F410168

General Info

Members Datasets Scaffolds Average Seq Length
330 180 652 408

Family's Representative Sequence

Representative Sequence 3300033179|Ga0307507_10000217|Ga0307507_1000021721
Length 444
Sequence LLTRDLCMRGGFFVLIFLNNTHNSATLATQLYTIMTDATAAKATRNMIFLVLVASLGYFVDIYDLLIFSIVRVQSLKDIGVPGAELLAKGQFIINVQMFGLLLGGILWGIIGDKLGRIKVLFGSILLYSIANFANGLVTDVNTYAIIRFIAGIGLAGELGAGITLVSETLSKEKRGYGTMIVAVIGLFGAVAAVNVAKYGWQRAYFVGGGLGILLLLLRIGTFESGMFKNVEQSKVSKGNMLILFTSWTRFKKYLFCILIGAPLWYVVGILVTFSPEFGVALHSKGTLSAGTGVLYTYIGISVGDMFAGLLAQVTKSRKLTMAVFLLASVGSVVYYLRAFGLSSQQFVWICFFMGCSVGYWATFVTIAAEQFGTNIRSTVTTTVPNFVRGALIPITFAFNAFKINYGMITSGYIMMGILTIIALLSLSQLKETFGKDLDYVEIS

Samples

Sample ID Description Type Environment
1 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
106 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
107 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
108 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
125 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
134 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
135 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
136 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
140 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
141 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
147 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
148 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
149 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
154 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
155 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
156 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
157 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
158 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
159 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
160 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
161 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
162 2738541278 Niastella sp. CF465 Isolate Unclassified
163 2739367663 Pedobacter sp. YR510 Isolate Unclassified
164 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
165 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
166 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
167 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
168 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
169 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
170 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
171 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
172 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
173 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
174 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
175 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
176 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
177 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
178 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
179 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
180 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.33
Metatranscriptomes 0.3
Isolates 6.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.88
Nodule 0
Rhizoplane 0.61
Rhizosphere 80.91
Stem 0
Stem Tuber 0
Unclassified 3.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307507_10000217 3300033179 Bacteria 109884
2 JGI24737J22298_10000149 3300001990 Bacteria 21865
3 JGI24737J22298_10003922 3300001990 Bacteria 5213
4 JGI24735J21928_10000014 3300002067 Bacteria 186670
5 JGI24735J21928_10007271 3300002067 Bacteria 3613
6 JGI25162J39368_1001098 3300002737 Bacteria 16423
7 JGI25164J39214_1002602 3300002772 Bacteria 2659
8 JGI25165J46597_1000898 3300003214 Bacteria 20764
9 rootH1_10025788 3300003316 Bacteria 15296
10 rootH2_10017200 3300003320 Bacteria 3451
11 rootH2_10025162 3300003320 Bacteria 10672
12 rootH2_10059243 3300003320 Bacteria 9365
13 rootH2_10168193 3300003320 Bacteria 1573
14 rootH2_10303474 3300003320 Bacteria 1623
15 rootL2_10318965 3300003322 Unclassified 2565
16 rootH1_10012846 3300003323 Bacteria 47357
17 rootH1_10023987 3300003323 Bacteria 12102
18 rootH1_10042286 3300003323 Bacteria 33290
19 rootH1_10210078 3300003323 Bacteria 3783
20 rootH1_10263386 3300003323 Bacteria 2334
21 Ga0058863_10025409 3300004799 Bacteria 3270
22 Ga0065704_10001670 3300005289 Bacteria 6924
23 Ga0070658_10000011 3300005327 Bacteria 294396
24 Ga0070658_10032672 3300005327 Bacteria 4184
25 Ga0070676_10000615 3300005328 Bacteria 17358
26 Ga0070683_100242356 3300005329 Bacteria 1715
27 Ga0070670_100018940 3300005331 Bacteria 5903
28 Ga0068869_100034568 3300005334 Bacteria 3576
29 Ga0070680_100002502 3300005336 Bacteria 13614
30 Ga0068868_100060727 3300005338 Bacteria 2994
31 Ga0068868_100065812 3300005338 Unclassified 2880
32 Ga0070660_100007712 3300005339 Bacteria 7503
33 Ga0070660_100169523 3300005339 Bacteria 1763
34 Ga0070669_100015966 3300005353 Bacteria 5357
35 Ga0070675_100016377 3300005354 Bacteria 5885
36 Ga0070671_100001785 3300005355 Bacteria 16335
37 Ga0070671_100199584 3300005355 Bacteria 1696
38 Ga0070674_100025313 3300005356 Bacteria 3862
39 Ga0070674_100126071 3300005356 Bacteria 1902
40 Ga0070673_100008914 3300005364 Bacteria 6705
41 Ga0070673_100009985 3300005364 Bacteria 6402
42 Ga0070659_100000383 3300005366 Bacteria 33558
43 Ga0070659_100009256 3300005366 Bacteria 7231
44 Ga0070659_100207142 3300005366 Bacteria 1615
45 Ga0070714_100000121 3300005435 Bacteria 62487
46 Ga0070678_100000605 3300005456 Bacteria 17659
47 Ga0070678_100001439 3300005456 Bacteria 12682
48 Ga0070681_10005612 3300005458 Bacteria 12126
49 Ga0070681_10023791 3300005458 Bacteria 6166
50 Ga0068867_100030943 3300005459 Bacteria 3862
51 Ga0070679_100002080 3300005530 Bacteria 18017
52 Ga0070679_100265788 3300005530 Unclassified 1670
53 Ga0068853_100121367 3300005539 Bacteria 2332
54 Ga0070665_100000003 3300005548 Bacteria 811857
55 Ga0070665_100023914 3300005548 Bacteria 6154
56 Ga0068855_100000042 3300005563 Bacteria 149332
57 Ga0068855_100000652 3300005563 Bacteria 42351
58 Ga0068855_100075442 3300005563 Bacteria 3915
59 Ga0068855_100159315 3300005563 Bacteria 2563
60 Ga0068857_100019150 3300005577 Bacteria 6008
61 Ga0068854_100068828 3300005578 Bacteria 2582
62 Ga0068856_100001806 3300005614 Bacteria 22338
63 Ga0068856_100007300 3300005614 Bacteria 10786
64 Ga0068852_100003871 3300005616 Bacteria 10512
65 Ga0068852_100004264 3300005616 Bacteria 10099
66 Ga0068852_100068727 3300005616 Bacteria 3102
67 Ga0068861_100122965 3300005719 Bacteria 2096
68 Ga0068870_10042154 3300005840 Bacteria 2375
69 Ga0068860_100020993 3300005843 Bacteria 6328
70 Ga0068860_100027319 3300005843 Bacteria 5498
71 Ga0068860_100030725 3300005843 Bacteria 5165
72 Ga0075366_10003891 3300006195 Bacteria 7960
73 Ga0075366_10005187 3300006195 Bacteria 7050
74 Ga0075366_10080033 3300006195 Bacteria 1951
75 Ga0097621_100000020 3300006237 Bacteria 86226
76 Ga0075370_10115986 3300006353 Bacteria 1557
77 Ga0068865_100000208 3300006881 Bacteria 32611
78 Ga0068865_100003471 3300006881 Bacteria 9444
79 Ga0105240_10000068 3300009093 Bacteria 207756
80 Ga0105240_10004490 3300009093 Bacteria 21219
81 Ga0105240_10008915 3300009093 Bacteria 14261
82 Ga0105240_10052535 3300009093 Bacteria 5122
83 Ga0105240_10072132 3300009093 Bacteria 4269
84 Ga0105240_10123403 3300009093 Bacteria 3116
85 Ga0105245_10000039 3300009098 Bacteria 144455
86 Ga0114129_10004976 3300009147 Bacteria 18722
87 Ga0105243_10000008 3300009148 Bacteria 390270
88 Ga0105241_10050286 3300009174 Bacteria 3176
89 Ga0105241_10146750 3300009174 Bacteria 1926
90 Ga0105242_10054010 3300009176 Bacteria 3283
91 Ga0105237_10000274 3300009545 Bacteria 72354
92 Ga0105237_10000356 3300009545 Bacteria 64629
93 Ga0105237_10001524 3300009545 Bacteria 30382
94 Ga0105237_10018786 3300009545 Bacteria 7149
95 Ga0105237_10029647 3300009545 Bacteria 5559
96 Ga0105237_10043584 3300009545 Bacteria 4519
97 Ga0105237_10059768 3300009545 Bacteria 3813
98 Ga0105237_10072274 3300009545 Bacteria 3443
99 Ga0105237_10089313 3300009545 Bacteria 3071
100 Ga0105238_10127083 3300009551 Bacteria 2528
101 Ga0105249_10171171 3300009553 Bacteria 2106
102 Ga0105239_10000002 3300010375 Bacteria 610298
103 Ga0105239_10000010 3300010375 Bacteria 341545
104 Ga0105239_10000081 3300010375 Bacteria 133686
105 Ga0105239_10000259 3300010375 Bacteria 78760
106 Ga0105239_10008945 3300010375 Bacteria 11330
107 Ga0105239_10009537 3300010375 Bacteria 10924
108 Ga0105239_10064006 3300010375 Bacteria 4037
109 Ga0105239_10064326 3300010375 Bacteria 4027
110 Ga0157373_10000328 3300013100 Bacteria 38459
111 Ga0157373_10017756 3300013100 Bacteria 5180
112 Ga0157371_10001189 3300013102 Bacteria 27874
113 Ga0157371_10004714 3300013102 Bacteria 11787
114 Ga0157370_10003472 3300013104 Bacteria 18497
115 Ga0157370_10006363 3300013104 Bacteria 13036
116 Ga0157370_10049689 3300013104 Bacteria 4013
117 Ga0157370_10100295 3300013104 Bacteria 2713
118 Ga0157370_10262859 3300013104 Bacteria 1595
119 Ga0157369_10000039 3300013105 Bacteria 188947
120 Ga0157369_10024387 3300013105 Bacteria 6729
121 Ga0157374_10000723 3300013296 Bacteria 28842
122 Ga0157374_10001085 3300013296 Bacteria 23473
123 Ga0157374_10014348 3300013296 Bacteria 6934
124 Ga0157374_10032111 3300013296 Bacteria 4779
125 Ga0157374_10201826 3300013296 Bacteria 1947
126 Ga0157378_10022162 3300013297 Bacteria 5590
127 Ga0157378_10046031 3300013297 Bacteria 3879
128 Ga0157378_10081516 3300013297 Bacteria 2924
129 Ga0157378_10169076 3300013297 Bacteria 2049
130 Ga0163162_10000066 3300013306 Bacteria 100009
131 Ga0163162_10001561 3300013306 Bacteria 21390
132 Ga0163162_10014096 3300013306 Bacteria 7812
133 Ga0157372_10000001 3300013307 Bacteria 791349
134 Ga0157372_10000372 3300013307 Bacteria 49527
135 Ga0157372_10008550 3300013307 Bacteria 10871
136 Ga0157372_10012004 3300013307 Bacteria 9225
137 Ga0157372_10017132 3300013307 Bacteria 7778
138 Ga0157372_10173239 3300013307 Bacteria 2497
139 Ga0157375_10137633 3300013308 Bacteria 2567
140 Ga0157375_10323109 3300013308 Bacteria 1708
141 Ga0157375_10431687 3300013308 Bacteria 1483
142 Ga0157376_10014674 3300014969 Bacteria 5890
143 Ga0163161_10040522 3300017792 Bacteria 3346
144 Ga0207427_100163 3300025231 Bacteria 74501
145 Ga0209437_100085 3300025233 Bacteria 254790
146 Ga0209437_100101 3300025233 Bacteria 226668
147 Ga0209026_1000361 3300025250 Bacteria 42722
148 Ga0209026_1009133 3300025250 Bacteria 1984
149 Ga0209129_1011397 3300025258 Bacteria 2127
150 Ga0209233_1000124 3300025261 Bacteria 226743
151 Ga0207647_10001459 3300025904 Bacteria 18183
152 Ga0207647_10007654 3300025904 Bacteria 7784
153 Ga0207645_10000544 3300025907 Bacteria 31399
154 Ga0207645_10000571 3300025907 Bacteria 30525
155 Ga0207705_10000015 3300025909 Bacteria 382901
156 Ga0207705_10031784 3300025909 Bacteria 3770
157 Ga0207705_10183530 3300025909 Bacteria 1580
158 Ga0207707_10035960 3300025912 Bacteria 4330
159 Ga0207707_10103854 3300025912 Bacteria 2484
160 Ga0207695_10000131 3300025913 Bacteria 223762
161 Ga0207695_10002296 3300025913 Bacteria 28532
162 Ga0207695_10033899 3300025913 Bacteria 5559
163 Ga0207695_10040836 3300025913 Bacteria 4969
164 Ga0207671_10000993 3300025914 Bacteria 34894
165 Ga0207671_10008174 3300025914 Bacteria 8923
166 Ga0207671_10008258 3300025914 Bacteria 8857
167 Ga0207671_10012593 3300025914 Bacteria 6793
168 Ga0207671_10016716 3300025914 Bacteria 5693
169 Ga0207671_10025886 3300025914 Bacteria 4402
170 Ga0207671_10049165 3300025914 Bacteria 3121
171 Ga0207660_10009376 3300025917 Bacteria 6335
172 Ga0207657_10035452 3300025919 Bacteria 4474
173 Ga0207657_10073849 3300025919 Bacteria 2881
174 Ga0207652_10000090 3300025921 Bacteria 99245
175 Ga0207652_10001292 3300025921 Bacteria 22268
176 Ga0207652_10003351 3300025921 Bacteria 13240
177 Ga0207681_10070629 3300025923 Bacteria 2432
178 Ga0207694_10023039 3300025924 Bacteria 4726
179 Ga0207687_10000022 3300025927 Bacteria 223060
180 Ga0207664_10000112 3300025929 Bacteria 71450
181 Ga0207644_10051432 3300025931 Bacteria 2957
182 Ga0207690_10003441 3300025932 Bacteria 9445
183 Ga0207690_10007925 3300025932 Bacteria 6307
184 Ga0207706_10147325 3300025933 Bacteria 2071
185 Ga0207709_10000006 3300025935 Bacteria 800946
186 Ga0207704_10000209 3300025938 Bacteria 29657
187 Ga0207689_10000939 3300025942 Bacteria 28012
188 Ga0207667_10000037 3300025949 Bacteria 297252
189 Ga0207667_10000323 3300025949 Bacteria 66327
190 Ga0207667_10001001 3300025949 Bacteria 36044
191 Ga0207667_10009578 3300025949 Bacteria 11400
192 Ga0207667_10148786 3300025949 Bacteria 2410
193 Ga0207667_10201289 3300025949 Bacteria 2043
194 Ga0207651_10021531 3300025960 Bacteria 3921
195 Ga0207677_10059456 3300026023 Bacteria 2636
196 Ga0207639_10014946 3300026041 Bacteria 5469
197 Ga0207639_10030522 3300026041 Bacteria 3953
198 Ga0207702_10000820 3300026078 Bacteria 32858
199 Ga0207648_10002203 3300026089 Bacteria 21158
200 Ga0207648_10004149 3300026089 Bacteria 14992
201 Ga0207674_10001708 3300026116 Bacteria 28109
202 Ga0207674_10121173 3300026116 Bacteria 2583
203 Ga0207675_100086472 3300026118 Bacteria 2944
204 Ga0207683_10000535 3300026121 Bacteria 35178
205 Ga0207683_10002255 3300026121 Bacteria 16919
206 Ga0207698_10002540 3300026142 Bacteria 10837
207 Ga0207698_10002554 3300026142 Bacteria 10802
208 Ga0268266_10000052 3300028379 Bacteria 296230
209 Ga0268264_10035514 3300028381 Bacteria 4104
210 Ga0268264_10038113 3300028381 Bacteria 3965
211 Ga0307517_10005359 3300028786 Bacteria 19372
212 Ga0307515_10000432 3300028794 Bacteria 100348
213 Ga0307515_10134442 3300028794 Bacteria 2699
214 Ga0307515_10136445 3300028794 Bacteria 2664
215 Ga0316177_1194820 3300030731 Bacteria 10470
216 Ga0316176_1082773 3300030732 Bacteria 7323
217 Ga0316183_1111132 3300030742 Bacteria 56687
218 Ga0316181_1060144 3300030744 Bacteria 1381
219 Ga0316181_1162796 3300030744 Bacteria 20295
220 Ga0307513_10020220 3300031456 Bacteria 7899
221 Ga0307510_10016554 3300033180 Bacteria 8704
222 Ga0395899_0000001 3300037312 Bacteria 1750322
223 Ga0395899_0000608 3300037312 Bacteria 37382
224 Ga0395899_0034235 3300037312 Bacteria 3814
225 Ga0395900_0000330 3300037418 Bacteria 69819
226 Ga0395900_0002720 3300037418 Bacteria 19323
227 Ga0395900_0027191 3300037418 Bacteria 5858
228 Ga0395900_0102675 3300037418 Bacteria 2937
229 Ga0395898_0001101 3300037466 Bacteria 41709
230 Ga0395898_0229831 3300037466 Bacteria 1769
231 Ga0395898_0280841 3300037466 Bacteria 1588
232 Ga0395905_0000301 3300037471 Bacteria 72121
233 Ga0395905_0010559 3300037471 Bacteria 8970
234 Ga0395901_0002979 3300038443 Bacteria 17081
235 Ga0395901_0007093 3300038443 Bacteria 11329
236 Ga0395901_0021819 3300038443 Bacteria 6564
237 Ga0395901_0137874 3300038443 Bacteria 2564
238 Ga0395901_0340966 3300038443 Bacteria 1548
239 Ga0395901_0393627 3300038443 Bacteria 1424
240 Ga0451577_0001423 3300042876 Bacteria 31912
241 Ga0451577_0008338 3300042876 Bacteria 10083
242 Ga0466961_0132030 3300044693 Bacteria 1565
243 Ga0453684_0000024 3300044712 Bacteria 819351
244 Ga0453684_0011767 3300044712 Bacteria 14586
245 Ga0466957_0000776 3300044842 Bacteria 16313
246 Ga0495592_0213931 3300046454 Unclassified 1293
247 Ga0495650_0000003 3300046471 Bacteria 900730
248 Ga0495585_0000085 3300046492 Bacteria 97836
249 Ga0495606_0000145 3300046507 Bacteria 122857
250 Ga0495606_0008880 3300046507 Bacteria 8610
251 Ga0495606_0014997 3300046507 Bacteria 6007
252 Ga0495606_0025458 3300046507 Bacteria 4237
253 Ga0495610_0003550 3300046512 Bacteria 12080
254 Ga0495616_0022008 3300046513 Bacteria 3445
255 Ga0495631_0005644 3300046518 Bacteria 6528
256 Ga0495631_0076847 3300046518 Bacteria 1441
257 Ga0495644_0039720 3300046523 Unclassified 1774
258 Ga0495648_0008324 3300046524 Bacteria 8176
259 Ga0495648_0094248 3300046524 Bacteria 1668
260 Ga0495609_0004504 3300046538 Bacteria 7600
261 Ga0495633_0000014 3300046558 Bacteria 261742
262 Ga0495633_0004452 3300046558 Bacteria 8909
263 Ga0495668_0000003 3300046616 Bacteria 695023
264 Ga0495668_0000108 3300046616 Bacteria 132593
265 Ga0495625_0000005 3300046660 Bacteria 596135
266 Ga0495625_0003490 3300046660 Bacteria 15592
267 Ga0495625_0005138 3300046660 Bacteria 12082
268 Ga0495625_0044923 3300046660 Bacteria 3196
269 Ga0495625_0062022 3300046660 Bacteria 2643
270 Ga0495661_0002958 3300046665 Bacteria 12832
271 Ga0495661_0005475 3300046665 Bacteria 9006
272 Ga0495649_0000003 3300046694 Bacteria 880817
273 Ga0495683_0055331 3300047323 Bacteria 1975
274 Ga0495687_034816 3300047443 Bacteria 2270
275 Ga0495686_0000788 3300047472 Bacteria 41315
276 Ga0495686_0001067 3300047472 Bacteria 32642
277 Ga0495686_0004353 3300047472 Bacteria 11693
278 Ga0495686_0024816 3300047472 Unclassified 3934
279 Ga0496114_0170726 3300048917 Bacteria 1895
280 Ga0496116_0005693 3300048919 Bacteria 11462
281 Ga0496117_0003387 3300048920 Bacteria 18574
282 Ga0496118_0115899 3300048921 Bacteria 1762
283 Ga0496122_0026876 3300048925 Bacteria 4942
284 Ga0496126_0190631 3300048929 Unclassified 1737
285 Ga0501034_0157257 3300049571 Bacteria 2246
286 Ga0501043_0262394 3300049579 Unclassified 1328
287 Ga0501208_000631 3300049655 Bacteria 2909
288 Ga0501238_004021 3300049671 Unclassified 1823
289 Ga0501241_008128 3300049758 Unclassified 1919
290 Ga0501269_001004 3300049766 Bacteria 4035
291 Ga0501035_0311715 3300049822 Unclassified 1324
292 Ga0501044_0163537 3300049823 Unclassified 2201
293 nmdc:mga0k408_1545_c1 3300050493 Bacteria 12427
294 nmdc:mga0k408_16_c1 3300050493 Bacteria 19854
295 nmdc:mga0k408_204686_c1 3300050493 Bacteria 1178
296 nmdc:mga0k408_52770_c1 3300050493 Bacteria 2356
297 nmdc:mga0k408_55306_c1 3300050493 Bacteria 1991
298 nmdc:mga07m45_76738_c1 3300050496 Bacteria 1905
299 Ga0500644_0002512 3300053088 Bacteria 4581
300 Ga0500608_006646 3300053122 Bacteria 4727
301 Ga0500618_000526 3300053125 Bacteria 24101
302 Ga0500642_0008072 3300053130 Bacteria 3579
303 Ga0500642_0045283 3300053130 Bacteria 1919
304 Ga0500616_0020359 3300053153 Bacteria 3727
305 Ga0500624_000656 3300053157 Bacteria 8993
306 2599477668 2599185184 Bacteria 6430550
307 2722728641 2721755487 Bacteria 6357185
308 2738727002 2738541278 Bacteria 9755573
309 2739645135 2739367663 Bacteria 5040914
310 2842909491 2842903701 Bacteria 6986368
311 2852623659 2852623160 Bacteria 4376875
312 2881957443 2881955468 Bacteria 3545609
313 2884937438 2884933994 Bacteria 4535041
314 2890739787 2890737413 Bacteria 4269751
315 2896319872 2896317667 Bacteria 4606601
316 2896345910 2896344016 Bacteria 3811746
317 2898715023 2898713307 Bacteria 4110805
318 2902049273 2902048731 Bacteria 4976191
319 2904784339 2904780799 Bacteria 5840761
320 2919179036 2919177583 Bacteria 5641607
321 2919441111 2919437846 Bacteria 6199444
322 2928079581 2928078545 Bacteria 6534839
323 2928147937 2928147474 Bacteria 6512076
324 2932086786 2932082852 Bacteria 6563563
325 2977232625 2977232053 Bacteria 5485925
326 3003236525 3003233435 Bacteria 4458031
327 Ga0307507_10000217
328 JGI24737J22298_10000149
329 JGI24737J22298_10003922
330 JGI24735J21928_10000014
331 JGI24735J21928_10007271
332 JGI25162J39368_1001098
333 JGI25164J39214_1002602
334 JGI25165J46597_1000898
335 rootH1_10025788
336 rootH2_10017200
337 rootH2_10025162
338 rootH2_10059243
339 rootH2_10168193
340 rootH2_10303474
341 rootL2_10318965
342 rootH1_10012846
343 rootH1_10023987
344 rootH1_10042286
345 rootH1_10210078
346 rootH1_10263386
347 Ga0058863_10025409
348 Ga0065704_10001670
349 Ga0070658_10000011
350 Ga0070658_10032672
351 Ga0070676_10000615
352 Ga0070683_100242356
353 Ga0070670_100018940
354 Ga0068869_100034568
355 Ga0070680_100002502
356 Ga0068868_100060727
357 Ga0068868_100065812
358 Ga0070660_100007712
359 Ga0070660_100169523
360 Ga0070669_100015966
361 Ga0070675_100016377
362 Ga0070671_100001785
363 Ga0070671_100199584
364 Ga0070674_100025313
365 Ga0070674_100126071
366 Ga0070673_100008914
367 Ga0070673_100009985
368 Ga0070659_100000383
369 Ga0070659_100009256
370 Ga0070659_100207142
371 Ga0070714_100000121
372 Ga0070678_100000605
373 Ga0070678_100001439
374 Ga0070681_10005612
375 Ga0070681_10023791
376 Ga0068867_100030943
377 Ga0070679_100002080
378 Ga0070679_100265788
379 Ga0068853_100121367
380 Ga0070665_100000003
381 Ga0070665_100023914
382 Ga0068855_100000042
383 Ga0068855_100000652
384 Ga0068855_100075442
385 Ga0068855_100159315
386 Ga0068857_100019150
387 Ga0068854_100068828
388 Ga0068856_100001806
389 Ga0068856_100007300
390 Ga0068852_100003871
391 Ga0068852_100004264
392 Ga0068852_100068727
393 Ga0068861_100122965
394 Ga0068870_10042154
395 Ga0068860_100020993
396 Ga0068860_100027319
397 Ga0068860_100030725
398 Ga0075366_10003891
399 Ga0075366_10005187
400 Ga0075366_10080033
401 Ga0097621_100000020
402 Ga0075370_10115986
403 Ga0068865_100000208
404 Ga0068865_100003471
405 Ga0105240_10000068
406 Ga0105240_10004490
407 Ga0105240_10008915
408 Ga0105240_10052535
409 Ga0105240_10072132
410 Ga0105240_10123403
411 Ga0105245_10000039
412 Ga0114129_10004976
413 Ga0105243_10000008
414 Ga0105241_10050286
415 Ga0105241_10146750
416 Ga0105242_10054010
417 Ga0105237_10000274
418 Ga0105237_10000356
419 Ga0105237_10001524
420 Ga0105237_10018786
421 Ga0105237_10029647
422 Ga0105237_10043584
423 Ga0105237_10059768
424 Ga0105237_10072274
425 Ga0105237_10089313
426 Ga0105238_10127083
427 Ga0105249_10171171
428 Ga0105239_10000002
429 Ga0105239_10000010
430 Ga0105239_10000081
431 Ga0105239_10000259
432 Ga0105239_10008945
433 Ga0105239_10009537
434 Ga0105239_10064006
435 Ga0105239_10064326
436 Ga0157373_10000328
437 Ga0157373_10017756
438 Ga0157371_10001189
439 Ga0157371_10004714
440 Ga0157370_10003472
441 Ga0157370_10006363
442 Ga0157370_10049689
443 Ga0157370_10100295
444 Ga0157370_10262859
445 Ga0157369_10000039
446 Ga0157369_10024387
447 Ga0157374_10000723
448 Ga0157374_10001085
449 Ga0157374_10014348
450 Ga0157374_10032111
451 Ga0157374_10201826
452 Ga0157378_10022162
453 Ga0157378_10046031
454 Ga0157378_10081516
455 Ga0157378_10169076
456 Ga0163162_10000066
457 Ga0163162_10001561
458 Ga0163162_10014096
459 Ga0157372_10000001
460 Ga0157372_10000372
461 Ga0157372_10008550
462 Ga0157372_10012004
463 Ga0157372_10017132
464 Ga0157372_10173239
465 Ga0157375_10137633
466 Ga0157375_10323109
467 Ga0157375_10431687
468 Ga0157376_10014674
469 Ga0163161_10040522
470 Ga0207427_100163
471 Ga0209437_100085
472 Ga0209437_100101
473 Ga0209026_1000361
474 Ga0209026_1009133
475 Ga0209129_1011397
476 Ga0209233_1000124
477 Ga0207647_10001459
478 Ga0207647_10007654
479 Ga0207645_10000544
480 Ga0207645_10000571
481 Ga0207705_10000015
482 Ga0207705_10031784
483 Ga0207705_10183530
484 Ga0207707_10035960
485 Ga0207707_10103854
486 Ga0207695_10000131
487 Ga0207695_10002296
488 Ga0207695_10033899
489 Ga0207695_10040836
490 Ga0207671_10000993
491 Ga0207671_10008174
492 Ga0207671_10008258
493 Ga0207671_10012593
494 Ga0207671_10016716
495 Ga0207671_10025886
496 Ga0207671_10049165
497 Ga0207660_10009376
498 Ga0207657_10035452
499 Ga0207657_10073849
500 Ga0207652_10000090
501 Ga0207652_10001292
502 Ga0207652_10003351
503 Ga0207681_10070629
504 Ga0207694_10023039
505 Ga0207687_10000022
506 Ga0207664_10000112
507 Ga0207644_10051432
508 Ga0207690_10003441
509 Ga0207690_10007925
510 Ga0207706_10147325
511 Ga0207709_10000006
512 Ga0207704_10000209
513 Ga0207689_10000939
514 Ga0207667_10000037
515 Ga0207667_10000323
516 Ga0207667_10001001
517 Ga0207667_10009578
518 Ga0207667_10148786
519 Ga0207667_10201289
520 Ga0207651_10021531
521 Ga0207677_10059456
522 Ga0207639_10014946
523 Ga0207639_10030522
524 Ga0207702_10000820
525 Ga0207648_10002203
526 Ga0207648_10004149
527 Ga0207674_10001708
528 Ga0207674_10121173
529 Ga0207675_100086472
530 Ga0207683_10000535
531 Ga0207683_10002255
532 Ga0207698_10002540
533 Ga0207698_10002554
534 Ga0268266_10000052
535 Ga0268264_10035514
536 Ga0268264_10038113
537 Ga0307517_10005359
538 Ga0307515_10000432
539 Ga0307515_10134442
540 Ga0307515_10136445
541 Ga0316177_1194820
542 Ga0316176_1082773
543 Ga0316183_1111132
544 Ga0316181_1060144
545 Ga0316181_1162796
546 Ga0307513_10020220
547 Ga0307510_10016554
548 Ga0395899_0000001
549 Ga0395899_0000608
550 Ga0395899_0034235
551 Ga0395900_0000330
552 Ga0395900_0002720
553 Ga0395900_0027191
554 Ga0395900_0102675
555 Ga0395898_0001101
556 Ga0395898_0229831
557 Ga0395898_0280841
558 Ga0395905_0000301
559 Ga0395905_0010559
560 Ga0395901_0002979
561 Ga0395901_0007093
562 Ga0395901_0021819
563 Ga0395901_0137874
564 Ga0395901_0340966
565 Ga0395901_0393627
566 Ga0451577_0001423
567 Ga0451577_0008338
568 Ga0466961_0132030
569 Ga0453684_0000024
570 Ga0453684_0011767
571 Ga0466957_0000776
572 Ga0495592_0213931
573 Ga0495650_0000003
574 Ga0495585_0000085
575 Ga0495606_0000145
576 Ga0495606_0008880
577 Ga0495606_0014997
578 Ga0495606_0025458
579 Ga0495610_0003550
580 Ga0495616_0022008
581 Ga0495631_0005644
582 Ga0495631_0076847
583 Ga0495644_0039720
584 Ga0495648_0008324
585 Ga0495648_0094248
586 Ga0495609_0004504
587 Ga0495633_0000014
588 Ga0495633_0004452
589 Ga0495668_0000003
590 Ga0495668_0000108
591 Ga0495625_0000005
592 Ga0495625_0003490
593 Ga0495625_0005138
594 Ga0495625_0044923
595 Ga0495625_0062022
596 Ga0495661_0002958
597 Ga0495661_0005475
598 Ga0495649_0000003
599 Ga0495683_0055331
600 Ga0495687_034816
601 Ga0495686_0000788
602 Ga0495686_0001067
603 Ga0495686_0004353
604 Ga0495686_0024816
605 Ga0496114_0170726
606 Ga0496116_0005693
607 Ga0496117_0003387
608 Ga0496118_0115899
609 Ga0496122_0026876
610 Ga0496126_0190631
611 Ga0501034_0157257
612 Ga0501043_0262394
613 Ga0501208_000631
614 Ga0501238_004021
615 Ga0501241_008128
616 Ga0501269_001004
617 Ga0501035_0311715
618 Ga0501044_0163537
619 nmdc:mga0k408_1545_c1
620 nmdc:mga0k408_16_c1
621 nmdc:mga0k408_204686_c1
622 nmdc:mga0k408_52770_c1
623 nmdc:mga0k408_55306_c1
624 nmdc:mga07m45_76738_c1
625 Ga0500644_0002512
626 Ga0500608_006646
627 Ga0500618_000526
628 Ga0500642_0008072
629 Ga0500642_0045283
630 Ga0500616_0020359
631 Ga0500624_000656
632 2599477668
633 2722728641
634 2738727002
635 2739645135
636 2842909491
637 2852623659
638 2881957443
639 2884937438
640 2890739787
641 2896319872
642 2896345910
643 2898715023
644 2902049273
645 2904784339
646 2919179036
647 2919441111
648 2928079581
649 2928147937
650 2932086786
651 2977232625
652 3003236525

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

47

393

0.83

PF00083

Sugar_tr

Sugar (and other) transporter

50

251

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zha-assembly1.cif.gz_A structure of human oct3 in complex with inhibitor decynium-22 0.7848 76 416
6m2l-assembly2.cif.gz_B crystal structure of plasmodium falciparum hexose transporter pfht1 bound with c3361 0.7805 38 428
6rw3-assembly3.cif.gz_C the molecular basis for sugar import in malaria parasites. 0.7734 40 424
7zh0-assembly1.cif.gz_A structure of human oct3 in lipid nanodisc 0.7732 36 422
8jt9-assembly1.cif.gz_A human vmat2 complex with ketanserin 0.7722 42 414
ID Description Score Start End Superfamily
af_A0A0R0HMJ0_13_161_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9289 89 218 1.20.1250.20
af_Q9SD00_1_254_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9187 38 225 1.20.1250.20
af_Q8N4F4_121_298_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9137 78 228 1.20.1250.20
af_P25744_10_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9083 39 216 1.20.1250.20
af_A0A0R0GUC5_71_252_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8928 40 213 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3G3GSL4-F1-model_v4 MFS transporter 0.9745 37 430 GO:0005886
GO:0046943
AF-A0A0X8X2W9-F1-model_v4 Putative niacin/nicotinamide transporter NaiP 0.9741 74 431 GO:0005886
GO:0046943
AF-A0A1L9B9E1-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9718 38 430 GO:0005886
GO:0046943
AF-A0A431MLJ6-F1-model_v4 MFS transporter 0.9716 38 428 GO:0005886
GO:0046943
AF-A0A2Z4GAJ4-F1-model_v4 MFS transporter 0.9709 39 430 GO:0005886
GO:0046943

Map