F410193

General Info

Members Datasets Scaffolds Average Seq Length
330 233 660 341

Family's Representative Sequence

Representative Sequence 3300041404|Ga0439436_0003435|Ga0439436_0003435_1435_2532
Length 365
Sequence MQHPPEMGPAAPKPGKSKLMNAKTSCNVAVVGATGAVGETMLKVLAERKFPIGKLHVLASERSAGEKIQFEGKTLVVEDLATFDPSGVDIALFSAGGSVSKEFAPKFAAAGAVVIDNSSAFRYDDDIPLVVSEVNPEQIANRPRGIIANPNCSTMQMLVALAPIHRKVGIERINVATYQSVSGTGRRALEELGRQTAGLLNFQETKAEVYPVQIAFNVIPHGGDFTDNGYTTEEMKLVWETRKILGDDSIGVNATVVRVPVFYAHSEAVHIETREKLSAADARKLLEAAPGLEVVDEAVGGGYPTPVTHASGHDPVYVGRIRDDISHPRGLAMWVVADNIRKGAALNAVQLAELVWAEQRAQHAA

Samples

Sample ID Description Type Environment
1 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
44 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
45 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
46 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
60 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
63 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
64 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
102 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
103 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
104 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
107 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
108 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
109 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
110 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
111 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
119 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
120 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
121 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
122 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
125 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
126 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
127 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
128 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
129 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
197 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
198 2643221559 Lysobacter sp. Root559 Isolate Unclassified
199 2643221573 Lysobacter sp. Root604 Isolate Unclassified
200 2643221586 Lysobacter sp. Root667 Isolate Unclassified
201 2643221593 Lysobacter sp. Root690 Isolate Unclassified
202 2643221612 Lysobacter sp. Root76 Isolate Unclassified
203 2643221695 Lysobacter sp. Root494 Isolate Unclassified
204 2643221720 Lysobacter sp. Root916 Isolate Unclassified
205 2643221727 Lysobacter sp. Root96 Isolate Unclassified
206 2643221728 Lysobacter sp. Root983 Isolate Unclassified
207 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
208 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
209 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
210 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
211 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
212 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
213 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
214 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
215 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
216 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
217 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
218 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
219 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
220 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
221 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
222 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
223 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
224 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
225 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
226 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
227 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
228 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
229 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
230 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
231 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
232 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
233 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.18
Metatranscriptomes 0
Isolates 11.82

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0
Endosphere 13.64
Nodule 0.3
Rhizoplane 0.91
Rhizosphere 72.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439436_0003435 3300041404 Bacteria 4811
2 JGI25152J39213_1000548 3300002773 Bacteria 20669
3 JGI25150J39212_1000114 3300002774 Bacteria 45745
4 JGI25151J46595_10000100 3300003187 Bacteria 116522
5 JGI25151J46595_10000128 3300003187 Bacteria 102514
6 JGI25153J46596_10000071 3300003215 Bacteria 116950
7 Ga0055526_1000021 3300003771 Bacteria 180007
8 Ga0055526_1016148 3300003771 Bacteria 2942
9 Ga0055537_1000141 3300003773 Bacteria 54030
10 Ga0055524_1000128 3300003775 Bacteria 88986
11 Ga0055524_1035871 3300003775 Bacteria 1345
12 Ga0055524_1038705 3300003775 Bacteria 1243
13 Ga0055534_1000054 3300003784 Bacteria 88986
14 Ga0055528_1000009 3300003790 Bacteria 224150
15 Ga0055530_10002002 3300003791 Bacteria 13806
16 Ga0055530_10012905 3300003791 Bacteria 2885
17 Ga0055531_10029560 3300003794 Bacteria 1864
18 Ga0055531_10046642 3300003794 Bacteria 1188
19 Ga0058692_1000024 3300003856 Bacteria 219702
20 Ga0065714_10069580 3300005288 Bacteria 4170
21 Ga0065704_10108834 3300005289 Bacteria 2018
22 Ga0065704_10122712 3300005289 Bacteria 1745
23 Ga0070680_100010297 3300005336 Bacteria 7208
24 Ga0070660_100043227 3300005339 Bacteria 3442
25 Ga0070661_100163750 3300005344 Bacteria 1685
26 Ga0070668_100119181 3300005347 Bacteria 2108
27 Ga0070669_100117131 3300005353 Bacteria 2028
28 Ga0070671_100055431 3300005355 Bacteria 3297
29 Ga0070659_100155085 3300005366 Bacteria 1870
30 Ga0070667_100215910 3300005367 Bacteria 1706
31 Ga0070681_10009605 3300005458 Bacteria 9512
32 Ga0068867_100070501 3300005459 Bacteria 2613
33 Ga0068853_100358185 3300005539 Bacteria 1358
34 Ga0070672_100004894 3300005543 Bacteria 8811
35 Ga0070693_100046574 3300005547 Bacteria 2463
36 Ga0070665_100061606 3300005548 Bacteria 3761
37 Ga0081539_10080032 3300005985 Bacteria 1720
38 Ga0075364_10090503 3300006051 Bacteria 2030
39 Ga0075369_10009077 3300006186 Bacteria 3851
40 Ga0097621_100078811 3300006237 Bacteria 2737
41 Ga0097621_100081909 3300006237 Bacteria 2686
42 Ga0075428_100061097 3300006844 Bacteria 4126
43 Ga0075430_100011600 3300006846 Bacteria 7494
44 Ga0075431_100031149 3300006847 Bacteria 5494
45 Ga0068865_100054718 3300006881 Bacteria 2774
46 Ga0105251_10023771 3300009011 Bacteria 3157
47 Ga0105240_10003874 3300009093 Bacteria 23103
48 Ga0114129_10006212 3300009147 Bacteria 16945
49 Ga0105243_10130664 3300009148 Bacteria 2130
50 Ga0105242_10060136 3300009176 Bacteria 3120
51 Ga0105032_100180 3300009979 Bacteria 6509
52 Ga0105029_101135 3300009984 Bacteria 1598
53 Ga0157318_1000231 3300012482 Bacteria 2168
54 Ga0157316_1000311 3300012510 Bacteria 2462
55 Ga0157373_10084279 3300013100 Bacteria 2241
56 Ga0157371_10000154 3300013102 Bacteria 100237
57 Ga0157371_10038439 3300013102 Bacteria 3424
58 Ga0157370_10012228 3300013104 Bacteria 8918
59 Ga0157370_10015401 3300013104 Bacteria 7773
60 Ga0157369_10018886 3300013105 Bacteria 7725
61 Ga0157374_10058523 3300013296 Bacteria 3601
62 Ga0157375_10076949 3300013308 Bacteria 3365
63 Ga0163163_10028239 3300014325 Bacteria 5385
64 Ga0182008_10000142 3300014497 Bacteria 55320
65 Ga0182008_10054080 3300014497 Bacteria 1987
66 Ga0157379_10305136 3300014968 Bacteria 1451
67 Ga0157376_10071718 3300014969 Bacteria 2944
68 Ga0182006_1010608 3300015261 Bacteria 4089
69 Ga0182007_10000287 3300015262 Bacteria 33403
70 Ga0182005_1000388 3300015265 Bacteria 24055
71 Ga0183360_10001 3300015689 Bacteria 3943671
72 Ga0163161_10001348 3300017792 Bacteria 18260
73 Ga0207425_1000030 3300025245 Bacteria 268200
74 Ga0207425_1004388 3300025245 Bacteria 4254
75 Ga0209129_1000063 3300025258 Bacteria 240205
76 Ga0209565_1000048 3300025263 Bacteria 224961
77 Ga0209673_1000001 3300025273 Bacteria 3176258
78 Ga0209673_1003827 3300025273 Bacteria 8520
79 Ga0209130_1003758 3300025284 Bacteria 6196
80 Ga0209675_1000045 3300025291 Bacteria 225750
81 Ga0209676_1008772 3300025292 Bacteria 4456
82 Ga0209025_1000005 3300025294 Bacteria 1272149
83 Ga0209025_1000013 3300025294 Bacteria 871757
84 Ga0209564_1000001 3300025295 Bacteria 3176258
85 Ga0209564_1008181 3300025295 Bacteria 5224
86 Ga0209758_1000014 3300025297 Bacteria 871757
87 Ga0209050_1000603 3300025298 Bacteria 57120
88 Ga0209050_1001888 3300025298 Bacteria 20105
89 Ga0209050_1021058 3300025298 Bacteria 2396
90 Ga0209256_1000002 3300025299 Bacteria 1906740
91 Ga0209256_1002292 3300025299 Bacteria 16094
92 Ga0209256_1004759 3300025299 Bacteria 8282
93 Ga0209256_1016474 3300025299 Bacteria 2516
94 Ga0209257_1000243 3300025304 Bacteria 126291
95 Ga0209257_1001409 3300025304 Bacteria 28685
96 Ga0209257_1004527 3300025304 Bacteria 10673
97 Ga0207713_1044851 3300025735 Bacteria 1811
98 Ga0207647_10159475 3300025904 Bacteria 1316
99 Ga0207699_10155022 3300025906 Bacteria 1519
100 Ga0207695_10020104 3300025913 Bacteria 7660
101 Ga0207695_10239215 3300025913 Bacteria 1717
102 Ga0207657_10025376 3300025919 Bacteria 5466
103 Ga0207649_10189731 3300025920 Bacteria 1444
104 Ga0207652_10051318 3300025921 Bacteria 3536
105 Ga0207681_10005175 3300025923 Bacteria 8010
106 Ga0207690_10072546 3300025932 Bacteria 2378
107 Ga0207709_10001041 3300025935 Bacteria 20489
108 Ga0207691_10001351 3300025940 Bacteria 24456
109 Ga0207691_10171174 3300025940 Bacteria 1902
110 Ga0207661_10184155 3300025944 Bacteria 1827
111 Ga0207679_10117336 3300025945 Bacteria 2112
112 Ga0207651_10031792 3300025960 Bacteria 3380
113 Ga0207668_10056705 3300025972 Bacteria 2729
114 Ga0207668_10121268 3300025972 Bacteria 1980
115 Ga0207639_10066136 3300026041 Bacteria 2808
116 Ga0207676_10078705 3300026095 Bacteria 2671
117 Ga0207674_10123965 3300026116 Bacteria 2549
118 Ga0207683_10077095 3300026121 Bacteria 2952
119 Ga0209371_1000007 3300027312 Bacteria 1050654
120 Ga0209371_1000016 3300027312 Bacteria 646301
121 Ga0209969_1005058 3300027360 Bacteria 1845
122 Ga0209982_1000482 3300027552 Bacteria 4955
123 Ga0209983_1004859 3300027665 Bacteria 2807
124 Ga0209971_1001850 3300027682 Bacteria 5179
125 Ga0209974_10002513 3300027876 Bacteria 6647
126 Ga0209974_10007772 3300027876 Bacteria 3686
127 Ga0209974_10027580 3300027876 Bacteria 1879
128 Ga0268266_10055933 3300028379 Bacteria 3393
129 Ga0307517_10160509 3300028786 Bacteria 1511
130 Ga0268256_1000008 3300030500 Bacteria 1050654
131 Ga0268256_1000015 3300030500 Bacteria 646300
132 Ga0316178_1124434 3300030735 Bacteria 1987
133 Ga0316181_1152677 3300030744 Bacteria 2159
134 Ga0265331_10032289 3300031250 Bacteria 2595
135 Ga0265331_10059241 3300031250 Bacteria 1811
136 Ga0316575_10031254 3300031665 Bacteria 2084
137 Ga0316579_10059477 3300031691 Bacteria 1796
138 Ga0316576_10067989 3300031727 Bacteria 2624
139 Ga0316576_10101793 3300031727 Bacteria 2148
140 Ga0316578_10024662 3300031728 Bacteria 3375
141 Ga0316578_10151089 3300031728 Bacteria 1399
142 Ga0316577_10012906 3300031733 Bacteria 4560
143 Ga0316577_10193897 3300031733 Bacteria 1148
144 Ga0307413_10025883 3300031824 Bacteria 3225
145 Ga0307406_10053789 3300031901 Bacteria 2566
146 Ga0307406_10223259 3300031901 Bacteria 1402
147 Ga0307412_10093492 3300031911 Bacteria 2109
148 Ga0307416_100028791 3300032002 Bacteria 4138
149 Ga0307416_100371858 3300032002 Bacteria 1456
150 Ga0307414_10042265 3300032004 Bacteria 3095
151 Ga0307414_10063045 3300032004 Bacteria 2633
152 Ga0307414_10132152 3300032004 Bacteria 1939
153 Ga0307414_10134887 3300032004 Bacteria 1923
154 Ga0307414_10269206 3300032004 Bacteria 1426
155 Ga0307411_10055649 3300032005 Bacteria 2603
156 Ga0307411_10224951 3300032005 Bacteria 1458
157 Ga0307415_100325121 3300032126 Bacteria 1284
158 Ga0316583_10000574 3300032133 Bacteria 11174
159 Ga0316580_10010932 3300032139 Bacteria 2750
160 Ga0316574_0001191 3300035398 Bacteria 12069
161 Ga0316574_0001600 3300035398 Bacteria 10846
162 Ga0316574_0049202 3300035398 Bacteria 2620
163 Ga0316574_0095285 3300035398 Bacteria 1902
164 Ga0316582_0000848 3300036647 Bacteria 12445
165 Ga0316582_0001504 3300036647 Bacteria 10303
166 Ga0316582_0170337 3300036647 Bacteria 1478
167 Ga0316584_0004963 3300036712 Bacteria 8859
168 Ga0316584_0007391 3300036712 Bacteria 7507
169 Ga0316584_0031766 3300036712 Bacteria 3904
170 Ga0436365_0628467 3300039437 Bacteria 1436
171 Ga0439436_0009432 3300041404 Bacteria 2993
172 Ga0439436_0014449 3300041404 Bacteria 2381
173 Ga0439439_0006645 3300041406 Bacteria 2678
174 Ga0439447_005388 3300041407 Bacteria 4263
175 Ga0439465_0009871 3300041413 Bacteria 3006
176 Ga0439433_0027876 3300041999 Bacteria 1283
177 Ga0439432_045186 3300042006 Bacteria 1386
178 Ga0439449_0000156 3300042007 Bacteria 23254
179 Ga0439449_0004679 3300042007 Bacteria 5287
180 Ga0439449_0010817 3300042007 Bacteria 3444
181 Ga0439449_0015772 3300042007 Bacteria 2840
182 Ga0451577_0000105 3300042876 Bacteria 184360
183 Ga0466969_0031949 3300044656 Bacteria 2678
184 Ga0466966_0004290 3300044684 Bacteria 9402
185 Ga0466961_0083631 3300044693 Bacteria 2019
186 Ga0453684_0003537 3300044712 Bacteria 34947
187 Ga0466957_0063707 3300044842 Bacteria 2267
188 Ga0466957_0129629 3300044842 Bacteria 1615
189 Ga0466959_0037053 3300045049 Bacteria 3603
190 Ga0466959_0360717 3300045049 Bacteria 990
191 Ga0466958_0058567 3300045836 Bacteria 2342
192 Ga0466958_0150896 3300045836 Bacteria 1466
193 Ga0495638_0004889 3300046460 Bacteria 10075
194 Ga0495607_0151690 3300046501 Bacteria 1185
195 Ga0495606_0013802 3300046507 Bacteria 6351
196 Ga0495610_0007451 3300046512 Bacteria 7280
197 Ga0495631_0004101 3300046518 Bacteria 7824
198 Ga0495643_0001695 3300046522 Bacteria 19192
199 Ga0495633_0024212 3300046558 Bacteria 3002
200 Ga0495668_0007035 3300046616 Bacteria 7259
201 Ga0495625_0048182 3300046660 Bacteria 3069
202 Ga0495636_0015719 3300047318 Bacteria 3017
203 Ga0495636_0021659 3300047318 Bacteria 2596
204 Ga0495636_0025838 3300047318 Bacteria 2386
205 Ga0495672_0000073 3300047320 Bacteria 179398
206 Ga0495686_0016393 3300047472 Bacteria 5025
207 Ga0496112_0038440 3300048915 Bacteria 4673
208 Ga0496114_0010365 3300048917 Bacteria 7416
209 Ga0496114_0405146 3300048917 Bacteria 1208
210 Ga0496116_0002061 3300048919 Bacteria 21524
211 Ga0496117_0002324 3300048920 Bacteria 24332
212 Ga0496117_0003747 3300048920 Bacteria 17400
213 Ga0496117_0179665 3300048920 Bacteria 1218
214 Ga0496118_0000344 3300048921 Bacteria 78989
215 Ga0496118_0001379 3300048921 Bacteria 36605
216 Ga0496119_0003326 3300048922 Bacteria 16773
217 Ga0496120_0023755 3300048923 Bacteria 3834
218 Ga0496121_0006284 3300048924 Bacteria 14851
219 Ga0496121_0017375 3300048924 Bacteria 7355
220 Ga0496121_0019877 3300048924 Bacteria 6686
221 Ga0496122_0017650 3300048925 Bacteria 6655
222 Ga0496122_0049521 3300048925 Bacteria 3215
223 Ga0496124_0022778 3300048927 Bacteria 5734
224 Ga0496125_0007804 3300048928 Bacteria 11315
225 Ga0496125_0052603 3300048928 Bacteria 3348
226 Ga0496126_0054742 3300048929 Bacteria 3612
227 Ga0501300_011196 3300049523 Bacteria 1308
228 Ga0501031_0002797 3300049568 Bacteria 11131
229 Ga0501031_0010177 3300049568 Bacteria 6127
230 Ga0501032_0003474 3300049569 Bacteria 12065
231 Ga0501033_0005223 3300049570 Bacteria 10312
232 Ga0501033_0211682 3300049570 Bacteria 1382
233 Ga0501034_0001021 3300049571 Bacteria 40111
234 Ga0501034_0002909 3300049571 Bacteria 19882
235 Ga0501034_0043728 3300049571 Bacteria 4531
236 Ga0501034_0164388 3300049571 Bacteria 2188
237 Ga0501036_0009131 3300049572 Bacteria 8154
238 Ga0501036_0009344 3300049572 Bacteria 8063
239 Ga0501036_0199569 3300049572 Bacteria 1683
240 Ga0501037_0002420 3300049573 Bacteria 13491
241 Ga0501037_0003701 3300049573 Bacteria 11101
242 Ga0501037_0008094 3300049573 Bacteria 7702
243 Ga0501038_0005011 3300049574 Bacteria 12292
244 Ga0501038_0051100 3300049574 Bacteria 3569
245 Ga0501038_0059626 3300049574 Bacteria 3268
246 Ga0501039_0013331 3300049575 Bacteria 6284
247 Ga0501039_0041055 3300049575 Bacteria 3572
248 Ga0501043_0006380 3300049579 Bacteria 9474
249 Ga0501043_0040688 3300049579 Bacteria 3653
250 Ga0501043_0194086 3300049579 Bacteria 1578
251 Ga0501046_0030600 3300049580 Bacteria 4368
252 Ga0501046_0031540 3300049580 Bacteria 4294
253 Ga0501047_0079637 3300049581 Bacteria 3149
254 Ga0501048_0032212 3300049582 Bacteria 3788
255 Ga0501067_0047546 3300049583 Bacteria 2379
256 Ga0501068_0003262 3300049584 Bacteria 8699
257 Ga0501069_0001264 3300049585 Bacteria 12408
258 Ga0501070_0008322 3300049586 Bacteria 8763
259 Ga0501070_0012849 3300049586 Bacteria 7056
260 Ga0501070_0025302 3300049586 Bacteria 4977
261 Ga0501070_0041087 3300049586 Bacteria 3853
262 Ga0501070_0083798 3300049586 Bacteria 2640
263 Ga0501070_0141558 3300049586 Bacteria 1986
264 Ga0501071_0064665 3300049587 Bacteria 2654
265 Ga0501071_0101466 3300049587 Bacteria 2121
266 Ga0501072_0207779 3300049588 Bacteria 1560
267 Ga0501073_0004387 3300049589 Bacteria 10598
268 Ga0501073_0007082 3300049589 Bacteria 8351
269 Ga0501073_0083726 3300049589 Bacteria 2219
270 Ga0501073_0086538 3300049589 Bacteria 2180
271 Ga0501073_0123574 3300049589 Bacteria 1794
272 Ga0501074_0000176 3300049590 Bacteria 34551
273 Ga0501079_0005754 3300049741 Bacteria 9266
274 Ga0501080_0008260 3300049742 Bacteria 9429
275 Ga0501080_0012957 3300049742 Bacteria 7655
276 Ga0501081_0073874 3300049743 Bacteria 2378
277 Ga0501083_0007992 3300049744 Bacteria 7490
278 Ga0501035_0003472 3300049822 Bacteria 15084
279 Ga0501035_0005788 3300049822 Bacteria 11649
280 Ga0501044_0022211 3300049823 Bacteria 6761
281 Ga0501044_0112357 3300049823 Bacteria 2731
282 Ga0501044_0256099 3300049823 Bacteria 1689
283 Ga0501045_0135680 3300049824 Bacteria 1829
284 nmdc:mga00v17_202_c2 3300050491 Bacteria 31082
285 nmdc:mga05p37_2658_c1 3300050507 Bacteria 20814
286 nmdc:mga0qj67_10803_c1 3300050509 Bacteria 6829
287 nmdc:mga0qj67_7764_c1 3300050509 Bacteria 7928
288 Ga0500651_0002382 3300053093 Bacteria 9897
289 Ga0501084_0075474 3300054114 Bacteria 2824
290 Ga0501082_0006658 3300060353 Bacteria 9997
291 Ga0501082_0008064 3300060353 Bacteria 9086
292 2547500028 2547132130 Bacteria 4660562
293 2547500762 2547132130 Bacteria 4660562
294 2578457579 2576861471 Bacteria 4648976
295 2643815274 2643221559 Bacteria 4424915
296 2643879313 2643221573 Bacteria 4784121
297 2643939952 2643221586 Bacteria 4446529
298 2643976186 2643221593 Bacteria 6296053
299 2644077010 2643221612 Bacteria 4361984
300 2644528891 2643221695 Bacteria 3441323
301 2644660612 2643221720 Bacteria 4694283
302 2644695324 2643221727 Bacteria 4415595
303 2644697973 2643221728 Bacteria 4797149
304 2816519054 2816332141 Bacteria 4436036
305 2842394861 2842391507 Bacteria 4486072
306 2852650001 2852649853 Bacteria 4036942
307 2857446973 2857442823 Bacteria 4562550
308 2874222587 2874220319 Bacteria 4594709
309 2894415901 2894414249 Bacteria 4405451
310 2895524458 2895522137 Bacteria 3284416
311 2919090528 2919089067 Bacteria 4560942
312 2919130636 2919130084 Bacteria 5301837
313 2919137543 2919134579 Bacteria 4480386
314 2928498363 2928496128 Bacteria 4631123
315 2929198361 2929195423 Bacteria 5325372
316 2931383956 2931380184 Bacteria 4455911
317 2937614483 2937610967 Bacteria 4618818
318 2939591129 2939589442 Bacteria 4214238
319 2939624623 2939622612 Bacteria 4698046
320 2939628302 2939626828 Bacteria 4695272
321 2941476655 2941475908 Bacteria 4145589
322 2941491146 2941489479 Bacteria 6313767
323 2961049352 2961047084 Bacteria 4594415
324 2961065960 2961064222 Bacteria 4749990
325 2974308205 2974307012 Bacteria 4172388
326 2977248957 2977247770 Bacteria 4160543
327 2984516586 2984514374 Bacteria 4172479
328 2989393254 2989392574 Bacteria 4554005
329 2995952077 2995948881 Bacteria 6358104
330 8003014584 8003014200 Bacteria 4059994
331 Ga0439436_0003435
332 JGI25152J39213_1000548
333 JGI25150J39212_1000114
334 JGI25151J46595_10000100
335 JGI25151J46595_10000128
336 JGI25153J46596_10000071
337 Ga0055526_1000021
338 Ga0055526_1016148
339 Ga0055537_1000141
340 Ga0055524_1000128
341 Ga0055524_1035871
342 Ga0055524_1038705
343 Ga0055534_1000054
344 Ga0055528_1000009
345 Ga0055530_10002002
346 Ga0055530_10012905
347 Ga0055531_10029560
348 Ga0055531_10046642
349 Ga0058692_1000024
350 Ga0065714_10069580
351 Ga0065704_10108834
352 Ga0065704_10122712
353 Ga0070680_100010297
354 Ga0070660_100043227
355 Ga0070661_100163750
356 Ga0070668_100119181
357 Ga0070669_100117131
358 Ga0070671_100055431
359 Ga0070659_100155085
360 Ga0070667_100215910
361 Ga0070681_10009605
362 Ga0068867_100070501
363 Ga0068853_100358185
364 Ga0070672_100004894
365 Ga0070693_100046574
366 Ga0070665_100061606
367 Ga0081539_10080032
368 Ga0075364_10090503
369 Ga0075369_10009077
370 Ga0097621_100078811
371 Ga0097621_100081909
372 Ga0075428_100061097
373 Ga0075430_100011600
374 Ga0075431_100031149
375 Ga0068865_100054718
376 Ga0105251_10023771
377 Ga0105240_10003874
378 Ga0114129_10006212
379 Ga0105243_10130664
380 Ga0105242_10060136
381 Ga0105032_100180
382 Ga0105029_101135
383 Ga0157318_1000231
384 Ga0157316_1000311
385 Ga0157373_10084279
386 Ga0157371_10000154
387 Ga0157371_10038439
388 Ga0157370_10012228
389 Ga0157370_10015401
390 Ga0157369_10018886
391 Ga0157374_10058523
392 Ga0157375_10076949
393 Ga0163163_10028239
394 Ga0182008_10000142
395 Ga0182008_10054080
396 Ga0157379_10305136
397 Ga0157376_10071718
398 Ga0182006_1010608
399 Ga0182007_10000287
400 Ga0182005_1000388
401 Ga0183360_10001
402 Ga0163161_10001348
403 Ga0207425_1000030
404 Ga0207425_1004388
405 Ga0209129_1000063
406 Ga0209565_1000048
407 Ga0209673_1000001
408 Ga0209673_1003827
409 Ga0209130_1003758
410 Ga0209675_1000045
411 Ga0209676_1008772
412 Ga0209025_1000005
413 Ga0209025_1000013
414 Ga0209564_1000001
415 Ga0209564_1008181
416 Ga0209758_1000014
417 Ga0209050_1000603
418 Ga0209050_1001888
419 Ga0209050_1021058
420 Ga0209256_1000002
421 Ga0209256_1002292
422 Ga0209256_1004759
423 Ga0209256_1016474
424 Ga0209257_1000243
425 Ga0209257_1001409
426 Ga0209257_1004527
427 Ga0207713_1044851
428 Ga0207647_10159475
429 Ga0207699_10155022
430 Ga0207695_10020104
431 Ga0207695_10239215
432 Ga0207657_10025376
433 Ga0207649_10189731
434 Ga0207652_10051318
435 Ga0207681_10005175
436 Ga0207690_10072546
437 Ga0207709_10001041
438 Ga0207691_10001351
439 Ga0207691_10171174
440 Ga0207661_10184155
441 Ga0207679_10117336
442 Ga0207651_10031792
443 Ga0207668_10056705
444 Ga0207668_10121268
445 Ga0207639_10066136
446 Ga0207676_10078705
447 Ga0207674_10123965
448 Ga0207683_10077095
449 Ga0209371_1000007
450 Ga0209371_1000016
451 Ga0209969_1005058
452 Ga0209982_1000482
453 Ga0209983_1004859
454 Ga0209971_1001850
455 Ga0209974_10002513
456 Ga0209974_10007772
457 Ga0209974_10027580
458 Ga0268266_10055933
459 Ga0307517_10160509
460 Ga0268256_1000008
461 Ga0268256_1000015
462 Ga0316178_1124434
463 Ga0316181_1152677
464 Ga0265331_10032289
465 Ga0265331_10059241
466 Ga0316575_10031254
467 Ga0316579_10059477
468 Ga0316576_10067989
469 Ga0316576_10101793
470 Ga0316578_10024662
471 Ga0316578_10151089
472 Ga0316577_10012906
473 Ga0316577_10193897
474 Ga0307413_10025883
475 Ga0307406_10053789
476 Ga0307406_10223259
477 Ga0307412_10093492
478 Ga0307416_100028791
479 Ga0307416_100371858
480 Ga0307414_10042265
481 Ga0307414_10063045
482 Ga0307414_10132152
483 Ga0307414_10134887
484 Ga0307414_10269206
485 Ga0307411_10055649
486 Ga0307411_10224951
487 Ga0307415_100325121
488 Ga0316583_10000574
489 Ga0316580_10010932
490 Ga0316574_0001191
491 Ga0316574_0001600
492 Ga0316574_0049202
493 Ga0316574_0095285
494 Ga0316582_0000848
495 Ga0316582_0001504
496 Ga0316582_0170337
497 Ga0316584_0004963
498 Ga0316584_0007391
499 Ga0316584_0031766
500 Ga0436365_0628467
501 Ga0439436_0009432
502 Ga0439436_0014449
503 Ga0439439_0006645
504 Ga0439447_005388
505 Ga0439465_0009871
506 Ga0439433_0027876
507 Ga0439432_045186
508 Ga0439449_0000156
509 Ga0439449_0004679
510 Ga0439449_0010817
511 Ga0439449_0015772
512 Ga0451577_0000105
513 Ga0466969_0031949
514 Ga0466966_0004290
515 Ga0466961_0083631
516 Ga0453684_0003537
517 Ga0466957_0063707
518 Ga0466957_0129629
519 Ga0466959_0037053
520 Ga0466959_0360717
521 Ga0466958_0058567
522 Ga0466958_0150896
523 Ga0495638_0004889
524 Ga0495607_0151690
525 Ga0495606_0013802
526 Ga0495610_0007451
527 Ga0495631_0004101
528 Ga0495643_0001695
529 Ga0495633_0024212
530 Ga0495668_0007035
531 Ga0495625_0048182
532 Ga0495636_0015719
533 Ga0495636_0021659
534 Ga0495636_0025838
535 Ga0495672_0000073
536 Ga0495686_0016393
537 Ga0496112_0038440
538 Ga0496114_0010365
539 Ga0496114_0405146
540 Ga0496116_0002061
541 Ga0496117_0002324
542 Ga0496117_0003747
543 Ga0496117_0179665
544 Ga0496118_0000344
545 Ga0496118_0001379
546 Ga0496119_0003326
547 Ga0496120_0023755
548 Ga0496121_0006284
549 Ga0496121_0017375
550 Ga0496121_0019877
551 Ga0496122_0017650
552 Ga0496122_0049521
553 Ga0496124_0022778
554 Ga0496125_0007804
555 Ga0496125_0052603
556 Ga0496126_0054742
557 Ga0501300_011196
558 Ga0501031_0002797
559 Ga0501031_0010177
560 Ga0501032_0003474
561 Ga0501033_0005223
562 Ga0501033_0211682
563 Ga0501034_0001021
564 Ga0501034_0002909
565 Ga0501034_0043728
566 Ga0501034_0164388
567 Ga0501036_0009131
568 Ga0501036_0009344
569 Ga0501036_0199569
570 Ga0501037_0002420
571 Ga0501037_0003701
572 Ga0501037_0008094
573 Ga0501038_0005011
574 Ga0501038_0051100
575 Ga0501038_0059626
576 Ga0501039_0013331
577 Ga0501039_0041055
578 Ga0501043_0006380
579 Ga0501043_0040688
580 Ga0501043_0194086
581 Ga0501046_0030600
582 Ga0501046_0031540
583 Ga0501047_0079637
584 Ga0501048_0032212
585 Ga0501067_0047546
586 Ga0501068_0003262
587 Ga0501069_0001264
588 Ga0501070_0008322
589 Ga0501070_0012849
590 Ga0501070_0025302
591 Ga0501070_0041087
592 Ga0501070_0083798
593 Ga0501070_0141558
594 Ga0501071_0064665
595 Ga0501071_0101466
596 Ga0501072_0207779
597 Ga0501073_0004387
598 Ga0501073_0007082
599 Ga0501073_0083726
600 Ga0501073_0086538
601 Ga0501073_0123574
602 Ga0501074_0000176
603 Ga0501079_0005754
604 Ga0501080_0008260
605 Ga0501080_0012957
606 Ga0501081_0073874
607 Ga0501083_0007992
608 Ga0501035_0003472
609 Ga0501035_0005788
610 Ga0501044_0022211
611 Ga0501044_0112357
612 Ga0501044_0256099
613 Ga0501045_0135680
614 nmdc:mga00v17_202_c2
615 nmdc:mga05p37_2658_c1
616 nmdc:mga0qj67_10803_c1
617 nmdc:mga0qj67_7764_c1
618 Ga0500651_0002382
619 Ga0501084_0075474
620 Ga0501082_0006658
621 Ga0501082_0008064
622 2547500028
623 2547500762
624 2578457579
625 2643815274
626 2643879313
627 2643939952
628 2643976186
629 2644077010
630 2644528891
631 2644660612
632 2644695324
633 2644697973
634 2816519054
635 2842394861
636 2852650001
637 2857446973
638 2874222587
639 2894415901
640 2895524458
641 2919090528
642 2919130636
643 2919137543
644 2928498363
645 2929198361
646 2931383956
647 2937614483
648 2939591129
649 2939624623
650 2939628302
651 2941476655
652 2941491146
653 2961049352
654 2961065960
655 2974308205
656 2977248957
657 2984516586
658 2989393254
659 2995952077
660 8003014584

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

161

342

0.99

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

27

142

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qz9-assembly2.cif.gz_B-2 crystal structure of aspartate semialdehyde dehydrogenase ii from vibrio cholerae 0.9846 6 342
2r00-assembly2.cif.gz_C-2 crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae 0.9841 6 342
2qz9-assembly2.cif.gz_B-2 crystal structure of aspartate semialdehyde dehydrogenase ii from vibrio cholerae 0.9817 6 342
2r00-assembly2.cif.gz_C-2 crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae 0.9783 6 342
2yv3-assembly1.cif.gz_B crystal structure of aspartate semialdehyde dehydrogenase from thermus thermophilus hb8 0.9715 9 335
ID Description Score Start End Superfamily
2r00C02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9885 132 321 3.30.360.10
af_P08390_5_140_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.986 8 140 3.40.50.720
2yv3B02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9834 132 320 3.30.360.10
2r00C02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9832 132 321 3.30.360.10
af_Q93Y73_167_356_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9785 132 320 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A091AZB7-F1-model_v4 Aspartate-semialdehyde dehydrogenase (ASA dehydrogenase) (ASADH) (EC 1.2.1.11) (Aspartate-beta-semialdehyde dehydrogenase) 0.9985 14 342 GO:0004073
GO:0009088
GO:0009089
GO:0009097
GO:0019877
GO:0046983
GO:0050661
GO:0051287
GO:0071266
AF-A0A7H8WIY3-F1-model_v4 deleted 0.9976 1 340
AF-A0A3D2N058-F1-model_v4 Aspartate-semialdehyde dehydrogenase 0.9975 137 319 GO:0004073
GO:0009085
GO:0009086
GO:0019877
GO:0046983
GO:0050661
AF-A0A3D2JW23-F1-model_v4 Aspartate-semialdehyde dehydrogenase 0.9975 205 335 GO:0004073
GO:0009085
GO:0009086
GO:0019877
GO:0046983
GO:0050661
AF-A0A2W4Y775-F1-model_v4 deleted 0.9974 6 341

Map