bacteria 60778
243 Ga0496118_0025169 3300048921 Bacteria 5113
244 Ga0496118_0113240 3300048921 Bacteria 1793
245 Ga0496119_0001659 3300048922 Bacteria 26156
246 Ga0496120_0013870 3300048923 Bacteria 5396
247 Ga0496121_0000031 3300048924 Bacteria 384119
248 Ga0496121_0001344 3300048924 Bacteria 42068
249 Ga0496121_0008806 3300048924 Bacteria 11756
250 Ga0496121_0154156 3300048924 Bacteria 1687
251 Ga0496122_0001874 3300048925 Bacteria 31963
252 Ga0496122_0003911 3300048925 Bacteria 19065
253 Ga0496123_0000984 3300048926 Bacteria 43992
254 Ga0496123_0001801 3300048926 Bacteria 28191
255 Ga0496123_0002940 3300048926 Bacteria 19911
256 Ga0496124_0001679 3300048927 Bacteria 31447
257 Ga0496124_0052927 3300048927 Bacteria 3446
258 Ga0496124_0168785 3300048927 Bacteria 1697
259 Ga0496125_0001603 3300048928 Bacteria 31974
260 Ga0496125_0085292 3300048928 Bacteria 2393
261 Ga0496126_0000543 3300048929 Bacteria 72785
262 Ga0496126_0001625 3300048929 Bacteria 33995
263 Ga0496126_0010177 3300048929 Bacteria 9897
264 Ga0496126_0055011 3300048929 Bacteria 3602
265 Ga0496126_0135212 3300048929 Bacteria 2127
266 Ga0501031_0143405 3300049568 Bacteria 1561
267 Ga0501034_0095190 3300049571 Bacteria 2975
268 Ga0501034_0152676 3300049571 Bacteria 2285
269 Ga0501036_0306860 3300049572 Bacteria 1327
270 Ga0501047_0241581 3300049581 Bacteria 1657
271 Ga0501249_000546 3300049679 Bacteria 9061
272 Ga0501080_0317977 3300049742 Bacteria 1410
273 Ga0501044_0000290 3300049823 Bacteria 63934
274 Ga0501044_0189245 3300049823 Bacteria 2022
275 Ga0501044_0199332 3300049823 Bacteria 1961
276 nmdc:mga03683_22_c1 3300050489 Bacteria 82016
277 nmdc:mga03683_373_c1 3300050489 Bacteria 12879
278 nmdc:mga03683_4162_c1 3300050489 Bacteria 4762
279 nmdc:mga03n38_11278_c1 3300050490 Bacteria 3323
280 nmdc:mga00v17_28069_c1 3300050491 Bacteria 3293
281 nmdc:mga00v17_7002_c1 3300050491 Bacteria 6001
282 nmdc:mga0yw44_25503_c1 3300050492 Bacteria 3363
283 nmdc:mga0k408_11023_c3 3300050493 Bacteria 1635
284 nmdc:mga0k408_38827_c1 3300050493 Bacteria 2734
285 nmdc:mga0k408_85248_c1 3300050493 Bacteria 1854
286 nmdc:mga0k408_8_c1 3300050493 Bacteria 161211
287 nmdc:mga06z11_349_c1 3300050494 Bacteria 17408
288 nmdc:mga04h51_523_c1 3300050495 Bacteria 9109
289 nmdc:mga07m45_110206_c1 3300050496 Bacteria 1585
290 nmdc:mga07m45_15_c1 3300050496 Bacteria 152740
291 nmdc:mga07m45_20_c1 3300050496 Bacteria 126269
292 nmdc:mga0sz30_11928_c1 3300050516 Bacteria 3369
293 nmdc:mga0sz30_12326_c1 3300050516 Bacteria 3325
294 nmdc:mga0sz30_39_c1 3300050516 Bacteria 12429
295 nmdc:mga0sz30_9129_c1 3300050516 Bacteria 3762
296 Ga0500643_000004 3300053087 Bacteria 857484
297 Ga0500646_0101228 3300053090 Bacteria 905
298 Ga0500566_0172687 3300053094 Bacteria 1116
299 Ga0500607_000231 3300053121 Bacteria 51561
300 Ga0500607_001306 3300053121 Bacteria 22788
301 Ga0500608_000175 3300053122 Bacteria 26374
302 Ga0500614_009316 3300053123 Bacteria 2095
303 Ga0500618_003935 3300053125 Bacteria 4927
304 Ga0500559_0000228 3300053136 Bacteria 44687
305 Ga0500559_0015428 3300053136 Bacteria 3225
306 Ga0500559_0029253 3300053136 Bacteria 2358
307 Ga0500564_015324 3300053138 Bacteria 3459
308 Ga0500590_010576 3300053148 Bacteria 4663
309 Ga0500616_0004004 3300053153 Bacteria 10744
310 Ga0500637_0021671 3300053178 Bacteria 3493
311 Ga0500567_002662 3300053723 Bacteria 7730
312 Ga0500625_000002 3300053729 Bacteria 371909
313 Ga0500645_037456 3300053730 Bacteria 1440

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_0669604 Ga0436364_0669604_27_725 202
2 iso_pu_bacteria 2928100450 2928104631 214
3 3300048925 Ga0496122_0003911 Ga0496122_0003911_18237_19019 215
4 3300005335 Ga0070666_10089738 Ga0070666_100897383 217
5 3300009093 Ga0105240_10002395 Ga0105240_1000239511 217
6 3300025913 Ga0207695_10027935 Ga0207695_100279356 217
7 3300006353 Ga0075370_10030243 Ga0075370_100302431 225
8 3300046471 Ga0495650_0091029 Ga0495650_0091029_107_889 225
9 iso_pu_bacteria 2643221588 2643950156 227
10 3300002459 JGI24751J29686_10024934 JGI24751J29686_100249341 228
11 3300031852 Ga0307410_10067504 Ga0307410_100675045 231
12 3300026095 Ga0207676_10711850 Ga0207676_107118501 232
13 3300025904 Ga0207647_10085482 Ga0207647_100854822 234
14 3300031911 Ga0307412_10073356 Ga0307412_100733562 234
15 3300048929 Ga0496126_0055011 Ga0496126_0055011_300_1148 236
16 3300044712 Ga0453684_0065976 Ga0453684_0065976_1133_2014 239
17 3300021361 Ga0213872_10011295 Ga0213872_100112951 240
18 3300039447 Ga0436361_0551543 Ga0436361_0551543_5402_6220 240
19 3300049572 Ga0501036_0306860 Ga0501036_0306860_481_1311 240
20 3300026142 Ga0207698_10327813 Ga0207698_103278132 241
21 3300006177 Ga0075362_10005149 Ga0075362_100051492 242
22 3300025935 Ga0207709_10061655 Ga0207709_100616552 242
23 3300050489 nmdc:mga03683_4162_c1 nmdc:mga03683_4162_c1_3007_3885 242
24 3300050516 nmdc:mga0sz30_11928_c1 nmdc:mga0sz30_11928_c1_2151_3029 242
25 3300005347 Ga0070668_100240293 Ga0070668_1002402932 243
26 3300005355 Ga0070671_100012194 Ga0070671_1000121946 243
27 3300005617 Ga0068859_100055635 Ga0068859_1000556353 243
28 3300005842 Ga0068858_100013874 Ga0068858_1000138746 243
29 3300006931 Ga0097620_100055637 Ga0097620_1000556373 243
30 3300025931 Ga0207644_10027868 Ga0207644_100278681 243
31 3300025941 Ga0207711_10049535 Ga0207711_100495352 243
32 3300026035 Ga0207703_10022146 Ga0207703_100221464 243
33 3300049679 Ga0501249_000546 Ga0501249_000546_7965_8792 243
34 3300005327 Ga0070658_10097055 Ga0070658_100970553 244
35 3300005336 Ga0070680_100024370 Ga0070680_1000243703 244
36 3300005339 Ga0070660_100024232 Ga0070660_1000242325 244
37 3300005344 Ga0070661_100014008 Ga0070661_1000140081 244
38 3300005366 Ga0070659_100009671 Ga0070659_1000096715 244
39 3300005366 Ga0070659_100146865 Ga0070659_1001468652 244
40 3300005457 Ga0070662_100004063 Ga0070662_1000040637 244
41 3300005458 Ga0070681_10118923 Ga0070681_101189233 244
42 3300005530 Ga0070679_100004736 Ga0070679_10000473614 244
43 3300005539 Ga0068853_100041290 Ga0068853_1000412903 244
44 3300005563 Ga0068855_100022295 Ga0068855_1000222953 244
45 3300005563 Ga0068855_100073002 Ga0068855_1000730022 244
46 3300005564 Ga0070664_100005668 Ga0070664_10000566810 244
47 3300005614 Ga0068856_100108820 Ga0068856_1001088203 244
48 3300025909 Ga0207705_10069936 Ga0207705_100699362 244
49 3300025911 Ga0207654_10094128 Ga0207654_100941283 244
50 3300025912 Ga0207707_10251784 Ga0207707_102517841 244
51 3300025919 Ga0207657_10007000 Ga0207657_100070004 244
52 3300025920 Ga0207649_10102463 Ga0207649_101024631 244
53 3300025921 Ga0207652_10012692 Ga0207652_100126923 244
54 3300025932 Ga0207690_10002987 Ga0207690_100029873 244
55 3300025933 Ga0207706_10004487 Ga0207706_100044873 244
56 3300025944 Ga0207661_10035165 Ga0207661_100351653 244
57 3300025945 Ga0207679_10357020 Ga0207679_103570202 244
58 3300025949 Ga0207667_10020048 Ga0207667_100200488 244
59 3300025949 Ga0207667_10294569 Ga0207667_102945692 244
60 3300026041 Ga0207639_10013056 Ga0207639_100130564 244
61 3300026078 Ga0207702_10091538 Ga0207702_100915383 244
62 3300026116 Ga0207674_10056611 Ga0207674_100566116 244
63 3300053090 Ga0500646_0101228 Ga0500646_0101228_35_868 245
64 3300005563 Ga0068855_100011815 Ga0068855_10001181510 246
65 3300011119 Ga0105246_10000333 Ga0105246_1000033328 246
66 3300013100 Ga0157373_10013141 Ga0157373_100131416 246
67 3300025949 Ga0207667_10026720 Ga0207667_100267205 246
68 3300005539 Ga0068853_100024528 Ga0068853_1000245285 249
69 3300005577 Ga0068857_100019462 Ga0068857_1000194623 249
70 3300005614 Ga0068856_100458871 Ga0068856_1004588711 249
71 3300005616 Ga0068852_100032319 Ga0068852_1000323195 249
72 3300005834 Ga0068851_10079343 Ga0068851_100793433 249
73 3300025321 Ga0207656_10056310 Ga0207656_100563101 249
74 3300026041 Ga0207639_10003549 Ga0207639_100035498 249
75 3300026116 Ga0207674_10011479 Ga0207674_100114795 249
76 3300046460 Ga0495638_0097704 Ga0495638_0097704_885_1730 249
77 3300003791 Ga0055530_10003245 Ga0055530_100032454 250
78 3300005331 Ga0070670_100039326 Ga0070670_1000393265 250
79 3300005353 Ga0070669_100094923 Ga0070669_1000949232 250
80 3300005577 Ga0068857_100071026 Ga0068857_1000710264 250
81 3300005578 Ga0068854_100009241 Ga0068854_1000092412 250
82 3300025298 Ga0209050_1000277 Ga0209050_100027736 250
83 3300025923 Ga0207681_10103229 Ga0207681_101032292 250
84 3300025981 Ga0207640_10017316 Ga0207640_100173167 250
85 3300049568 Ga0501031_0143405 Ga0501031_0143405_464_1324 250
86 3300049571 Ga0501034_0095190 Ga0501034_0095190_979_1839 250
87 3300049742 Ga0501080_0317977 Ga0501080_0317977_171_1031 250
88 3300005530 Ga0070679_100002641 Ga0070679_1000026418 251
89 3300025921 Ga0207652_10043276 Ga0207652_100432766 251
90 3300048919 Ga0496116_0000017 Ga0496116_0000017_494156_495061 251
91 3300048921 Ga0496118_0113240 Ga0496118_0113240_508_1413 251
92 3300048924 Ga0496121_0000031 Ga0496121_0000031_25812_26684 251
93 3300048926 Ga0496123_0002940 Ga0496123_0002940_13282_14187 251
94 3300048927 Ga0496124_0168785 Ga0496124_0168785_700_1605 251
95 3300048928 Ga0496125_0085292 Ga0496125_0085292_412_1317 251
96 3300048929 Ga0496126_0000543 Ga0496126_0000543_59721_60626 251
97 3300025920 Ga0207649_10378502 Ga0207649_103785021 252
98 3300049581 Ga0501047_0241581 Ga0501047_0241581_334_1194 252
99 3300009177 Ga0105248_10527975 Ga0105248_105279751 253
100 3300048921 Ga0496118_0025169 Ga0496118_0025169_3701_4558 253
101 3300048924 Ga0496121_0001344 Ga0496121_0001344_28411_29268 253
102 iso_pu_bacteria 2848297114 2848298836 253
103 3300050496 nmdc:mga07m45_110206_c1 nmdc:mga07m45_110206_c1_664_1545 254
104 3300053094 Ga0500566_0172687 Ga0500566_0172687_27_908 254
105 3300053121 Ga0500607_000231 Ga0500607_000231_352_1233 254
106 3300053125 Ga0500618_003935 Ga0500618_003935_347_1240 254
107 3300053136 Ga0500559_0000228 Ga0500559_0000228_43455_44336 254
108 3300053136 Ga0500559_0015428 Ga0500559_0015428_1961_2842 254
109 3300053178 Ga0500637_0021671 Ga0500637_0021671_347_1228 254
110 3300053730 Ga0500645_037456 Ga0500645_037456_396_1277 254
111 3300048090 Ga0495615_0000041 Ga0495615_0000041_25703_26605 255
112 3300048926 Ga0496123_0000984 Ga0496123_0000984_3489_4391 255
113 3300048927 Ga0496124_0052927 Ga0496124_0052927_430_1332 255
114 3300005330 Ga0070690_100289624 Ga0070690_1002896242 256
115 3300005355 Ga0070671_100000545 Ga0070671_10000054518 256
116 3300005367 Ga0070667_100108965 Ga0070667_1001089652 256
117 3300005530 Ga0070679_100099296 Ga0070679_1000992962 256
118 3300006048 Ga0075363_100001685 Ga0075363_1000016855 256
119 3300006177 Ga0075362_10000003 Ga0075362_1000000352 256
120 3300006186 Ga0075369_10018793 Ga0075369_100187932 256
121 3300006195 Ga0075366_10000006 Ga0075366_10000006108 256
122 3300006353 Ga0075370_10000088 Ga0075370_100000882 256
123 3300025315 Ga0207697_10017352 Ga0207697_100173523 256
124 3300025931 Ga0207644_10000053 Ga0207644_1000005376 256
125 3300025986 Ga0207658_10020496 Ga0207658_100204964 256
126 3300026088 Ga0207641_10056095 Ga0207641_100560951 256
127 3300032133 Ga0316583_10001801 Ga0316583_100018012 256
128 3300048906 Ga0496103_0105884 Ga0496103_0105884_576_1448 256
129 3300048907 Ga0496104_0050534 Ga0496104_0050534_1036_1908 256
130 3300048914 Ga0496111_0125301 Ga0496111_0125301_40_912 256
131 3300050489 nmdc:mga03683_22_c1 nmdc:mga03683_22_c1_32378_33247 256
132 3300050493 nmdc:mga0k408_11023_c3 nmdc:mga0k408_11023_c3_716_1585 256
133 3300050493 nmdc:mga0k408_8_c1 nmdc:mga0k408_8_c1_160292_161161 256
134 3300050496 nmdc:mga07m45_20_c1 nmdc:mga07m45_20_c1_125002_125871 256
135 3300050516 nmdc:mga0sz30_39_c1 nmdc:mga0sz30_39_c1_1772_2641 256
136 iso_pu_bacteria 2739367865 2740030294 256
137 3300005563 Ga0068855_100127907 Ga0068855_1001279074 257
138 3300005842 Ga0068858_100046090 Ga0068858_1000460904 257
139 3300026035 Ga0207703_10038642 Ga0207703_100386424 257
140 3300032002 Ga0307416_100175626 Ga0307416_1001756262 257
141 3300032002 Ga0307416_100733811 Ga0307416_1007338112 257
142 3300032004 Ga0307414_10227360 Ga0307414_102273602 257
143 3300002459 JGI24751J29686_10000299 JGI24751J29686_1000029917 258
144 3300005335 Ga0070666_10046639 Ga0070666_100466392 258
145 3300005340 Ga0070689_100018286 Ga0070689_1000182863 258
146 3300005353 Ga0070669_100002298 Ga0070669_1000022983 258
147 3300005466 Ga0070685_10275305 Ga0070685_102753051 258
148 3300005548 Ga0070665_100110826 Ga0070665_1001108263 258
149 3300005617 Ga0068859_100077010 Ga0068859_1000770103 258
150 3300005842 Ga0068858_100067582 Ga0068858_1000675821 258
151 3300005843 Ga0068860_100028274 Ga0068860_1000282743 258
152 3300006195 Ga0075366_10005726 Ga0075366_100057262 258
153 3300006353 Ga0075370_10065894 Ga0075370_100658942 258
154 3300006931 Ga0097620_100077010 Ga0097620_1000770102 258
155 3300009101 Ga0105247_10306519 Ga0105247_103065191 258
156 3300009553 Ga0105249_10167167 Ga0105249_101671672 258
157 3300014325 Ga0163163_10080189 Ga0163163_100801892 258
158 3300025900 Ga0207710_10106059 Ga0207710_101060591 258
159 3300025923 Ga0207681_10000137 Ga0207681_1000013761 258
160 3300025936 Ga0207670_10135855 Ga0207670_101358552 258
161 3300025941 Ga0207711_10109757 Ga0207711_101097572 258
162 3300025949 Ga0207667_10117253 Ga0207667_101172532 258
163 3300025972 Ga0207668_10008565 Ga0207668_100085651 258
164 3300048903 Ga0496100_0152528 Ga0496100_0152528_231_1103 258
165 3300048905 Ga0496102_0041759 Ga0496102_0041759_2297_3169 258
166 3300048909 Ga0496106_0214345 Ga0496106_0214345_633_1505 258
167 3300048913 Ga0496110_0064368 Ga0496110_0064368_1675_2547 258
168 3300048916 Ga0496113_0001390 Ga0496113_0001390_6423_7295 258
169 3300048917 Ga0496114_0542365 Ga0496114_0542365_25_897 258
170 3300050493 nmdc:mga0k408_38827_c1 nmdc:mga0k408_38827_c1_392_1273 258
171 3300053122 Ga0500608_000175 Ga0500608_000175_1712_2596 258
172 3300053123 Ga0500614_009316 Ga0500614_009316_574_1458 258
173 3300053136 Ga0500559_0029253 Ga0500559_0029253_1229_2113 258
174 3300053138 Ga0500564_015324 Ga0500564_015324_2143_3027 258
175 3300053723 Ga0500567_002662 Ga0500567_002662_2951_3835 258
176 3300053729 Ga0500625_000002 Ga0500625_000002_281384_282268 258
177 iso_pu_bacteria 2895880812 2895888322 258
178 iso_pu_bacteria 2896184354 2896186946 258
179 2162886007 SwRhRL2b_contig_3541668 SwRhRL2b_0369.00005110 259
180 3300005289 Ga0065704_10070806 Ga0065704_1007080615 259
181 3300005355 Ga0070671_100091685 Ga0070671_1000916854 260
182 3300005841 Ga0068863_100010974 Ga0068863_1000109749 260
183 3300005843 Ga0068860_100022768 Ga0068860_1000227682 260
184 3300013102 Ga0157371_10070098 Ga0157371_100700983 260
185 3300025986 Ga0207658_10007296 Ga0207658_100072965 260
186 3300026088 Ga0207641_10275454 Ga0207641_102754542 260
187 3300031731 Ga0307405_10020490 Ga0307405_100204903 260
188 3300031911 Ga0307412_10142979 Ga0307412_101429791 260
189 3300032005 Ga0307411_10215040 Ga0307411_102150402 260
190 3300048929 Ga0496126_0010177 Ga0496126_0010177_1973_2857 260
191 3300049823 Ga0501044_0189245 Ga0501044_0189245_441_1328 260
192 iso_pu_bacteria 2896253425 2896254717 260
193 3300005841 Ga0068863_100000006 Ga0068863_100000006154 261
194 3300006042 Ga0075368_10000893 Ga0075368_100008933 261
195 3300006048 Ga0075363_100044645 Ga0075363_1000446452 261
196 3300006051 Ga0075364_10067654 Ga0075364_100676542 261
197 3300006178 Ga0075367_10002046 Ga0075367_100020464 261
198 3300006186 Ga0075369_10007219 Ga0075369_100072194 261
199 3300006195 Ga0075366_10106012 Ga0075366_101060122 261
200 3300026088 Ga0207641_10000054 Ga0207641_10000054105 261
201 3300027866 Ga0209813_10000243 Ga0209813_100002432 261
202 3300046460 Ga0495638_0104851 Ga0495638_0104851_324_1205 261
203 3300046660 Ga0495625_0044676 Ga0495625_0044676_101_982 261
204 3300046691 Ga0495670_0197526 Ga0495670_0197526_102_983 261
205 3300047472 Ga0495686_0115879 Ga0495686_0115879_234_1115 261
206 3300048911 Ga0496108_0173887 Ga0496108_0173887_108_992 261
207 3300048914 Ga0496111_0066199 Ga0496111_0066199_1182_2066 261
208 3300048924 Ga0496121_0154156 Ga0496121_0154156_639_1520 261
209 3300049571 Ga0501034_0152676 Ga0501034_0152676_893_1795 261
210 3300050489 nmdc:mga03683_373_c1 nmdc:mga03683_373_c1_8309_9190 261
211 3300050490 nmdc:mga03n38_11278_c1 nmdc:mga03n38_11278_c1_1793_2674 261
212 3300050491 nmdc:mga00v17_28069_c1 nmdc:mga00v17_28069_c1_2131_3012 261
213 3300050492 nmdc:mga0yw44_25503_c1 nmdc:mga0yw44_25503_c1_650_1531 261
214 3300050493 nmdc:mga0k408_85248_c1 nmdc:mga0k408_85248_c1_306_1187 261
215 3300050494 nmdc:mga06z11_349_c1 nmdc:mga06z11_349_c1_14735_15616 261
216 3300050495 nmdc:mga04h51_523_c1 nmdc:mga04h51_523_c1_2135_3016 261
217 3300050496 nmdc:mga07m45_15_c1 nmdc:mga07m45_15_c1_12719_13600 261
218 3300050516 nmdc:mga0sz30_12326_c1 nmdc:mga0sz30_12326_c1_2371_3252 261
219 3300053087 Ga0500643_000004 Ga0500643_000004_215719_216600 261
220 3300053121 Ga0500607_001306 Ga0500607_001306_18670_19551 261
221 3300053148 Ga0500590_010576 Ga0500590_010576_423_1328 261
222 3300053153 Ga0500616_0004004 Ga0500616_0004004_3735_4616 261
223 3300013306 Ga0163162_10095034 Ga0163162_100950344 262
224 3300046500 Ga0495596_0001908 Ga0495596_0001908_6712_7602 262
225 3300046507 Ga0495606_0005638 Ga0495606_0005638_1648_2538 262
226 3300046522 Ga0495643_0098066 Ga0495643_0098066_456_1346 262
227 3300048091 Ga0495626_0005484 Ga0495626_0005484_6133_7023 262
228 3300048929 Ga0496126_0135212 Ga0496126_0135212_287_1171 262
229 iso_pu_bacteria 2510917021 2511129755 262
230 iso_pu_bacteria 2818991438 2819553000 262
231 3300005336 Ga0070680_100191118 Ga0070680_1001911181 263
232 3300005366 Ga0070659_100140540 Ga0070659_1001405402 263
233 3300005535 Ga0070684_100006396 Ga0070684_1000063967 263
234 3300005564 Ga0070664_100066251 Ga0070664_1000662512 263
235 3300025933 Ga0207706_10066315 Ga0207706_100663153 263
236 3300025945 Ga0207679_10105119 Ga0207679_101051192 263
237 3300032004 Ga0307414_10190702 Ga0307414_101907022 263
238 3300046512 Ga0495610_0000015 Ga0495610_0000015_19302_20219 263
239 3300046512 Ga0495610_0000300 Ga0495610_0000300_45218_46111 263
240 3300046515 Ga0495620_0043177 Ga0495620_0043177_635_1552 263
241 3300046522 Ga0495643_0000023 Ga0495643_0000023_168584_169477 263
242 3300048924 Ga0496121_0008806 Ga0496121_0008806_5566_6471 263
243 3300005327 Ga0070658_10000124 Ga0070658_1000012470 264
244 3300005578 Ga0068854_100110533 Ga0068854_1001105333 264
245 3300005614 Ga0068856_100161135 Ga0068856_1001611352 264
246 3300005616 Ga0068852_100020817 Ga0068852_1000208173 264
247 3300009093 Ga0105240_10005088 Ga0105240_100050883 264
248 3300009551 Ga0105238_10324810 Ga0105238_103248102 264
249 3300025904 Ga0207647_10058696 Ga0207647_100586964 264
250 3300025909 Ga0207705_10000009 Ga0207705_10000009556 264
251 3300025913 Ga0207695_10076639 Ga0207695_100766393 264
252 3300025924 Ga0207694_10343247 Ga0207694_103432472 264
253 3300025981 Ga0207640_10065025 Ga0207640_100650254 264
254 3300026078 Ga0207702_10008724 Ga0207702_1000872410 264
255 3300026116 Ga0207674_10160499 Ga0207674_101604993 264
256 3300026142 Ga0207698_10000111 Ga0207698_1000011152 264
257 3300032004 Ga0307414_10125310 Ga0307414_101253102 264
258 3300042116 Ga0450912_000154 Ga0450912_000154_1594_2499 264
259 3300046519 Ga0495632_0001359 Ga0495632_0001359_15700_16617 264
260 iso_pu_bacteria 2882806704 2882807056 264
261 iso_pu_bacteria 3000865235 3000866427 264
262 3300006058 Ga0075432_10005801 Ga0075432_100058015 265
263 3300006177 Ga0075362_10166165 Ga0075362_101661651 265
264 3300006186 Ga0075369_10009614 Ga0075369_100096142 265
265 3300027907 Ga0207428_10158288 Ga0207428_101582882 265
266 3300046460 Ga0495638_0125247 Ga0495638_0125247_56_949 265
267 3300046558 Ga0495633_0051267 Ga0495633_0051267_662_1555 265
268 3300050491 nmdc:mga00v17_7002_c1 nmdc:mga00v17_7002_c1_280_1173 265
269 3300050516 nmdc:mga0sz30_9129_c1 nmdc:mga0sz30_9129_c1_2517_3410 265
270 3300005616 Ga0068852_100226964 Ga0068852_1002269643 266
271 3300013102 Ga0157371_10028906 Ga0157371_100289066 266
272 3300013104 Ga0157370_10231582 Ga0157370_102315822 266
273 3300013105 Ga0157369_10337042 Ga0157369_103370422 266
274 3300026142 Ga0207698_10167373 Ga0207698_101673732 266
275 3300031901 Ga0307406_10019699 Ga0307406_100196992 266
276 3300032126 Ga0307415_100167265 Ga0307415_1001672652 266
277 3300046501 Ga0495607_0007418 Ga0495607_0007418_1223_2128 266
278 3300046507 Ga0495606_0010708 Ga0495606_0010708_3730_4635 266
279 3300046522 Ga0495643_0008645 Ga0495643_0008645_2960_3865 266
280 3300049823 Ga0501044_0000290 Ga0501044_0000290_55599_56495 266
281 3300005337 Ga0070682_100198390 Ga0070682_1001983901 267
282 3300009094 Ga0111539_10564142 Ga0111539_105641421 267
283 3300017792 Ga0163161_10270220 Ga0163161_102702201 267
284 3300042015 Ga0439462_0000040 Ga0439462_0000040_10261_11160 267
285 3300013100 Ga0157373_10026951 Ga0157373_100269514 268
286 3300013102 Ga0157371_10007116 Ga0157371_100071163 268
287 3300013104 Ga0157370_10055946 Ga0157370_100559463 268
288 3300013105 Ga0157369_10013298 Ga0157369_100132987 268
289 3300013307 Ga0157372_10155331 Ga0157372_101553313 268
290 3300013307 Ga0157372_10278762 Ga0157372_102787622 268
291 3300031911 Ga0307412_10109232 Ga0307412_101092322 268
292 3300032004 Ga0307414_10073922 Ga0307414_100739222 268
293 3300032004 Ga0307414_10100799 Ga0307414_101007992 268
294 3300049823 Ga0501044_0199332 Ga0501044_0199332_444_1346 268
295 3300032005 Ga0307411_10409658 Ga0307411_104096582 269
296 3300005327 Ga0070658_10288700 Ga0070658_102887001 270
297 3300032004 Ga0307414_10051141 Ga0307414_100511413 270
298 iso_pu_bacteria 2738541275 2738712757 270
299 iso_pu_bacteria 2738541301 2738851181 270
300 iso_pu_bacteria 2738541304 2738866911 270
301 iso_pu_bacteria 2738543022 2739299428 270
302 iso_pu_bacteria 2738543033 2739361107 270
303 iso_pu_bacteria 2928959182 2928963023 270
304 2162886007 SwRhRL2b_contig_2924680 SwRhRL2b_0202.00000150 274
305 3300005289 Ga0065704_10079185 Ga0065704_100791852 274
306 3300005353 Ga0070669_100098928 Ga0070669_1000989282 274
307 3300005355 Ga0070671_100031293 Ga0070671_1000312934 274
308 3300005367 Ga0070667_100021758 Ga0070667_1000217583 274
309 3300005844 Ga0068862_100031787 Ga0068862_1000317873 274
310 3300009092 Ga0105250_10004007 Ga0105250_100040075 274
311 3300025711 Ga0207696_1009011 Ga0207696_10090112 274
312 3300025923 Ga0207681_10001319 Ga0207681_100013193 274
313 3300025931 Ga0207644_10022873 Ga0207644_100228734 274
314 3300025986 Ga0207658_10014837 Ga0207658_100148374 274
315 3300028380 Ga0268265_10015588 Ga0268265_100155885 274
316 3300048905 Ga0496102_0001387 Ga0496102_0001387_18915_19865 274
317 3300048906 Ga0496103_0000482 Ga0496103_0000482_12112_13062 274
318 3300048907 Ga0496104_0003250 Ga0496104_0003250_11793_12743 274
319 3300048908 Ga0496105_0000549 Ga0496105_0000549_18858_19808 274
320 3300048916 Ga0496113_0000100 Ga0496113_0000100_23574_24524 274
321 3300048918 Ga0496115_0119234 Ga0496115_0119234_1207_2157 274
322 3300048919 Ga0496116_0043827 Ga0496116_0043827_1508_2458 274
323 3300048920 Ga0496117_0000566 Ga0496117_0000566_47717_48667 274
324 3300048922 Ga0496119_0001659 Ga0496119_0001659_4617_5567 274
325 3300048923 Ga0496120_0013870 Ga0496120_0013870_715_1665 274
326 3300048925 Ga0496122_0001874 Ga0496122_0001874_12109_13059 274
327 3300048926 Ga0496123_0001801 Ga0496123_0001801_15133_16083 274
328 3300048927 Ga0496124_0001679 Ga0496124_0001679_25318_26238 274
329 3300048928 Ga0496125_0001603 Ga0496125_0001603_12109_13059 274
330 3300048929 Ga0496126_0001625 Ga0496126_0001625_20590_21540 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

47

264

0.91

Feature Viewer

pLDDT pTM Quality
56.38 0.34 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map