F410193
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 330 | 233 | 660 | 341 |
Family's Representative Sequence
| Representative Sequence | 3300041404|Ga0439436_0003435|Ga0439436_0003435_1435_2532 |
| Length | 365 |
| Sequence | MQHPPEMGPAAPKPGKSKLMNAKTSCNVAVVGATGAVGETMLKVLAERKFPIGKLHVLASERSAGEKIQFEGKTLVVEDLATFDPSGVDIALFSAGGSVSKEFAPKFAAAGAVVIDNSSAFRYDDDIPLVVSEVNPEQIANRPRGIIANPNCSTMQMLVALAPIHRKVGIERINVATYQSVSGTGRRALEELGRQTAGLLNFQETKAEVYPVQIAFNVIPHGGDFTDNGYTTEEMKLVWETRKILGDDSIGVNATVVRVPVFYAHSEAVHIETREKLSAADARKLLEAAPGLEVVDEAVGGGYPTPVTHASGHDPVYVGRIRDDISHPRGLAMWVVADNIRKGAALNAVQLAELVWAEQRAQHAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 2 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 3 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 4 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 31 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 32 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 33 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 35 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 36 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 37 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 38 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 44 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 45 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 46 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 47 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 55 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 58 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 61 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 63 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 64 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 65 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 102 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 103 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 104 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 105 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 106 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 107 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 108 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 109 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 110 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 111 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 112 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 113 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 114 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 115 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 116 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 117 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 118 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 119 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 120 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 121 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 122 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 123 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 124 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 125 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 126 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 127 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 128 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 129 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 130 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 131 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 132 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 133 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 134 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 135 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 136 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 137 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 138 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 151 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 152 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 153 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 154 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 155 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 156 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 157 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 158 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 159 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 160 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 161 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 162 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 163 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 191 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 194 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 197 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 198 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 199 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 200 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 201 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 202 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 203 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 204 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 205 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 206 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 207 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 208 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 209 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 210 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 211 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 212 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 213 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 214 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 215 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 216 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 217 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 218 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 219 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 220 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 221 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 222 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 223 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 224 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 225 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 226 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 227 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 228 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 229 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 230 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 231 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 232 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 233 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.18 |
| Metatranscriptomes | 0 |
| Isolates | 11.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.3 |
| Bulb | 0 |
| Endosphere | 13.64 |
| Nodule | 0.3 |
| Rhizoplane | 0.91 |
| Rhizosphere | 72.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439436_0003435 | 3300041404 | Bacteria | 4811 |
| 2 | JGI25152J39213_1000548 | 3300002773 | Bacteria | 20669 |
| 3 | JGI25150J39212_1000114 | 3300002774 | Bacteria | 45745 |
| 4 | JGI25151J46595_10000100 | 3300003187 | Bacteria | 116522 |
| 5 | JGI25151J46595_10000128 | 3300003187 | Bacteria | 102514 |
| 6 | JGI25153J46596_10000071 | 3300003215 | Bacteria | 116950 |
| 7 | Ga0055526_1000021 | 3300003771 | Bacteria | 180007 |
| 8 | Ga0055526_1016148 | 3300003771 | Bacteria | 2942 |
| 9 | Ga0055537_1000141 | 3300003773 | Bacteria | 54030 |
| 10 | Ga0055524_1000128 | 3300003775 | Bacteria | 88986 |
| 11 | Ga0055524_1035871 | 3300003775 | Bacteria | 1345 |
| 12 | Ga0055524_1038705 | 3300003775 | Bacteria | 1243 |
| 13 | Ga0055534_1000054 | 3300003784 | Bacteria | 88986 |
| 14 | Ga0055528_1000009 | 3300003790 | Bacteria | 224150 |
| 15 | Ga0055530_10002002 | 3300003791 | Bacteria | 13806 |
| 16 | Ga0055530_10012905 | 3300003791 | Bacteria | 2885 |
| 17 | Ga0055531_10029560 | 3300003794 | Bacteria | 1864 |
| 18 | Ga0055531_10046642 | 3300003794 | Bacteria | 1188 |
| 19 | Ga0058692_1000024 | 3300003856 | Bacteria | 219702 |
| 20 | Ga0065714_10069580 | 3300005288 | Bacteria | 4170 |
| 21 | Ga0065704_10108834 | 3300005289 | Bacteria | 2018 |
| 22 | Ga0065704_10122712 | 3300005289 | Bacteria | 1745 |
| 23 | Ga0070680_100010297 | 3300005336 | Bacteria | 7208 |
| 24 | Ga0070660_100043227 | 3300005339 | Bacteria | 3442 |
| 25 | Ga0070661_100163750 | 3300005344 | Bacteria | 1685 |
| 26 | Ga0070668_100119181 | 3300005347 | Bacteria | 2108 |
| 27 | Ga0070669_100117131 | 3300005353 | Bacteria | 2028 |
| 28 | Ga0070671_100055431 | 3300005355 | Bacteria | 3297 |
| 29 | Ga0070659_100155085 | 3300005366 | Bacteria | 1870 |
| 30 | Ga0070667_100215910 | 3300005367 | Bacteria | 1706 |
| 31 | Ga0070681_10009605 | 3300005458 | Bacteria | 9512 |
| 32 | Ga0068867_100070501 | 3300005459 | Bacteria | 2613 |
| 33 | Ga0068853_100358185 | 3300005539 | Bacteria | 1358 |
| 34 | Ga0070672_100004894 | 3300005543 | Bacteria | 8811 |
| 35 | Ga0070693_100046574 | 3300005547 | Bacteria | 2463 |
| 36 | Ga0070665_100061606 | 3300005548 | Bacteria | 3761 |
| 37 | Ga0081539_10080032 | 3300005985 | Bacteria | 1720 |
| 38 | Ga0075364_10090503 | 3300006051 | Bacteria | 2030 |
| 39 | Ga0075369_10009077 | 3300006186 | Bacteria | 3851 |
| 40 | Ga0097621_100078811 | 3300006237 | Bacteria | 2737 |
| 41 | Ga0097621_100081909 | 3300006237 | Bacteria | 2686 |
| 42 | Ga0075428_100061097 | 3300006844 | Bacteria | 4126 |
| 43 | Ga0075430_100011600 | 3300006846 | Bacteria | 7494 |
| 44 | Ga0075431_100031149 | 3300006847 | Bacteria | 5494 |
| 45 | Ga0068865_100054718 | 3300006881 | Bacteria | 2774 |
| 46 | Ga0105251_10023771 | 3300009011 | Bacteria | 3157 |
| 47 | Ga0105240_10003874 | 3300009093 | Bacteria | 23103 |
| 48 | Ga0114129_10006212 | 3300009147 | Bacteria | 16945 |
| 49 | Ga0105243_10130664 | 3300009148 | Bacteria | 2130 |
| 50 | Ga0105242_10060136 | 3300009176 | Bacteria | 3120 |
| 51 | Ga0105032_100180 | 3300009979 | Bacteria | 6509 |
| 52 | Ga0105029_101135 | 3300009984 | Bacteria | 1598 |
| 53 | Ga0157318_1000231 | 3300012482 | Bacteria | 2168 |
| 54 | Ga0157316_1000311 | 3300012510 | Bacteria | 2462 |
| 55 | Ga0157373_10084279 | 3300013100 | Bacteria | 2241 |
| 56 | Ga0157371_10000154 | 3300013102 | Bacteria | 100237 |
| 57 | Ga0157371_10038439 | 3300013102 | Bacteria | 3424 |
| 58 | Ga0157370_10012228 | 3300013104 | Bacteria | 8918 |
| 59 | Ga0157370_10015401 | 3300013104 | Bacteria | 7773 |
| 60 | Ga0157369_10018886 | 3300013105 | Bacteria | 7725 |
| 61 | Ga0157374_10058523 | 3300013296 | Bacteria | 3601 |
| 62 | Ga0157375_10076949 | 3300013308 | Bacteria | 3365 |
| 63 | Ga0163163_10028239 | 3300014325 | Bacteria | 5385 |
| 64 | Ga0182008_10000142 | 3300014497 | Bacteria | 55320 |
| 65 | Ga0182008_10054080 | 3300014497 | Bacteria | 1987 |
| 66 | Ga0157379_10305136 | 3300014968 | Bacteria | 1451 |
| 67 | Ga0157376_10071718 | 3300014969 | Bacteria | 2944 |
| 68 | Ga0182006_1010608 | 3300015261 | Bacteria | 4089 |
| 69 | Ga0182007_10000287 | 3300015262 | Bacteria | 33403 |
| 70 | Ga0182005_1000388 | 3300015265 | Bacteria | 24055 |
| 71 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 72 | Ga0163161_10001348 | 3300017792 | Bacteria | 18260 |
| 73 | Ga0207425_1000030 | 3300025245 | Bacteria | 268200 |
| 74 | Ga0207425_1004388 | 3300025245 | Bacteria | 4254 |
| 75 | Ga0209129_1000063 | 3300025258 | Bacteria | 240205 |
| 76 | Ga0209565_1000048 | 3300025263 | Bacteria | 224961 |
| 77 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 78 | Ga0209673_1003827 | 3300025273 | Bacteria | 8520 |
| 79 | Ga0209130_1003758 | 3300025284 | Bacteria | 6196 |
| 80 | Ga0209675_1000045 | 3300025291 | Bacteria | 225750 |
| 81 | Ga0209676_1008772 | 3300025292 | Bacteria | 4456 |
| 82 | Ga0209025_1000005 | 3300025294 | Bacteria | 1272149 |
| 83 | Ga0209025_1000013 | 3300025294 | Bacteria | 871757 |
| 84 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 85 | Ga0209564_1008181 | 3300025295 | Bacteria | 5224 |
| 86 | Ga0209758_1000014 | 3300025297 | Bacteria | 871757 |
| 87 | Ga0209050_1000603 | 3300025298 | Bacteria | 57120 |
| 88 | Ga0209050_1001888 | 3300025298 | Bacteria | 20105 |
| 89 | Ga0209050_1021058 | 3300025298 | Bacteria | 2396 |
| 90 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 91 | Ga0209256_1002292 | 3300025299 | Bacteria | 16094 |
| 92 | Ga0209256_1004759 | 3300025299 | Bacteria | 8282 |
| 93 | Ga0209256_1016474 | 3300025299 | Bacteria | 2516 |
| 94 | Ga0209257_1000243 | 3300025304 | Bacteria | 126291 |
| 95 | Ga0209257_1001409 | 3300025304 | Bacteria | 28685 |
| 96 | Ga0209257_1004527 | 3300025304 | Bacteria | 10673 |
| 97 | Ga0207713_1044851 | 3300025735 | Bacteria | 1811 |
| 98 | Ga0207647_10159475 | 3300025904 | Bacteria | 1316 |
| 99 | Ga0207699_10155022 | 3300025906 | Bacteria | 1519 |
| 100 | Ga0207695_10020104 | 3300025913 | Bacteria | 7660 |
| 101 | Ga0207695_10239215 | 3300025913 | Bacteria | 1717 |
| 102 | Ga0207657_10025376 | 3300025919 | Bacteria | 5466 |
| 103 | Ga0207649_10189731 | 3300025920 | Bacteria | 1444 |
| 104 | Ga0207652_10051318 | 3300025921 | Bacteria | 3536 |
| 105 | Ga0207681_10005175 | 3300025923 | Bacteria | 8010 |
| 106 | Ga0207690_10072546 | 3300025932 | Bacteria | 2378 |
| 107 | Ga0207709_10001041 | 3300025935 | Bacteria | 20489 |
| 108 | Ga0207691_10001351 | 3300025940 | Bacteria | 24456 |
| 109 | Ga0207691_10171174 | 3300025940 | Bacteria | 1902 |
| 110 | Ga0207661_10184155 | 3300025944 | Bacteria | 1827 |
| 111 | Ga0207679_10117336 | 3300025945 | Bacteria | 2112 |
| 112 | Ga0207651_10031792 | 3300025960 | Bacteria | 3380 |
| 113 | Ga0207668_10056705 | 3300025972 | Bacteria | 2729 |
| 114 | Ga0207668_10121268 | 3300025972 | Bacteria | 1980 |
| 115 | Ga0207639_10066136 | 3300026041 | Bacteria | 2808 |
| 116 | Ga0207676_10078705 | 3300026095 | Bacteria | 2671 |
| 117 | Ga0207674_10123965 | 3300026116 | Bacteria | 2549 |
| 118 | Ga0207683_10077095 | 3300026121 | Bacteria | 2952 |
| 119 | Ga0209371_1000007 | 3300027312 | Bacteria | 1050654 |
| 120 | Ga0209371_1000016 | 3300027312 | Bacteria | 646301 |
| 121 | Ga0209969_1005058 | 3300027360 | Bacteria | 1845 |
| 122 | Ga0209982_1000482 | 3300027552 | Bacteria | 4955 |
| 123 | Ga0209983_1004859 | 3300027665 | Bacteria | 2807 |
| 124 | Ga0209971_1001850 | 3300027682 | Bacteria | 5179 |
| 125 | Ga0209974_10002513 | 3300027876 | Bacteria | 6647 |
| 126 | Ga0209974_10007772 | 3300027876 | Bacteria | 3686 |
| 127 | Ga0209974_10027580 | 3300027876 | Bacteria | 1879 |
| 128 | Ga0268266_10055933 | 3300028379 | Bacteria | 3393 |
| 129 | Ga0307517_10160509 | 3300028786 | Bacteria | 1511 |
| 130 | Ga0268256_1000008 | 3300030500 | Bacteria | 1050654 |
| 131 | Ga0268256_1000015 | 3300030500 | Bacteria | 646300 |
| 132 | Ga0316178_1124434 | 3300030735 | Bacteria | 1987 |
| 133 | Ga0316181_1152677 | 3300030744 | Bacteria | 2159 |
| 134 | Ga0265331_10032289 | 3300031250 | Bacteria | 2595 |
| 135 | Ga0265331_10059241 | 3300031250 | Bacteria | 1811 |
| 136 | Ga0316575_10031254 | 3300031665 | Bacteria | 2084 |
| 137 | Ga0316579_10059477 | 3300031691 | Bacteria | 1796 |
| 138 | Ga0316576_10067989 | 3300031727 | Bacteria | 2624 |
| 139 | Ga0316576_10101793 | 3300031727 | Bacteria | 2148 |
| 140 | Ga0316578_10024662 | 3300031728 | Bacteria | 3375 |
| 141 | Ga0316578_10151089 | 3300031728 | Bacteria | 1399 |
| 142 | Ga0316577_10012906 | 3300031733 | Bacteria | 4560 |
| 143 | Ga0316577_10193897 | 3300031733 | Bacteria | 1148 |
| 144 | Ga0307413_10025883 | 3300031824 | Bacteria | 3225 |
| 145 | Ga0307406_10053789 | 3300031901 | Bacteria | 2566 |
| 146 | Ga0307406_10223259 | 3300031901 | Bacteria | 1402 |
| 147 | Ga0307412_10093492 | 3300031911 | Bacteria | 2109 |
| 148 | Ga0307416_100028791 | 3300032002 | Bacteria | 4138 |
| 149 | Ga0307416_100371858 | 3300032002 | Bacteria | 1456 |
| 150 | Ga0307414_10042265 | 3300032004 | Bacteria | 3095 |
| 151 | Ga0307414_10063045 | 3300032004 | Bacteria | 2633 |
| 152 | Ga0307414_10132152 | 3300032004 | Bacteria | 1939 |
| 153 | Ga0307414_10134887 | 3300032004 | Bacteria | 1923 |
| 154 | Ga0307414_10269206 | 3300032004 | Bacteria | 1426 |
| 155 | Ga0307411_10055649 | 3300032005 | Bacteria | 2603 |
| 156 | Ga0307411_10224951 | 3300032005 | Bacteria | 1458 |
| 157 | Ga0307415_100325121 | 3300032126 | Bacteria | 1284 |
| 158 | Ga0316583_10000574 | 3300032133 | Bacteria | 11174 |
| 159 | Ga0316580_10010932 | 3300032139 | Bacteria | 2750 |
| 160 | Ga0316574_0001191 | 3300035398 | Bacteria | 12069 |
| 161 | Ga0316574_0001600 | 3300035398 | Bacteria | 10846 |
| 162 | Ga0316574_0049202 | 3300035398 | Bacteria | 2620 |
| 163 | Ga0316574_0095285 | 3300035398 | Bacteria | 1902 |
| 164 | Ga0316582_0000848 | 3300036647 | Bacteria | 12445 |
| 165 | Ga0316582_0001504 | 3300036647 | Bacteria | 10303 |
| 166 | Ga0316582_0170337 | 3300036647 | Bacteria | 1478 |
| 167 | Ga0316584_0004963 | 3300036712 | Bacteria | 8859 |
| 168 | Ga0316584_0007391 | 3300036712 | Bacteria | 7507 |
| 169 | Ga0316584_0031766 | 3300036712 | Bacteria | 3904 |
| 170 | Ga0436365_0628467 | 3300039437 | Bacteria | 1436 |
| 171 | Ga0439436_0009432 | 3300041404 | Bacteria | 2993 |
| 172 | Ga0439436_0014449 | 3300041404 | Bacteria | 2381 |
| 173 | Ga0439439_0006645 | 3300041406 | Bacteria | 2678 |
| 174 | Ga0439447_005388 | 3300041407 | Bacteria | 4263 |
| 175 | Ga0439465_0009871 | 3300041413 | Bacteria | 3006 |
| 176 | Ga0439433_0027876 | 3300041999 | Bacteria | 1283 |
| 177 | Ga0439432_045186 | 3300042006 | Bacteria | 1386 |
| 178 | Ga0439449_0000156 | 3300042007 | Bacteria | 23254 |
| 179 | Ga0439449_0004679 | 3300042007 | Bacteria | 5287 |
| 180 | Ga0439449_0010817 | 3300042007 | Bacteria | 3444 |
| 181 | Ga0439449_0015772 | 3300042007 | Bacteria | 2840 |
| 182 | Ga0451577_0000105 | 3300042876 | Bacteria | 184360 |
| 183 | Ga0466969_0031949 | 3300044656 | Bacteria | 2678 |
| 184 | Ga0466966_0004290 | 3300044684 | Bacteria | 9402 |
| 185 | Ga0466961_0083631 | 3300044693 | Bacteria | 2019 |
| 186 | Ga0453684_0003537 | 3300044712 | Bacteria | 34947 |
| 187 | Ga0466957_0063707 | 3300044842 | Bacteria | 2267 |
| 188 | Ga0466957_0129629 | 3300044842 | Bacteria | 1615 |
| 189 | Ga0466959_0037053 | 3300045049 | Bacteria | 3603 |
| 190 | Ga0466959_0360717 | 3300045049 | Bacteria | 990 |
| 191 | Ga0466958_0058567 | 3300045836 | Bacteria | 2342 |
| 192 | Ga0466958_0150896 | 3300045836 | Bacteria | 1466 |
| 193 | Ga0495638_0004889 | 3300046460 | Bacteria | 10075 |
| 194 | Ga0495607_0151690 | 3300046501 | Bacteria | 1185 |
| 195 | Ga0495606_0013802 | 3300046507 | Bacteria | 6351 |
| 196 | Ga0495610_0007451 | 3300046512 | Bacteria | 7280 |
| 197 | Ga0495631_0004101 | 3300046518 | Bacteria | 7824 |
| 198 | Ga0495643_0001695 | 3300046522 | Bacteria | 19192 |
| 199 | Ga0495633_0024212 | 3300046558 | Bacteria | 3002 |
| 200 | Ga0495668_0007035 | 3300046616 | Bacteria | 7259 |
| 201 | Ga0495625_0048182 | 3300046660 | Bacteria | 3069 |
| 202 | Ga0495636_0015719 | 3300047318 | Bacteria | 3017 |
| 203 | Ga0495636_0021659 | 3300047318 | Bacteria | 2596 |
| 204 | Ga0495636_0025838 | 3300047318 | Bacteria | 2386 |
| 205 | Ga0495672_0000073 | 3300047320 | Bacteria | 179398 |
| 206 | Ga0495686_0016393 | 3300047472 | Bacteria | 5025 |
| 207 | Ga0496112_0038440 | 3300048915 | Bacteria | 4673 |
| 208 | Ga0496114_0010365 | 3300048917 | Bacteria | 7416 |
| 209 | Ga0496114_0405146 | 3300048917 | Bacteria | 1208 |
| 210 | Ga0496116_0002061 | 3300048919 | Bacteria | 21524 |
| 211 | Ga0496117_0002324 | 3300048920 | Bacteria | 24332 |
| 212 | Ga0496117_0003747 | 3300048920 | Bacteria | 17400 |
| 213 | Ga0496117_0179665 | 3300048920 | Bacteria | 1218 |
| 214 | Ga0496118_0000344 | 3300048921 | Bacteria | 78989 |
| 215 | Ga0496118_0001379 | 3300048921 | Bacteria | 36605 |
| 216 | Ga0496119_0003326 | 3300048922 | Bacteria | 16773 |
| 217 | Ga0496120_0023755 | 3300048923 | Bacteria | 3834 |
| 218 | Ga0496121_0006284 | 3300048924 | Bacteria | 14851 |
| 219 | Ga0496121_0017375 | 3300048924 | Bacteria | 7355 |
| 220 | Ga0496121_0019877 | 3300048924 | Bacteria | 6686 |
| 221 | Ga0496122_0017650 | 3300048925 | Bacteria | 6655 |
| 222 | Ga0496122_0049521 | 3300048925 | Bacteria | 3215 |
| 223 | Ga0496124_0022778 | 3300048927 | Bacteria | 5734 |
| 224 | Ga0496125_0007804 | 3300048928 | Bacteria | 11315 |
| 225 | Ga0496125_0052603 | 3300048928 | Bacteria | 3348 |
| 226 | Ga0496126_0054742 | 3300048929 | Bacteria | 3612 |
| 227 | Ga0501300_011196 | 3300049523 | Bacteria | 1308 |
| 228 | Ga0501031_0002797 | 3300049568 | Bacteria | 11131 |
| 229 | Ga0501031_0010177 | 3300049568 | Bacteria | 6127 |
| 230 | Ga0501032_0003474 | 3300049569 | Bacteria | 12065 |
| 231 | Ga0501033_0005223 | 3300049570 | Bacteria | 10312 |
| 232 | Ga0501033_0211682 | 3300049570 | Bacteria | 1382 |
| 233 | Ga0501034_0001021 | 3300049571 | Bacteria | 40111 |
| 234 | Ga0501034_0002909 | 3300049571 | Bacteria | 19882 |
| 235 | Ga0501034_0043728 | 3300049571 | Bacteria | 4531 |
| 236 | Ga0501034_0164388 | 3300049571 | Bacteria | 2188 |
| 237 | Ga0501036_0009131 | 3300049572 | Bacteria | 8154 |
| 238 | Ga0501036_0009344 | 3300049572 | Bacteria | 8063 |
| 239 | Ga0501036_0199569 | 3300049572 | Bacteria | 1683 |
| 240 | Ga0501037_0002420 | 3300049573 | Bacteria | 13491 |
| 241 | Ga0501037_0003701 | 3300049573 | Bacteria | 11101 |
| 242 | Ga0501037_0008094 | 3300049573 | Bacteria | 7702 |
| 243 | Ga0501038_0005011 | 3300049574 | Bacteria | 12292 |
| 244 | Ga0501038_0051100 | 3300049574 | Bacteria | 3569 |
| 245 | Ga0501038_0059626 | 3300049574 | Bacteria | 3268 |
| 246 | Ga0501039_0013331 | 3300049575 | Bacteria | 6284 |
| 247 | Ga0501039_0041055 | 3300049575 | Bacteria | 3572 |
| 248 | Ga0501043_0006380 | 3300049579 | Bacteria | 9474 |
| 249 | Ga0501043_0040688 | 3300049579 | Bacteria | 3653 |
| 250 | Ga0501043_0194086 | 3300049579 | Bacteria | 1578 |
| 251 | Ga0501046_0030600 | 3300049580 | Bacteria | 4368 |
| 252 | Ga0501046_0031540 | 3300049580 | Bacteria | 4294 |
| 253 | Ga0501047_0079637 | 3300049581 | Bacteria | 3149 |
| 254 | Ga0501048_0032212 | 3300049582 | Bacteria | 3788 |
| 255 | Ga0501067_0047546 | 3300049583 | Bacteria | 2379 |
| 256 | Ga0501068_0003262 | 3300049584 | Bacteria | 8699 |
| 257 | Ga0501069_0001264 | 3300049585 | Bacteria | 12408 |
| 258 | Ga0501070_0008322 | 3300049586 | Bacteria | 8763 |
| 259 | Ga0501070_0012849 | 3300049586 | Bacteria | 7056 |
| 260 | Ga0501070_0025302 | 3300049586 | Bacteria | 4977 |
| 261 | Ga0501070_0041087 | 3300049586 | Bacteria | 3853 |
| 262 | Ga0501070_0083798 | 3300049586 | Bacteria | 2640 |
| 263 | Ga0501070_0141558 | 3300049586 | Bacteria | 1986 |
| 264 | Ga0501071_0064665 | 3300049587 | Bacteria | 2654 |
| 265 | Ga0501071_0101466 | 3300049587 | Bacteria | 2121 |
| 266 | Ga0501072_0207779 | 3300049588 | Bacteria | 1560 |
| 267 | Ga0501073_0004387 | 3300049589 | Bacteria | 10598 |
| 268 | Ga0501073_0007082 | 3300049589 | Bacteria | 8351 |
| 269 | Ga0501073_0083726 | 3300049589 | Bacteria | 2219 |
| 270 | Ga0501073_0086538 | 3300049589 | Bacteria | 2180 |
| 271 | Ga0501073_0123574 | 3300049589 | Bacteria | 1794 |
| 272 | Ga0501074_0000176 | 3300049590 | Bacteria | 34551 |
| 273 | Ga0501079_0005754 | 3300049741 | Bacteria | 9266 |
| 274 | Ga0501080_0008260 | 3300049742 | Bacteria | 9429 |
| 275 | Ga0501080_0012957 | 3300049742 | Bacteria | 7655 |
| 276 | Ga0501081_0073874 | 3300049743 | Bacteria | 2378 |
| 277 | Ga0501083_0007992 | 3300049744 | Bacteria | 7490 |
| 278 | Ga0501035_0003472 | 3300049822 | Bacteria | 15084 |
| 279 | Ga0501035_0005788 | 3300049822 | Bacteria | 11649 |
| 280 | Ga0501044_0022211 | 3300049823 | Bacteria | 6761 |
| 281 | Ga0501044_0112357 | 3300049823 | Bacteria | 2731 |
| 282 | Ga0501044_0256099 | 3300049823 | Bacteria | 1689 |
| 283 | Ga0501045_0135680 | 3300049824 | Bacteria | 1829 |
| 284 | nmdc:mga00v17_202_c2 | 3300050491 | Bacteria | 31082 |
| 285 | nmdc:mga05p37_2658_c1 | 3300050507 | Bacteria | 20814 |
| 286 | nmdc:mga0qj67_10803_c1 | 3300050509 | Bacteria | 6829 |
| 287 | nmdc:mga0qj67_7764_c1 | 3300050509 | Bacteria | 7928 |
| 288 | Ga0500651_0002382 | 3300053093 | Bacteria | 9897 |
| 289 | Ga0501084_0075474 | 3300054114 | Bacteria | 2824 |
| 290 | Ga0501082_0006658 | 3300060353 | Bacteria | 9997 |
| 291 | Ga0501082_0008064 | 3300060353 | Bacteria | 9086 |
| 292 | 2547500028 | 2547132130 | Bacteria | 4660562 |
| 293 | 2547500762 | 2547132130 | Bacteria | 4660562 |
| 294 | 2578457579 | 2576861471 | Bacteria | 4648976 |
| 295 | 2643815274 | 2643221559 | Bacteria | 4424915 |
| 296 | 2643879313 | 2643221573 | Bacteria | 4784121 |
| 297 | 2643939952 | 2643221586 | Bacteria | 4446529 |
| 298 | 2643976186 | 2643221593 | Bacteria | 6296053 |
| 299 | 2644077010 | 2643221612 | Bacteria | 4361984 |
| 300 | 2644528891 | 2643221695 | Bacteria | 3441323 |
| 301 | 2644660612 | 2643221720 | Bacteria | 4694283 |
| 302 | 2644695324 | 2643221727 | Bacteria | 4415595 |
| 303 | 2644697973 | 2643221728 | Bacteria | 4797149 |
| 304 | 2816519054 | 2816332141 | Bacteria | 4436036 |
| 305 | 2842394861 | 2842391507 | Bacteria | 4486072 |
| 306 | 2852650001 | 2852649853 | Bacteria | 4036942 |
| 307 | 2857446973 | 2857442823 | Bacteria | 4562550 |
| 308 | 2874222587 | 2874220319 | Bacteria | 4594709 |
| 309 | 2894415901 | 2894414249 | Bacteria | 4405451 |
| 310 | 2895524458 | 2895522137 | Bacteria | 3284416 |
| 311 | 2919090528 | 2919089067 | Bacteria | 4560942 |
| 312 | 2919130636 | 2919130084 | Bacteria | 5301837 |
| 313 | 2919137543 | 2919134579 | Bacteria | 4480386 |
| 314 | 2928498363 | 2928496128 | Bacteria | 4631123 |
| 315 | 2929198361 | 2929195423 | Bacteria | 5325372 |
| 316 | 2931383956 | 2931380184 | Bacteria | 4455911 |
| 317 | 2937614483 | 2937610967 | Bacteria | 4618818 |
| 318 | 2939591129 | 2939589442 | Bacteria | 4214238 |
| 319 | 2939624623 | 2939622612 | Bacteria | 4698046 |
| 320 | 2939628302 | 2939626828 | Bacteria | 4695272 |
| 321 | 2941476655 | 2941475908 | Bacteria | 4145589 |
| 322 | 2941491146 | 2941489479 | Bacteria | 6313767 |
| 323 | 2961049352 | 2961047084 | Bacteria | 4594415 |
| 324 | 2961065960 | 2961064222 | Bacteria | 4749990 |
| 325 | 2974308205 | 2974307012 | Bacteria | 4172388 |
| 326 | 2977248957 | 2977247770 | Bacteria | 4160543 |
| 327 | 2984516586 | 2984514374 | Bacteria | 4172479 |
| 328 | 2989393254 | 2989392574 | Bacteria | 4554005 |
| 329 | 2995952077 | 2995948881 | Bacteria | 6358104 |
| 330 | 8003014584 | 8003014200 | Bacteria | 4059994 |
| 331 | Ga0439436_0003435 | |||
| 332 | JGI25152J39213_1000548 | |||
| 333 | JGI25150J39212_1000114 | |||
| 334 | JGI25151J46595_10000100 | |||
| 335 | JGI25151J46595_10000128 | |||
| 336 | JGI25153J46596_10000071 | |||
| 337 | Ga0055526_1000021 | |||
| 338 | Ga0055526_1016148 | |||
| 339 | Ga0055537_1000141 | |||
| 340 | Ga0055524_1000128 | |||
| 341 | Ga0055524_1035871 | |||
| 342 | Ga0055524_1038705 | |||
| 343 | Ga0055534_1000054 | |||
| 344 | Ga0055528_1000009 | |||
| 345 | Ga0055530_10002002 | |||
| 346 | Ga0055530_10012905 | |||
| 347 | Ga0055531_10029560 | |||
| 348 | Ga0055531_10046642 | |||
| 349 | Ga0058692_1000024 | |||
| 350 | Ga0065714_10069580 | |||
| 351 | Ga0065704_10108834 | |||
| 352 | Ga0065704_10122712 | |||
| 353 | Ga0070680_100010297 | |||
| 354 | Ga0070660_100043227 | |||
| 355 | Ga0070661_100163750 | |||
| 356 | Ga0070668_100119181 | |||
| 357 | Ga0070669_100117131 | |||
| 358 | Ga0070671_100055431 | |||
| 359 | Ga0070659_100155085 | |||
| 360 | Ga0070667_100215910 | |||
| 361 | Ga0070681_10009605 | |||
| 362 | Ga0068867_100070501 | |||
| 363 | Ga0068853_100358185 | |||
| 364 | Ga0070672_100004894 | |||
| 365 | Ga0070693_100046574 | |||
| 366 | Ga0070665_100061606 | |||
| 367 | Ga0081539_10080032 | |||
| 368 | Ga0075364_10090503 | |||
| 369 | Ga0075369_10009077 | |||
| 370 | Ga0097621_100078811 | |||
| 371 | Ga0097621_100081909 | |||
| 372 | Ga0075428_100061097 | |||
| 373 | Ga0075430_100011600 | |||
| 374 | Ga0075431_100031149 | |||
| 375 | Ga0068865_100054718 | |||
| 376 | Ga0105251_10023771 | |||
| 377 | Ga0105240_10003874 | |||
| 378 | Ga0114129_10006212 | |||
| 379 | Ga0105243_10130664 | |||
| 380 | Ga0105242_10060136 | |||
| 381 | Ga0105032_100180 | |||
| 382 | Ga0105029_101135 | |||
| 383 | Ga0157318_1000231 | |||
| 384 | Ga0157316_1000311 | |||
| 385 | Ga0157373_10084279 | |||
| 386 | Ga0157371_10000154 | |||
| 387 | Ga0157371_10038439 | |||
| 388 | Ga0157370_10012228 | |||
| 389 | Ga0157370_10015401 | |||
| 390 | Ga0157369_10018886 | |||
| 391 | Ga0157374_10058523 | |||
| 392 | Ga0157375_10076949 | |||
| 393 | Ga0163163_10028239 | |||
| 394 | Ga0182008_10000142 | |||
| 395 | Ga0182008_10054080 | |||
| 396 | Ga0157379_10305136 | |||
| 397 | Ga0157376_10071718 | |||
| 398 | Ga0182006_1010608 | |||
| 399 | Ga0182007_10000287 | |||
| 400 | Ga0182005_1000388 | |||
| 401 | Ga0183360_10001 | |||
| 402 | Ga0163161_10001348 | |||
| 403 | Ga0207425_1000030 | |||
| 404 | Ga0207425_1004388 | |||
| 405 | Ga0209129_1000063 | |||
| 406 | Ga0209565_1000048 | |||
| 407 | Ga0209673_1000001 | |||
| 408 | Ga0209673_1003827 | |||
| 409 | Ga0209130_1003758 | |||
| 410 | Ga0209675_1000045 | |||
| 411 | Ga0209676_1008772 | |||
| 412 | Ga0209025_1000005 | |||
| 413 | Ga0209025_1000013 | |||
| 414 | Ga0209564_1000001 | |||
| 415 | Ga0209564_1008181 | |||
| 416 | Ga0209758_1000014 | |||
| 417 | Ga0209050_1000603 | |||
| 418 | Ga0209050_1001888 | |||
| 419 | Ga0209050_1021058 | |||
| 420 | Ga0209256_1000002 | |||
| 421 | Ga0209256_1002292 | |||
| 422 | Ga0209256_1004759 | |||
| 423 | Ga0209256_1016474 | |||
| 424 | Ga0209257_1000243 | |||
| 425 | Ga0209257_1001409 | |||
| 426 | Ga0209257_1004527 | |||
| 427 | Ga0207713_1044851 | |||
| 428 | Ga0207647_10159475 | |||
| 429 | Ga0207699_10155022 | |||
| 430 | Ga0207695_10020104 | |||
| 431 | Ga0207695_10239215 | |||
| 432 | Ga0207657_10025376 | |||
| 433 | Ga0207649_10189731 | |||
| 434 | Ga0207652_10051318 | |||
| 435 | Ga0207681_10005175 | |||
| 436 | Ga0207690_10072546 | |||
| 437 | Ga0207709_10001041 | |||
| 438 | Ga0207691_10001351 | |||
| 439 | Ga0207691_10171174 | |||
| 440 | Ga0207661_10184155 | |||
| 441 | Ga0207679_10117336 | |||
| 442 | Ga0207651_10031792 | |||
| 443 | Ga0207668_10056705 | |||
| 444 | Ga0207668_10121268 | |||
| 445 | Ga0207639_10066136 | |||
| 446 | Ga0207676_10078705 | |||
| 447 | Ga0207674_10123965 | |||
| 448 | Ga0207683_10077095 | |||
| 449 | Ga0209371_1000007 | |||
| 450 | Ga0209371_1000016 | |||
| 451 | Ga0209969_1005058 | |||
| 452 | Ga0209982_1000482 | |||
| 453 | Ga0209983_1004859 | |||
| 454 | Ga0209971_1001850 | |||
| 455 | Ga0209974_10002513 | |||
| 456 | Ga0209974_10007772 | |||
| 457 | Ga0209974_10027580 | |||
| 458 | Ga0268266_10055933 | |||
| 459 | Ga0307517_10160509 | |||
| 460 | Ga0268256_1000008 | |||
| 461 | Ga0268256_1000015 | |||
| 462 | Ga0316178_1124434 | |||
| 463 | Ga0316181_1152677 | |||
| 464 | Ga0265331_10032289 | |||
| 465 | Ga0265331_10059241 | |||
| 466 | Ga0316575_10031254 | |||
| 467 | Ga0316579_10059477 | |||
| 468 | Ga0316576_10067989 | |||
| 469 | Ga0316576_10101793 | |||
| 470 | Ga0316578_10024662 | |||
| 471 | Ga0316578_10151089 | |||
| 472 | Ga0316577_10012906 | |||
| 473 | Ga0316577_10193897 | |||
| 474 | Ga0307413_10025883 | |||
| 475 | Ga0307406_10053789 | |||
| 476 | Ga0307406_10223259 | |||
| 477 | Ga0307412_10093492 | |||
| 478 | Ga0307416_100028791 | |||
| 479 | Ga0307416_100371858 | |||
| 480 | Ga0307414_10042265 | |||
| 481 | Ga0307414_10063045 | |||
| 482 | Ga0307414_10132152 | |||
| 483 | Ga0307414_10134887 | |||
| 484 | Ga0307414_10269206 | |||
| 485 | Ga0307411_10055649 | |||
| 486 | Ga0307411_10224951 | |||
| 487 | Ga0307415_100325121 | |||
| 488 | Ga0316583_10000574 | |||
| 489 | Ga0316580_10010932 | |||
| 490 | Ga0316574_0001191 | |||
| 491 | Ga0316574_0001600 | |||
| 492 | Ga0316574_0049202 | |||
| 493 | Ga0316574_0095285 | |||
| 494 | Ga0316582_0000848 | |||
| 495 | Ga0316582_0001504 | |||
| 496 | Ga0316582_0170337 | |||
| 497 | Ga0316584_0004963 | |||
| 498 | Ga0316584_0007391 | |||
| 499 | Ga0316584_0031766 | |||
| 500 | Ga0436365_0628467 | |||
| 501 | Ga0439436_0009432 | |||
| 502 | Ga0439436_0014449 | |||
| 503 | Ga0439439_0006645 | |||
| 504 | Ga0439447_005388 | |||
| 505 | Ga0439465_0009871 | |||
| 506 | Ga0439433_0027876 | |||
| 507 | Ga0439432_045186 | |||
| 508 | Ga0439449_0000156 | |||
| 509 | Ga0439449_0004679 | |||
| 510 | Ga0439449_0010817 | |||
| 511 | Ga0439449_0015772 | |||
| 512 | Ga0451577_0000105 | |||
| 513 | Ga0466969_0031949 | |||
| 514 | Ga0466966_0004290 | |||
| 515 | Ga0466961_0083631 | |||
| 516 | Ga0453684_0003537 | |||
| 517 | Ga0466957_0063707 | |||
| 518 | Ga0466957_0129629 | |||
| 519 | Ga0466959_0037053 | |||
| 520 | Ga0466959_0360717 | |||
| 521 | Ga0466958_0058567 | |||
| 522 | Ga0466958_0150896 | |||
| 523 | Ga0495638_0004889 | |||
| 524 | Ga0495607_0151690 | |||
| 525 | Ga0495606_0013802 | |||
| 526 | Ga0495610_0007451 | |||
| 527 | Ga0495631_0004101 | |||
| 528 | Ga0495643_0001695 | |||
| 529 | Ga0495633_0024212 | |||
| 530 | Ga0495668_0007035 | |||
| 531 | Ga0495625_0048182 | |||
| 532 | Ga0495636_0015719 | |||
| 533 | Ga0495636_0021659 | |||
| 534 | Ga0495636_0025838 | |||
| 535 | Ga0495672_0000073 | |||
| 536 | Ga0495686_0016393 | |||
| 537 | Ga0496112_0038440 | |||
| 538 | Ga0496114_0010365 | |||
| 539 | Ga0496114_0405146 | |||
| 540 | Ga0496116_0002061 | |||
| 541 | Ga0496117_0002324 | |||
| 542 | Ga0496117_0003747 | |||
| 543 | Ga0496117_0179665 | |||
| 544 | Ga0496118_0000344 | |||
| 545 | Ga0496118_0001379 | |||
| 546 | Ga0496119_0003326 | |||
| 547 | Ga0496120_0023755 | |||
| 548 | Ga0496121_0006284 | |||
| 549 | Ga0496121_0017375 | |||
| 550 | Ga0496121_0019877 | |||
| 551 | Ga0496122_0017650 | |||
| 552 | Ga0496122_0049521 | |||
| 553 | Ga0496124_0022778 | |||
| 554 | Ga0496125_0007804 | |||
| 555 | Ga0496125_0052603 | |||
| 556 | Ga0496126_0054742 | |||
| 557 | Ga0501300_011196 | |||
| 558 | Ga0501031_0002797 | |||
| 559 | Ga0501031_0010177 | |||
| 560 | Ga0501032_0003474 | |||
| 561 | Ga0501033_0005223 | |||
| 562 | Ga0501033_0211682 | |||
| 563 | Ga0501034_0001021 | |||
| 564 | Ga0501034_0002909 | |||
| 565 | Ga0501034_0043728 | |||
| 566 | Ga0501034_0164388 | |||
| 567 | Ga0501036_0009131 | |||
| 568 | Ga0501036_0009344 | |||
| 569 | Ga0501036_0199569 | |||
| 570 | Ga0501037_0002420 | |||
| 571 | Ga0501037_0003701 | |||
| 572 | Ga0501037_0008094 | |||
| 573 | Ga0501038_0005011 | |||
| 574 | Ga0501038_0051100 | |||
| 575 | Ga0501038_0059626 | |||
| 576 | Ga0501039_0013331 | |||
| 577 | Ga0501039_0041055 | |||
| 578 | Ga0501043_0006380 | |||
| 579 | Ga0501043_0040688 | |||
| 580 | Ga0501043_0194086 | |||
| 581 | Ga0501046_0030600 | |||
| 582 | Ga0501046_0031540 | |||
| 583 | Ga0501047_0079637 | |||
| 584 | Ga0501048_0032212 | |||
| 585 | Ga0501067_0047546 | |||
| 586 | Ga0501068_0003262 | |||
| 587 | Ga0501069_0001264 | |||
| 588 | Ga0501070_0008322 | |||
| 589 | Ga0501070_0012849 | |||
| 590 | Ga0501070_0025302 | |||
| 591 | Ga0501070_0041087 | |||
| 592 | Ga0501070_0083798 | |||
| 593 | Ga0501070_0141558 | |||
| 594 | Ga0501071_0064665 | |||
| 595 | Ga0501071_0101466 | |||
| 596 | Ga0501072_0207779 | |||
| 597 | Ga0501073_0004387 | |||
| 598 | Ga0501073_0007082 | |||
| 599 | Ga0501073_0083726 | |||
| 600 | Ga0501073_0086538 | |||
| 601 | Ga0501073_0123574 | |||
| 602 | Ga0501074_0000176 | |||
| 603 | Ga0501079_0005754 | |||
| 604 | Ga0501080_0008260 | |||
| 605 | Ga0501080_0012957 | |||
| 606 | Ga0501081_0073874 | |||
| 607 | Ga0501083_0007992 | |||
| 608 | Ga0501035_0003472 | |||
| 609 | Ga0501035_0005788 | |||
| 610 | Ga0501044_0022211 | |||
| 611 | Ga0501044_0112357 | |||
| 612 | Ga0501044_0256099 | |||
| 613 | Ga0501045_0135680 | |||
| 614 | nmdc:mga00v17_202_c2 | |||
| 615 | nmdc:mga05p37_2658_c1 | |||
| 616 | nmdc:mga0qj67_10803_c1 | |||
| 617 | nmdc:mga0qj67_7764_c1 | |||
| 618 | Ga0500651_0002382 | |||
| 619 | Ga0501084_0075474 | |||
| 620 | Ga0501082_0006658 | |||
| 621 | Ga0501082_0008064 | |||
| 622 | 2547500028 | |||
| 623 | 2547500762 | |||
| 624 | 2578457579 | |||
| 625 | 2643815274 | |||
| 626 | 2643879313 | |||
| 627 | 2643939952 | |||
| 628 | 2643976186 | |||
| 629 | 2644077010 | |||
| 630 | 2644528891 | |||
| 631 | 2644660612 | |||
| 632 | 2644695324 | |||
| 633 | 2644697973 | |||
| 634 | 2816519054 | |||
| 635 | 2842394861 | |||
| 636 | 2852650001 | |||
| 637 | 2857446973 | |||
| 638 | 2874222587 | |||
| 639 | 2894415901 | |||
| 640 | 2895524458 | |||
| 641 | 2919090528 | |||
| 642 | 2919130636 | |||
| 643 | 2919137543 | |||
| 644 | 2928498363 | |||
| 645 | 2929198361 | |||
| 646 | 2931383956 | |||
| 647 | 2937614483 | |||
| 648 | 2939591129 | |||
| 649 | 2939624623 | |||
| 650 | 2939628302 | |||
| 651 | 2941476655 | |||
| 652 | 2941491146 | |||
| 653 | 2961049352 | |||
| 654 | 2961065960 | |||
| 655 | 2974308205 | |||
| 656 | 2977248957 | |||
| 657 | 2984516586 | |||
| 658 | 2989393254 | |||
| 659 | 2995952077 | |||
| 660 | 8003014584 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qz9-assembly2.cif.gz_B-2 | crystal structure of aspartate semialdehyde dehydrogenase ii from vibrio cholerae | 0.9846 | 6 | 342 |
| 2r00-assembly2.cif.gz_C-2 | crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae | 0.9841 | 6 | 342 |
| 2qz9-assembly2.cif.gz_B-2 | crystal structure of aspartate semialdehyde dehydrogenase ii from vibrio cholerae | 0.9817 | 6 | 342 |
| 2r00-assembly2.cif.gz_C-2 | crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae | 0.9783 | 6 | 342 |
| 2yv3-assembly1.cif.gz_B | crystal structure of aspartate semialdehyde dehydrogenase from thermus thermophilus hb8 | 0.9715 | 9 | 335 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2r00C02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9885 | 132 | 321 | 3.30.360.10 |
| af_P08390_5_140_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.986 | 8 | 140 | 3.40.50.720 |
| 2yv3B02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9834 | 132 | 320 | 3.30.360.10 |
| 2r00C02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9832 | 132 | 321 | 3.30.360.10 |
| af_Q93Y73_167_356_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9785 | 132 | 320 | 3.30.360.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A091AZB7-F1-model_v4 | Aspartate-semialdehyde dehydrogenase (ASA dehydrogenase) (ASADH) (EC 1.2.1.11) (Aspartate-beta-semialdehyde dehydrogenase) | 0.9985 | 14 | 342 |
GO:0004073
GO:0009088 GO:0009089 GO:0009097 GO:0019877 GO:0046983 GO:0050661 GO:0051287 GO:0071266 |
| AF-A0A7H8WIY3-F1-model_v4 | deleted | 0.9976 | 1 | 340 |
|
| AF-A0A3D2N058-F1-model_v4 | Aspartate-semialdehyde dehydrogenase | 0.9975 | 137 | 319 |
GO:0004073
GO:0009085 GO:0009086 GO:0019877 GO:0046983 GO:0050661 |
| AF-A0A3D2JW23-F1-model_v4 | Aspartate-semialdehyde dehydrogenase | 0.9975 | 205 | 335 |
GO:0004073
GO:0009085 GO:0009086 GO:0019877 GO:0046983 GO:0050661 |
| AF-A0A2W4Y775-F1-model_v4 | deleted | 0.9974 | 6 | 341 |
|