F410167

General Info

Members Datasets Scaffolds Average Seq Length
330 145 660 266

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100093853|Ga0307415_1000938532
Length 302
Sequence MTSLLQTYVSAPTPEREREIAALGPWFHNLHLPDGAQTAPGHPLGDFPAFKWREIAPHLPQDLRGWRALDIGCNAGFYTFELARRGAHVTGIDVEPLFLAQAEWAAVEFGLADRVEFHRRQVYDLAHDDASYDLVLFMGVFYHLRYPMLGLDVVAERVRRLMVFQTLTMPGSEVYAGASQDRGVMDRDDFLQPGWPKVAFIEREFAGDPTNWWAPNHACVEAMLRSSGLKVTGRPGHEIYLCEPDPQAAAWPRGRGRMELLAATGRPWLDAARAWEAEHAGAARRGEARADGVAEPRHAGGE

Samples

Sample ID Description Type Environment
1 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
70 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
91 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
113 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
120 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
121 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
122 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
123 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
124 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
125 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
126 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
127 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
128 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
131 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
132 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
133 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
139 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
142 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
143 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
144 2919404418 Luteibacter sp. 3190 Isolate Unclassified
145 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 0
Isolates 1.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 1.52
Rhizosphere 95.45
Stem 0
Stem Tuber 0
Unclassified 5.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307415_100093853 3300032126 Bacteria 2180
2 rootH2_10000834 3300003320 Bacteria 40472
3 rootH1_10061299 3300003323 Bacteria 3415
4 Ga0070676_10054732 3300005328 Bacteria 2353
5 Ga0070683_100000787 3300005329 Bacteria 23394
6 Ga0070690_100208725 3300005330 Bacteria 1362
7 Ga0070670_100015712 3300005331 Bacteria 6499
8 Ga0070680_100000072 3300005336 Bacteria 53846
9 Ga0070680_100002366 3300005336 Bacteria 13931
10 Ga0070680_100018537 3300005336 Bacteria 5501
11 Ga0070680_100033816 3300005336 Bacteria 4122
12 Ga0070660_100064505 3300005339 Bacteria 2849
13 Ga0070661_100205169 3300005344 Bacteria 1507
14 Ga0070675_100000070 3300005354 Bacteria 59599
15 Ga0070674_100395253 3300005356 Unclassified 1128
16 Ga0070688_100000028 3300005365 Bacteria 67085
17 Ga0070688_100000517 3300005365 Bacteria 19506
18 Ga0070714_100011835 3300005435 Bacteria 6933
19 Ga0070681_10001939 3300005458 Bacteria 18673
20 Ga0070681_10051125 3300005458 Bacteria 4122
21 Ga0070681_10055002 3300005458 Bacteria 3965
22 Ga0070685_10000010 3300005466 Bacteria 146946
23 Ga0070685_10000027 3300005466 Bacteria 91882
24 Ga0070685_10353853 3300005466 Bacteria 1005
25 Ga0070679_100000193 3300005530 Bacteria 49569
26 Ga0070679_100050978 3300005530 Bacteria 4122
27 Ga0070679_100056029 3300005530 Bacteria 3927
28 Ga0070679_100073885 3300005530 Bacteria 3400
29 Ga0070684_100037784 3300005535 Bacteria 4144
30 Ga0070684_100055777 3300005535 Bacteria 3446
31 Ga0068853_100012274 3300005539 Bacteria 6966
32 Ga0070665_100000134 3300005548 Bacteria 139586
33 Ga0070665_100000770 3300005548 Bacteria 42271
34 Ga0070665_100310710 3300005548 Bacteria 1580
35 Ga0068855_100002742 3300005563 Bacteria 21688
36 Ga0068855_100029985 3300005563 Bacteria 6505
37 Ga0068855_100049337 3300005563 Bacteria 4964
38 Ga0068855_100055000 3300005563 Bacteria 4676
39 Ga0068855_100321587 3300005563 Bacteria 1710
40 Ga0068854_100013096 3300005578 Bacteria 5436
41 Ga0068856_100001373 3300005614 Bacteria 25601
42 Ga0068856_100092943 3300005614 Bacteria 3002
43 Ga0068856_100161039 3300005614 Bacteria 2254
44 Ga0068856_100376290 3300005614 Unclassified 1439
45 Ga0068852_100000022 3300005616 Bacteria 125196
46 Ga0068852_100218659 3300005616 Bacteria 1811
47 Ga0070717_10000008 3300006028 Bacteria 299056
48 Ga0070712_100049709 3300006175 Bacteria 2913
49 Ga0075427_10002274 3300006194 Bacteria 2561
50 Ga0075428_100009586 3300006844 Bacteria 10754
51 Ga0075430_100227940 3300006846 Bacteria 1545
52 Ga0075431_100290996 3300006847 Unclassified 1652
53 Ga0068865_100000040 3300006881 Bacteria 72979
54 Ga0105240_10034481 3300009093 Bacteria 6527
55 Ga0105240_10047290 3300009093 Bacteria 5445
56 Ga0105240_10707966 3300009093 Unclassified 1099
57 Ga0111539_10140418 3300009094 Bacteria 2828
58 Ga0114129_10015645 3300009147 Bacteria 10789
59 Ga0105241_10594171 3300009174 Bacteria 999
60 Ga0105248_10000037 3300009177 Bacteria 180751
61 Ga0105237_10032594 3300009545 Bacteria 5275
62 Ga0105237_10133635 3300009545 Bacteria 2476
63 Ga0105237_10185317 3300009545 Bacteria 2081
64 Ga0105238_10335297 3300009551 Bacteria 1500
65 Ga0157373_10184927 3300013100 Bacteria 1468
66 Ga0157371_10002779 3300013102 Bacteria 16418
67 Ga0157370_10080917 3300013104 Bacteria 3058
68 Ga0157369_10000051 3300013105 Bacteria 165672
69 Ga0157369_10119431 3300013105 Bacteria 2798
70 Ga0157378_10003336 3300013297 Bacteria 14284
71 Ga0157372_10009584 3300013307 Bacteria 10294
72 Ga0157372_10120237 3300013307 Bacteria 3016
73 Ga0157372_10195735 3300013307 Unclassified 2342
74 Ga0157372_10257492 3300013307 Bacteria 2026
75 Ga0157372_10347404 3300013307 Bacteria 1728
76 Ga0157372_10427682 3300013307 Bacteria 1543
77 Ga0157372_11070254 3300013307 Bacteria 933
78 Ga0213875_10000022 3300021388 Bacteria 215075
79 Ga0209676_1001855 3300025292 Bacteria 17419
80 Ga0209025_1071106 3300025294 Bacteria 1235
81 Ga0207645_10022106 3300025907 Bacteria 4142
82 Ga0207707_10000481 3300025912 Bacteria 41355
83 Ga0207707_10005642 3300025912 Bacteria 10953
84 Ga0207707_10258388 3300025912 Bacteria 1512
85 Ga0207695_10020139 3300025913 Bacteria 7651
86 Ga0207695_10137702 3300025913 Bacteria 2393
87 Ga0207671_10019404 3300025914 Bacteria 5198
88 Ga0207671_10223908 3300025914 Bacteria 1474
89 Ga0207693_10057294 3300025915 Bacteria 3054
90 Ga0207660_10000679 3300025917 Bacteria 22750
91 Ga0207660_10001424 3300025917 Bacteria 16048
92 Ga0207660_10006106 3300025917 Bacteria 7822
93 Ga0207660_10246396 3300025917 Bacteria 1409
94 Ga0207657_10042267 3300025919 Bacteria 4023
95 Ga0207652_10001248 3300025921 Bacteria 22669
96 Ga0207652_10003955 3300025921 Bacteria 12117
97 Ga0207652_10050006 3300025921 Bacteria 3581
98 Ga0207694_10081956 3300025924 Bacteria 2535
99 Ga0207650_10010388 3300025925 Bacteria 6384
100 Ga0207659_10000018 3300025926 Bacteria 156920
101 Ga0207664_10107349 3300025929 Bacteria 2316
102 Ga0207704_10000079 3300025938 Bacteria 58183
103 Ga0207711_10000011 3300025941 Bacteria 518817
104 Ga0207661_10000516 3300025944 Bacteria 24975
105 Ga0207661_10017606 3300025944 Bacteria 5293
106 Ga0207667_10103868 3300025949 Bacteria 2930
107 Ga0207667_10209385 3300025949 Bacteria 1999
108 Ga0207702_10028722 3300026078 Bacteria 4624
109 Ga0207702_10036242 3300026078 Bacteria 4125
110 Ga0207702_10179104 3300026078 Bacteria 1950
111 Ga0207698_10000015 3300026142 Bacteria 207368
112 Ga0207698_10139738 3300026142 Bacteria 2084
113 Ga0268266_10000637 3300028379 Bacteria 47708
114 Ga0268266_10003144 3300028379 Bacteria 16769
115 Ga0268266_10746478 3300028379 Bacteria 944
116 Ga0316178_1030790 3300030735 Bacteria 1628
117 Ga0307408_100000003 3300031548 Bacteria 618438
118 Ga0307408_100013177 3300031548 Bacteria 5488
119 Ga0307408_100014389 3300031548 Bacteria 5255
120 Ga0307408_100051435 3300031548 Bacteria 2967
121 Ga0307408_100096997 3300031548 Bacteria 2238
122 Ga0307408_100158370 3300031548 Bacteria 1796
123 Ga0307408_100405707 3300031548 Bacteria 1171
124 Ga0316576_10273739 3300031727 Bacteria 1265
125 Ga0316578_10125347 3300031728 Bacteria 1544
126 Ga0307405_10009479 3300031731 Bacteria 4993
127 Ga0307405_10014181 3300031731 Bacteria 4277
128 Ga0307405_10044771 3300031731 Bacteria 2708
129 Ga0307405_10125456 3300031731 Bacteria 1764
130 Ga0307405_10161132 3300031731 Unclassified 1589
131 Ga0307405_10477449 3300031731 Bacteria 994
132 Ga0307413_10001452 3300031824 Bacteria 9001
133 Ga0307413_10001720 3300031824 Bacteria 8556
134 Ga0307413_10002667 3300031824 Bacteria 7311
135 Ga0307413_10007928 3300031824 Bacteria 4972
136 Ga0307413_10074559 3300031824 Bacteria 2149
137 Ga0307413_10075215 3300031824 Bacteria 2143
138 Ga0307413_10199806 3300031824 Bacteria 1443
139 Ga0307413_10243471 3300031824 Bacteria 1329
140 Ga0307413_10278672 3300031824 Bacteria 1256
141 Ga0307410_10000011 3300031852 Bacteria 80087
142 Ga0307410_10002004 3300031852 Bacteria 9602
143 Ga0307410_10003242 3300031852 Bacteria 8123
144 Ga0307410_10004154 3300031852 Bacteria 7423
145 Ga0307410_10006236 3300031852 Bacteria 6417
146 Ga0307410_10012382 3300031852 Bacteria 4930
147 Ga0307410_10050292 3300031852 Bacteria 2802
148 Ga0307410_10054596 3300031852 Bacteria 2709
149 Ga0307410_10161532 3300031852 Bacteria 1679
150 Ga0307410_10324631 3300031852 Bacteria 1222
151 Ga0307406_10001974 3300031901 Bacteria 11201
152 Ga0307406_10006732 3300031901 Bacteria 6355
153 Ga0307406_10040112 3300031901 Bacteria 2909
154 Ga0307406_10062763 3300031901 Bacteria 2404
155 Ga0307406_10098148 3300031901 Bacteria 1988
156 Ga0307407_10024579 3300031903 Bacteria 3162
157 Ga0307407_10037947 3300031903 Bacteria 2665
158 Ga0307407_10066547 3300031903 Bacteria 2125
159 Ga0307407_10177454 3300031903 Bacteria 1409
160 Ga0307412_10011505 3300031911 Bacteria 5129
161 Ga0307412_10028708 3300031911 Bacteria 3484
162 Ga0307412_10030924 3300031911 Bacteria 3376
163 Ga0307412_10188379 3300031911 Bacteria 1558
164 Ga0307412_10238409 3300031911 Bacteria 1405
165 Ga0307412_10326590 3300031911 Unclassified 1223
166 Ga0307412_10347727 3300031911 Bacteria 1189
167 Ga0307409_100000045 3300031995 Bacteria 44221
168 Ga0307409_100000202 3300031995 Bacteria 23457
169 Ga0307409_100000247 3300031995 Bacteria 21734
170 Ga0307409_100000776 3300031995 Bacteria 14462
171 Ga0307409_100020531 3300031995 Bacteria 4505
172 Ga0307409_100025362 3300031995 Bacteria 4157
173 Ga0307409_100055874 3300031995 Bacteria 3051
174 Ga0307409_100056223 3300031995 Bacteria 3042
175 Ga0307409_100059277 3300031995 Bacteria 2978
176 Ga0307409_100235464 3300031995 Bacteria 1663
177 Ga0307409_100464378 3300031995 Bacteria 1225
178 Ga0307416_100000027 3300032002 Bacteria 172418
179 Ga0307416_100001545 3300032002 Bacteria 12583
180 Ga0307416_100008244 3300032002 Bacteria 6702
181 Ga0307416_100012347 3300032002 Bacteria 5750
182 Ga0307416_100020109 3300032002 Bacteria 4755
183 Ga0307416_100023115 3300032002 Bacteria 4504
184 Ga0307416_100027000 3300032002 Bacteria 4243
185 Ga0307416_100031220 3300032002 Bacteria 4007
186 Ga0307416_100039217 3300032002 Bacteria 3664
187 Ga0307416_100040993 3300032002 Bacteria 3603
188 Ga0307416_100087624 3300032002 Bacteria 2658
189 Ga0307416_100109210 3300032002 Bacteria 2432
190 Ga0307416_100163483 3300032002 Bacteria 2061
191 Ga0307414_10001655 3300032004 Bacteria 11591
192 Ga0307414_10037359 3300032004 Bacteria 3251
193 Ga0307414_10059482 3300032004 Bacteria 2698
194 Ga0307414_10081767 3300032004 Bacteria 2366
195 Ga0307414_10139756 3300032004 Bacteria 1894
196 Ga0307414_10152553 3300032004 Bacteria 1824
197 Ga0307414_10273980 3300032004 Bacteria 1415
198 Ga0307411_10005393 3300032005 Bacteria 6276
199 Ga0307411_10009788 3300032005 Bacteria 5066
200 Ga0307411_10013163 3300032005 Bacteria 4551
201 Ga0307411_10017255 3300032005 Bacteria 4107
202 Ga0307411_10054602 3300032005 Bacteria 2624
203 Ga0307411_10072506 3300032005 Bacteria 2338
204 Ga0307411_10116639 3300032005 Bacteria 1922
205 Ga0307411_10127131 3300032005 Bacteria 1855
206 Ga0307411_10129388 3300032005 Bacteria 1842
207 Ga0307411_10633437 3300032005 Unclassified 923
208 Ga0307415_100000248 3300032126 Bacteria 23334
209 Ga0307415_100002082 3300032126 Bacteria 9892
210 Ga0307415_100014331 3300032126 Bacteria 4658
211 Ga0307415_100023097 3300032126 Bacteria 3853
212 Ga0307415_100031874 3300032126 Unclassified 3402
213 Ga0307415_100033222 3300032126 Bacteria 3348
214 Ga0307415_100099648 3300032126 Bacteria 2127
215 Ga0307415_100113705 3300032126 Bacteria 2014
216 Ga0307415_100172324 3300032126 Unclassified 1689
217 Ga0307415_100177696 3300032126 Bacteria 1667
218 Ga0307415_100235098 3300032126 Bacteria 1478
219 Ga0307415_100298668 3300032126 Unclassified 1333
220 Ga0307415_100508579 3300032126 Unclassified 1055
221 Ga0316584_0077358 3300036712 Bacteria 2493
222 Ga0395899_0046292 3300037312 Bacteria 3240
223 Ga0395899_0073825 3300037312 Bacteria 2493
224 Ga0395900_0078691 3300037418 Bacteria 3387
225 Ga0395898_0009011 3300037466 Bacteria 10504
226 Ga0395898_0120743 3300037466 Bacteria 2511
227 Ga0395905_0000010 3300037471 Bacteria 460729
228 Ga0395905_0000592 3300037471 Bacteria 48656
229 Ga0395905_0243720 3300037471 Bacteria 1679
230 Ga0436364_0530951 3300037853 Bacteria 215117
231 Ga0395901_0056421 3300038443 Bacteria 4085
232 Ga0395901_0283343 3300038443 Bacteria 1721
233 Ga0436365_0346827 3300039437 Bacteria 1172
234 Ga0436365_1447825 3300039437 Bacteria 2367
235 Ga0451577_0007103 3300042876 Bacteria 11040
236 Ga0451577_0308413 3300042876 Bacteria 1434
237 Ga0466972_0002002 3300044658 Bacteria 9978
238 Ga0466972_0035205 3300044658 Bacteria 2451
239 Ga0453683_0000655 3300044673 Bacteria 37122
240 Ga0466966_0067396 3300044684 Bacteria 2248
241 Ga0466966_0092654 3300044684 Bacteria 1874
242 Ga0466966_0096380 3300044684 Bacteria 1832
243 Ga0466961_0002715 3300044693 Bacteria 11002
244 Ga0466961_0047007 3300044693 Bacteria 2760
245 Ga0466961_0060182 3300044693 Bacteria 2415
246 Ga0466961_0129211 3300044693 Bacteria 1584
247 Ga0466961_0267682 3300044693 Bacteria 1047
248 Ga0466963_0043053 3300044694 Bacteria 2967
249 Ga0466963_0146822 3300044694 Bacteria 1637
250 Ga0466963_0176189 3300044694 Bacteria 1492
251 Ga0466964_0000303 3300044706 Bacteria 14520
252 Ga0453684_0002117 3300044712 Bacteria 50043
253 Ga0453684_0013175 3300044712 Bacteria 13479
254 Ga0453684_0029823 3300044712 Bacteria 7729
255 Ga0453684_0128176 3300044712 Bacteria 3050
256 Ga0453684_0213464 3300044712 Bacteria 2241
257 Ga0453684_0843489 3300044712 Unclassified 985
258 Ga0466971_0013612 3300044719 Bacteria 3575
259 Ga0466970_0001080 3300044765 Bacteria 13202
260 Ga0466957_0084989 3300044842 Bacteria 1976
261 Ga0466957_0309445 3300044842 Bacteria 1063
262 Ga0466960_0097435 3300044901 Bacteria 1509
263 Ga0466960_0122235 3300044901 Bacteria 1365
264 Ga0466959_0055045 3300045049 Bacteria 2905
265 Ga0466959_0094641 3300045049 Bacteria 2143
266 Ga0466959_0097060 3300045049 Bacteria 2112
267 Ga0466959_0167488 3300045049 Bacteria 1542
268 Ga0466959_0249509 3300045049 Bacteria 1224
269 Ga0466959_0338784 3300045049 Bacteria 1026
270 Ga0451576_0000804 3300045051 Bacteria 61506
271 Ga0451576_0001005 3300045051 Bacteria 52161
272 Ga0451576_0011057 3300045051 Bacteria 10303
273 Ga0451576_0458019 3300045051 Unclassified 1339
274 Ga0466958_0154101 3300045836 Bacteria 1450
275 Ga0466958_0244749 3300045836 Unclassified 1146
276 Ga0466958_0305306 3300045836 Bacteria 1022
277 Ga0466967_0060122 3300045976 Bacteria 3366
278 Ga0466967_0138475 3300045976 Bacteria 2265
279 Ga0466967_0146431 3300045976 Bacteria 2203
280 Ga0466967_0276788 3300045976 Bacteria 1609
281 Ga0466967_0521017 3300045976 Bacteria 1168
282 Ga0495606_0000017 3300046507 Bacteria 284549
283 Ga0495668_0200344 3300046616 Bacteria 1093
284 Ga0496100_0291690 3300048903 Bacteria 1219
285 Ga0496102_0139388 3300048905 Bacteria 2274
286 Ga0496106_0530467 3300048909 Bacteria 945
287 Ga0496109_0177655 3300048912 Bacteria 1999
288 Ga0496114_0121714 3300048917 Bacteria 2244
289 Ga0501291_033227 3300049514 Unclassified 879
290 Ga0501040_0001078 3300049576 Bacteria 17266
291 Ga0501042_0001067 3300049578 Bacteria 15685
292 Ga0501047_0192395 3300049581 Bacteria 1903
293 Ga0501047_0243775 3300049581 Bacteria 1647
294 Ga0501047_0431392 3300049581 Bacteria 1149
295 Ga0501067_0010337 3300049583 Bacteria 5164
296 Ga0501067_0229189 3300049583 Bacteria 1034
297 Ga0501070_0012644 3300049586 Bacteria 7118
298 Ga0501070_0212213 3300049586 Bacteria 1589
299 Ga0501074_0039346 3300049590 Bacteria 3425
300 Ga0501075_0000570 3300049591 Bacteria 22456
301 Ga0501077_0000348 3300049593 Bacteria 27335
302 Ga0501198_012334 3300049649 Bacteria 1285
303 Ga0501201_008791 3300049651 Bacteria 977
304 Ga0501216_013087 3300049660 Bacteria 1371
305 Ga0501242_013894 3300049674 Bacteria 993
306 Ga0501243_000028 3300049675 Bacteria 12806
307 Ga0501247_005747 3300049677 Bacteria 1389
308 Ga0501225_0002647 3300049705 Bacteria 5501
309 Ga0501225_0047251 3300049705 Bacteria 1194
310 Ga0501234_019593 3300049707 Unclassified 1074
311 Ga0501080_0006242 3300049742 Bacteria 10693
312 Ga0501263_005565 3300049760 Bacteria 1426
313 Ga0501263_026477 3300049760 Bacteria 803
314 Ga0501268_001509 3300049765 Unclassified 2915
315 Ga0501268_022780 3300049765 Bacteria 1083
316 Ga0501272_001609 3300049769 Bacteria 2162
317 Ga0501273_006478 3300049770 Bacteria 1355
318 Ga0501035_0003237 3300049822 Bacteria 15599
319 Ga0501044_0071873 3300049823 Bacteria 3518
320 nmdc:mga05p37_8468_c1 3300050507 Bacteria 12160
321 nmdc:mga06r32_165293_c1 3300050510 Bacteria 2196
322 Ga0590075_018664 3300059424 Bacteria 1717
323 Ga0590075_040170 3300059424 Bacteria 1195
324 Ga0590077_008852 3300059426 Bacteria 2060
325 Ga0501082_0001713 3300060353 Bacteria 19338
326 2788432849 2786546940 Bacteria 6396474
327 2894415322 2894414249 Bacteria 4405451
328 2910248549 2910245624 Bacteria 6935613
329 2919405345 2919404418 Bacteria 4232372
330 8003014740 8003014200 Bacteria 4059994
331 Ga0307415_100093853
332 rootH2_10000834
333 rootH1_10061299
334 Ga0070676_10054732
335 Ga0070683_100000787
336 Ga0070690_100208725
337 Ga0070670_100015712
338 Ga0070680_100000072
339 Ga0070680_100002366
340 Ga0070680_100018537
341 Ga0070680_100033816
342 Ga0070660_100064505
343 Ga0070661_100205169
344 Ga0070675_100000070
345 Ga0070674_100395253
346 Ga0070688_100000028
347 Ga0070688_100000517
348 Ga0070714_100011835
349 Ga0070681_10001939
350 Ga0070681_10051125
351 Ga0070681_10055002
352 Ga0070685_10000010
353 Ga0070685_10000027
354 Ga0070685_10353853
355 Ga0070679_100000193
356 Ga0070679_100050978
357 Ga0070679_100056029
358 Ga0070679_100073885
359 Ga0070684_100037784
360 Ga0070684_100055777
361 Ga0068853_100012274
362 Ga0070665_100000134
363 Ga0070665_100000770
364 Ga0070665_100310710
365 Ga0068855_100002742
366 Ga0068855_100029985
367 Ga0068855_100049337
368 Ga0068855_100055000
369 Ga0068855_100321587
370 Ga0068854_100013096
371 Ga0068856_100001373
372 Ga0068856_100092943
373 Ga0068856_100161039
374 Ga0068856_100376290
375 Ga0068852_100000022
376 Ga0068852_100218659
377 Ga0070717_10000008
378 Ga0070712_100049709
379 Ga0075427_10002274
380 Ga0075428_100009586
381 Ga0075430_100227940
382 Ga0075431_100290996
383 Ga0068865_100000040
384 Ga0105240_10034481
385 Ga0105240_10047290
386 Ga0105240_10707966
387 Ga0111539_10140418
388 Ga0114129_10015645
389 Ga0105241_10594171
390 Ga0105248_10000037
391 Ga0105237_10032594
392 Ga0105237_10133635
393 Ga0105237_10185317
394 Ga0105238_10335297
395 Ga0157373_10184927
396 Ga0157371_10002779
397 Ga0157370_10080917
398 Ga0157369_10000051
399 Ga0157369_10119431
400 Ga0157378_10003336
401 Ga0157372_10009584
402 Ga0157372_10120237
403 Ga0157372_10195735
404 Ga0157372_10257492
405 Ga0157372_10347404
406 Ga0157372_10427682
407 Ga0157372_11070254
408 Ga0213875_10000022
409 Ga0209676_1001855
410 Ga0209025_1071106
411 Ga0207645_10022106
412 Ga0207707_10000481
413 Ga0207707_10005642
414 Ga0207707_10258388
415 Ga0207695_10020139
416 Ga0207695_10137702
417 Ga0207671_10019404
418 Ga0207671_10223908
419 Ga0207693_10057294
420 Ga0207660_10000679
421 Ga0207660_10001424
422 Ga0207660_10006106
423 Ga0207660_10246396
424 Ga0207657_10042267
425 Ga0207652_10001248
426 Ga0207652_10003955
427 Ga0207652_10050006
428 Ga0207694_10081956
429 Ga0207650_10010388
430 Ga0207659_10000018
431 Ga0207664_10107349
432 Ga0207704_10000079
433 Ga0207711_10000011
434 Ga0207661_10000516
435 Ga0207661_10017606
436 Ga0207667_10103868
437 Ga0207667_10209385
438 Ga0207702_10028722
439 Ga0207702_10036242
440 Ga0207702_10179104
441 Ga0207698_10000015
442 Ga0207698_10139738
443 Ga0268266_10000637
444 Ga0268266_10003144
445 Ga0268266_10746478
446 Ga0316178_1030790
447 Ga0307408_100000003
448 Ga0307408_100013177
449 Ga0307408_100014389
450 Ga0307408_100051435
451 Ga0307408_100096997
452 Ga0307408_100158370
453 Ga0307408_100405707
454 Ga0316576_10273739
455 Ga0316578_10125347
456 Ga0307405_10009479
457 Ga0307405_10014181
458 Ga0307405_10044771
459 Ga0307405_10125456
460 Ga0307405_10161132
461 Ga0307405_10477449
462 Ga0307413_10001452
463 Ga0307413_10001720
464 Ga0307413_10002667
465 Ga0307413_10007928
466 Ga0307413_10074559
467 Ga0307413_10075215
468 Ga0307413_10199806
469 Ga0307413_10243471
470 Ga0307413_10278672
471 Ga0307410_10000011
472 Ga0307410_10002004
473 Ga0307410_10003242
474 Ga0307410_10004154
475 Ga0307410_10006236
476 Ga0307410_10012382
477 Ga0307410_10050292
478 Ga0307410_10054596
479 Ga0307410_10161532
480 Ga0307410_10324631
481 Ga0307406_10001974
482 Ga0307406_10006732
483 Ga0307406_10040112
484 Ga0307406_10062763
485 Ga0307406_10098148
486 Ga0307407_10024579
487 Ga0307407_10037947
488 Ga0307407_10066547
489 Ga0307407_10177454
490 Ga0307412_10011505
491 Ga0307412_10028708
492 Ga0307412_10030924
493 Ga0307412_10188379
494 Ga0307412_10238409
495 Ga0307412_10326590
496 Ga0307412_10347727
497 Ga0307409_100000045
498 Ga0307409_100000202
499 Ga0307409_100000247
500 Ga0307409_100000776
501 Ga0307409_100020531
502 Ga0307409_100025362
503 Ga0307409_100055874
504 Ga0307409_100056223
505 Ga0307409_100059277
506 Ga0307409_100235464
507 Ga0307409_100464378
508 Ga0307416_100000027
509 Ga0307416_100001545
510 Ga0307416_100008244
511 Ga0307416_100012347
512 Ga0307416_100020109
513 Ga0307416_100023115
514 Ga0307416_100027000
515 Ga0307416_100031220
516 Ga0307416_100039217
517 Ga0307416_100040993
518 Ga0307416_100087624
519 Ga0307416_100109210
520 Ga0307416_100163483
521 Ga0307414_10001655
522 Ga0307414_10037359
523 Ga0307414_10059482
524 Ga0307414_10081767
525 Ga0307414_10139756
526 Ga0307414_10152553
527 Ga0307414_10273980
528 Ga0307411_10005393
529 Ga0307411_10009788
530 Ga0307411_10013163
531 Ga0307411_10017255
532 Ga0307411_10054602
533 Ga0307411_10072506
534 Ga0307411_10116639
535 Ga0307411_10127131
536 Ga0307411_10129388
537 Ga0307411_10633437
538 Ga0307415_100000248
539 Ga0307415_100002082
540 Ga0307415_100014331
541 Ga0307415_100023097
542 Ga0307415_100031874
543 Ga0307415_100033222
544 Ga0307415_100099648
545 Ga0307415_100113705
546 Ga0307415_100172324
547 Ga0307415_100177696
548 Ga0307415_100235098
549 Ga0307415_100298668
550 Ga0307415_100508579
551 Ga0316584_0077358
552 Ga0395899_0046292
553 Ga0395899_0073825
554 Ga0395900_0078691
555 Ga0395898_0009011
556 Ga0395898_0120743
557 Ga0395905_0000010
558 Ga0395905_0000592
559 Ga0395905_0243720
560 Ga0436364_0530951
561 Ga0395901_0056421
562 Ga0395901_0283343
563 Ga0436365_0346827
564 Ga0436365_1447825
565 Ga0451577_0007103
566 Ga0451577_0308413
567 Ga0466972_0002002
568 Ga0466972_0035205
569 Ga0453683_0000655
570 Ga0466966_0067396
571 Ga0466966_0092654
572 Ga0466966_0096380
573 Ga0466961_0002715
574 Ga0466961_0047007
575 Ga0466961_0060182
576 Ga0466961_0129211
577 Ga0466961_0267682
578 Ga0466963_0043053
579 Ga0466963_0146822
580 Ga0466963_0176189
581 Ga0466964_0000303
582 Ga0453684_0002117
583 Ga0453684_0013175
584 Ga0453684_0029823
585 Ga0453684_0128176
586 Ga0453684_0213464
587 Ga0453684_0843489
588 Ga0466971_0013612
589 Ga0466970_0001080
590 Ga0466957_0084989
591 Ga0466957_0309445
592 Ga0466960_0097435
593 Ga0466960_0122235
594 Ga0466959_0055045
595 Ga0466959_0094641
596 Ga0466959_0097060
597 Ga0466959_0167488
598 Ga0466959_0249509
599 Ga0466959_0338784
600 Ga0451576_0000804
601 Ga0451576_0001005
602 Ga0451576_0011057
603 Ga0451576_0458019
604 Ga0466958_0154101
605 Ga0466958_0244749
606 Ga0466958_0305306
607 Ga0466967_0060122
608 Ga0466967_0138475
609 Ga0466967_0146431
610 Ga0466967_0276788
611 Ga0466967_0521017
612 Ga0495606_0000017
613 Ga0495668_0200344
614 Ga0496100_0291690
615 Ga0496102_0139388
616 Ga0496106_0530467
617 Ga0496109_0177655
618 Ga0496114_0121714
619 Ga0501291_033227
620 Ga0501040_0001078
621 Ga0501042_0001067
622 Ga0501047_0192395
623 Ga0501047_0243775
624 Ga0501047_0431392
625 Ga0501067_0010337
626 Ga0501067_0229189
627 Ga0501070_0012644
628 Ga0501070_0212213
629 Ga0501074_0039346
630 Ga0501075_0000570
631 Ga0501077_0000348
632 Ga0501198_012334
633 Ga0501201_008791
634 Ga0501216_013087
635 Ga0501242_013894
636 Ga0501243_000028
637 Ga0501247_005747
638 Ga0501225_0002647
639 Ga0501225_0047251
640 Ga0501234_019593
641 Ga0501080_0006242
642 Ga0501263_005565
643 Ga0501263_026477
644 Ga0501268_001509
645 Ga0501268_022780
646 Ga0501272_001609
647 Ga0501273_006478
648 Ga0501035_0003237
649 Ga0501044_0071873
650 nmdc:mga05p37_8468_c1
651 nmdc:mga06r32_165293_c1
652 Ga0590075_018664
653 Ga0590075_040170
654 Ga0590077_008852
655 Ga0501082_0001713
656 2788432849
657 2894415322
658 2910248549
659 2919405345
660 8003014740

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

69

161

0.93

PF13649

Methyltransf_25

Methyltransferase domain

68

162

0.91

PF13847

Methyltransf_31

Methyltransferase domain

63

176

0.87

PF08003

Methyltransf_9

Protein of unknown function (DUF1698)

47

199

0.86

PF08242

Methyltransf_12

Methyltransferase domain

69

162

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hkr-assembly1.cif.gz_A crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis 0.8505 61 170
8hkr-assembly1.cif.gz_B crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis 0.8319 61 170
3ccf-assembly1.cif.gz_A crystal structure of putative methyltransferase (yp_321342.1) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.8189 53 167
1n2x-assembly1.cif.gz_A crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.8124 54 141
2gs9-assembly1.cif.gz_B crystal structure of tt1324 from thermus thermophilis hb8 0.8075 41 169
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8838 60 126 3.40.50.150
af_I1JDM5_91_303_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8726 67 160 3.40.50.150
af_A0A0P0Y1E1_35_188_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8539 52 148 3.40.50.150
af_A0A1D8PSY8_4_290_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.85 56 159 3.40.50.150
af_A0A144A060_258_376_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8491 67 142 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1H5I9Z1-F1-model_v4 tRNA (Mo5U34)-methyltransferase 0.9719 20 265 GO:0008168
GO:0032259
AF-A0A1G2Y3U6-F1-model_v4 Methyltransferase, TIGR04290 family 0.9691 20 256 GO:0008168
GO:0032259
AF-A0A4Q2YU95-F1-model_v4 TIGR04290 family methyltransferase 0.9606 69 245 GO:0008168
GO:0032259
AF-A0A7W5Z0H6-F1-model_v4 deleted 0.96 20 245
AF-A0A2W6A0V1-F1-model_v4 TIGR04290 family methyltransferase 0.9516 20 243 GO:0008168
GO:0032259

Map