F410550

General Info

Members Datasets Scaffolds Average Seq Length
331 254 662 415

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10000676|Ga0307511_100006761
Length 458
Sequence MLSASWMASVRLRISGKIVLDKPSLPQSCRRERASVVQSDRNPVPDIEIYIELQGQMRQVGLARCKRVRGSETITFEYTDEWLDSPDRFSIEPALALTRGVFPPPAGQSIFGAIGDSAPDTWGRRLMQRLERRQAERDRRAVRTLTESDYLLGVSDETRLGALRFRWAGEQTFQAPPRAGVPTLIELGRLMQITERILRDEESDADLQLIFAPGSSLGGARPKASVIDQHGHLSIAKFPKETDEYSMETWEEIALRLAAQAGITTPHHHLLQVAGKAVLLSRRFDRSGLIRIPFLSAMSMTGSKDGERGSYPEIVDALSSHGAQAKADAQSLYRRVVFNVLISNVDDHLRNHGFLWLGRTGWTLSPAYDLNPVPTDLKARILTTNIDLDEGTCSLDLLEAAAEYFSLSLPQARTVIKEVATVTASWREVARNAGAKSSEINRMASAFEHEDLQRALAR

Samples

Sample ID Description Type Environment
1 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
28 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
37 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
38 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
42 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
44 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
45 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
50 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
64 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
65 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
66 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
67 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
68 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
69 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
70 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
71 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
78 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
81 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
82 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
83 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
84 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
85 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
88 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
89 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
90 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
91 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
92 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
93 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
94 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
95 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
96 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
97 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
98 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
99 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
100 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
101 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
104 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
105 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
106 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
109 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
112 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
116 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
117 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
118 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
119 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
120 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
121 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
122 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
130 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
131 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
132 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
135 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
136 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
140 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
150 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
151 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
152 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
153 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
154 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
155 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
156 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
157 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
158 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
159 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
160 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
161 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
162 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
163 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
164 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
165 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
166 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
167 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
168 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
169 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
170 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
171 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
172 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
173 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
174 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
175 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
176 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
177 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
178 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
179 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
180 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
181 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
182 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
183 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
184 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
185 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
186 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
187 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
188 2519899620 Rhizobium sp. Pop5 Isolate Nodule
189 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
190 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
191 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
192 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
193 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
194 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
195 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
196 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
197 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
198 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
199 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
200 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
201 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
202 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
203 2643221610 Ensifer sp. Root74 Isolate Unclassified
204 2643221668 Ensifer sp. Root423 Isolate Unclassified
205 2643221674 Devosia sp. Root436 Isolate Unclassified
206 2643221675 Ensifer sp. Root1298 Isolate Unclassified
207 2643221680 Ensifer sp. Root1312 Isolate Unclassified
208 2643221726 Ensifer sp. Root954 Isolate Unclassified
209 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
210 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
211 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
212 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
213 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
214 2791355266 Rhizobium sp. L43 Isolate Nodule
215 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
216 2818991435 Caulobacter henricii 536 Isolate Unclassified
217 2818991467 Bosea vestrisii 3192 Isolate Unclassified
218 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
219 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
220 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
221 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
222 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
223 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
224 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
225 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
226 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
227 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
228 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
229 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
230 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
231 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
232 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
233 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
234 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
235 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
236 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
237 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
238 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
239 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
240 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
241 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
242 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
243 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
244 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
245 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
246 2996887358 Rhizobium sp. R711 Isolate Nodule
247 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
248 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
249 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
250 8005321885 Rhizobium sp. R72 Isolate Nodule
251 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
252 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
253 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
254 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.92
Metatranscriptomes 0
Isolates 25.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.41
Nodule 16.01
Rhizoplane 1.81
Rhizosphere 49.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307511_10000676 3300030521 Bacteria 36300
2 SwRhRL2b_contig_1774094 2162886007 Bacteria 26398
3 JGI24735J21928_10005095 3300002067 Bacteria 4374
4 JGI25157J39369_1000369 3300002741 Bacteria 30974
5 JGI25157J39369_1000874 3300002741 Bacteria 14553
6 Ga0055526_1002542 3300003771 Bacteria 12248
7 Ga0055526_1003128 3300003771 Bacteria 10719
8 Ga0055526_1026146 3300003771 Bacteria 1851
9 Ga0055524_1017678 3300003775 Bacteria 2507
10 Ga0055528_1000248 3300003790 Bacteria 45559
11 Ga0055528_1000754 3300003790 Bacteria 22574
12 Ga0055528_1009939 3300003790 Bacteria 3922
13 Ga0055531_10000106 3300003794 Bacteria 91868
14 Ga0065165_1006133 3300005262 Bacteria 6430
15 Ga0065704_10070267 3300005289 Bacteria 43544
16 Ga0070658_10143665 3300005327 Bacteria 1994
17 Ga0070659_100163329 3300005366 Bacteria 1822
18 Ga0070713_100281042 3300005436 Bacteria 1527
19 Ga0070698_100029197 3300005471 Bacteria 5724
20 Ga0070697_100082913 3300005536 Bacteria 2644
21 Ga0068855_100226808 3300005563 Bacteria 2093
22 Ga0068859_100180890 3300005617 Bacteria 2191
23 Ga0068860_100222728 3300005843 Bacteria 1832
24 Ga0081455_10003107 3300005937 Bacteria 19320
25 Ga0070717_10005818 3300006028 Bacteria 9030
26 Ga0075364_10000203 3300006051 Bacteria 27794
27 Ga0075364_10051282 3300006051 Bacteria 2694
28 Ga0070712_100014511 3300006175 Bacteria 5056
29 Ga0097620_100180894 3300006931 Bacteria 2191
30 Ga0105240_10065958 3300009093 Bacteria 4493
31 Ga0105240_10067178 3300009093 Bacteria 4445
32 Ga0105240_10093921 3300009093 Bacteria 3660
33 Ga0105245_10424917 3300009098 Bacteria 1333
34 Ga0105248_10247166 3300009177 Bacteria 2008
35 Ga0123340_1036410 3300009763 Bacteria 2572
36 Ga0123341_1046854 3300009765 Bacteria 2572
37 Ga0105239_10005903 3300010375 Bacteria 14266
38 Ga0157371_10053274 3300013102 Bacteria 2873
39 Ga0157371_10185862 3300013102 Bacteria 1487
40 Ga0157370_10018241 3300013104 Bacteria 7060
41 Ga0157370_10182361 3300013104 Bacteria 1951
42 Ga0157369_10001156 3300013105 Bacteria 32916
43 Ga0157369_10007218 3300013105 Bacteria 12804
44 Ga0157369_10190815 3300013105 Bacteria 2153
45 Ga0171463_1016 3300013249 Bacteria 62129
46 Ga0157374_10000107 3300013296 Bacteria 75925
47 Ga0182008_10023918 3300014497 Bacteria 3113
48 Ga0182006_1000005 3300015261 Bacteria 621201
49 Ga0182007_10006577 3300015262 Bacteria 4981
50 Ga0183363_1064 3300015690 Bacteria 33282
51 Ga0163161_10015544 3300017792 Bacteria 5307
52 Ga0209672_102712 3300025228 Bacteria 4108
53 Ga0209026_1000002 3300025250 Bacteria 1136158
54 Ga0209026_1000023 3300025250 Bacteria 357521
55 Ga0209148_1001123 3300025254 Bacteria 15827
56 Ga0209759_1000201 3300025256 Bacteria 94126
57 Ga0209759_1000325 3300025256 Bacteria 62758
58 Ga0209759_1014274 3300025256 Bacteria 2110
59 Ga0209129_1000424 3300025258 Bacteria 32069
60 Ga0209673_1000351 3300025273 Bacteria 84009
61 Ga0209673_1000708 3300025273 Bacteria 47031
62 Ga0209564_1000370 3300025295 Bacteria 83874
63 Ga0209564_1000727 3300025295 Bacteria 47031
64 Ga0209758_1004953 3300025297 Bacteria 10670
65 Ga0209256_1000349 3300025299 Bacteria 75062
66 Ga0209256_1001167 3300025299 Bacteria 29678
67 Ga0207426_1000968 3300025302 Bacteria 28326
68 Ga0209051_1000192 3300025303 Bacteria 108667
69 Ga0209051_1019012 3300025303 Bacteria 3016
70 Ga0209257_1000300 3300025304 Bacteria 108786
71 Ga0207710_10058451 3300025900 Bacteria 1743
72 Ga0207647_10000108 3300025904 Bacteria 63172
73 Ga0207705_10003468 3300025909 Bacteria 11992
74 Ga0207705_10051668 3300025909 Bacteria 2958
75 Ga0207695_10100728 3300025913 Bacteria 2884
76 Ga0207649_10010411 3300025920 Bacteria 5110
77 Ga0207700_10095999 3300025928 Bacteria 2353
78 Ga0207667_10003639 3300025949 Bacteria 19000
79 Ga0207667_10069619 3300025949 Bacteria 3662
80 Ga0207678_10072012 3300026067 Bacteria 2962
81 Ga0209371_1007253 3300027312 Bacteria 3902
82 Ga0268266_10070434 3300028379 Bacteria 3030
83 Ga0268264_10190779 3300028381 Bacteria 1868
84 Ga0307517_10000677 3300028786 Bacteria 58559
85 Ga0307515_10219437 3300028794 Bacteria 1724
86 Ga0268256_1003608 3300030500 Bacteria 6889
87 Ga0265330_10036684 3300031235 Bacteria 2184
88 Ga0307509_10000019 3300031507 Bacteria 256151
89 Ga0265313_10007478 3300031595 Bacteria 7452
90 Ga0265314_10020538 3300031711 Bacteria 5098
91 Ga0307516_10003144 3300031730 Bacteria 21485
92 Ga0373956_0010060 3300035119 Bacteria 3861
93 Ga0373937_0000611 3300036401 Bacteria 31552
94 Ga0395900_0001667 3300037418 Bacteria 25970
95 Ga0395900_0088537 3300037418 Bacteria 3183
96 Ga0395898_0010676 3300037466 Bacteria 9596
97 Ga0395898_0012627 3300037466 Bacteria 8732
98 Ga0395905_0000076 3300037471 Bacteria 164190
99 Ga0395905_0082301 3300037471 Bacteria 3017
100 Ga0395901_0000095 3300038443 Bacteria 119290
101 Ga0400490_28764 3300038726 Bacteria 4865
102 Ga0400483_270478 3300039062 Bacteria 3490
103 Ga0400483_283596 3300039062 Bacteria 1971
104 Ga0436365_1842415 3300039437 Bacteria 4088
105 Ga0450908_000157 3300042184 Bacteria 14169
106 Ga0466969_0023083 3300044656 Bacteria 3208
107 Ga0466961_0000195 3300044693 Bacteria 40831
108 Ga0466961_0026040 3300044693 Bacteria 3760
109 Ga0466970_0011704 3300044765 Bacteria 4475
110 Ga0466957_0003807 3300044842 Bacteria 8339
111 Ga0466957_0048009 3300044842 Bacteria 2595
112 Ga0466959_0008943 3300045049 Bacteria 7104
113 Ga0466959_0012394 3300045049 Bacteria 6159
114 Ga0466958_0001035 3300045836 Bacteria 12709
115 Ga0466958_0012427 3300045836 Bacteria 4824
116 Ga0495627_001849 3300046453 Bacteria 11224
117 Ga0495638_0000181 3300046460 Bacteria 96473
118 Ga0495650_0001261 3300046471 Bacteria 26122
119 Ga0495650_0002217 3300046471 Bacteria 16356
120 Ga0495605_0001214 3300046474 Bacteria 17178
121 Ga0495584_0005614 3300046491 Bacteria 6633
122 Ga0495585_0000780 3300046492 Bacteria 28158
123 Ga0495585_0003663 3300046492 Bacteria 10269
124 Ga0495585_0116609 3300046492 Bacteria 1416
125 Ga0495607_0088044 3300046501 Bacteria 1688
126 Ga0495606_0000469 3300046507 Bacteria 66319
127 Ga0495606_0001432 3300046507 Bacteria 32015
128 Ga0495606_0013217 3300046507 Bacteria 6548
129 Ga0495606_0016244 3300046507 Bacteria 5684
130 Ga0495610_0019085 3300046512 Bacteria 3848
131 Ga0495610_0045479 3300046512 Bacteria 2172
132 Ga0495616_0000001 3300046513 Bacteria 780061
133 Ga0495620_0000107 3300046515 Bacteria 66810
134 Ga0495620_0034928 3300046515 Bacteria 2267
135 Ga0495631_0000137 3300046518 Bacteria 49790
136 Ga0495631_0008042 3300046518 Bacteria 5330
137 Ga0495632_0000386 3300046519 Bacteria 42002
138 Ga0495632_0001321 3300046519 Bacteria 20869
139 Ga0495632_0028500 3300046519 Bacteria 2914
140 Ga0495637_0003943 3300046520 Bacteria 7769
141 Ga0495643_0002837 3300046522 Bacteria 13193
142 Ga0495648_0000798 3300046524 Bacteria 33314
143 Ga0495648_0004341 3300046524 Bacteria 12145
144 Ga0495663_0000103 3300046525 Bacteria 34647
145 Ga0495642_0032190 3300046528 Bacteria 2103
146 Ga0495654_0000835 3300046530 Bacteria 23370
147 Ga0495609_0002727 3300046538 Bacteria 10653
148 Ga0495633_0000506 3300046558 Bacteria 39306
149 Ga0495668_0005072 3300046616 Bacteria 9065
150 Ga0495611_0000068 3300046648 Bacteria 71983
151 Ga0495611_0000281 3300046648 Bacteria 34801
152 Ga0495625_0002122 3300046660 Bacteria 22125
153 Ga0495625_0009695 3300046660 Bacteria 8021
154 Ga0495625_0013585 3300046660 Bacteria 6534
155 Ga0495625_0017073 3300046660 Bacteria 5689
156 Ga0495661_0000885 3300046665 Bacteria 27597
157 Ga0495588_0001166 3300046674 Bacteria 11322
158 Ga0495588_0003245 3300046674 Bacteria 7054
159 Ga0495588_0036626 3300046674 Bacteria 2489
160 Ga0495588_0050707 3300046674 Bacteria 2136
161 Ga0495658_0015955 3300046683 Bacteria 3863
162 Ga0495613_0006751 3300046689 Bacteria 8570
163 Ga0495670_0001020 3300046691 Bacteria 13600
164 Ga0495670_0003862 3300046691 Bacteria 7359
165 Ga0495671_0001235 3300046692 Bacteria 17511
166 Ga0495649_0005050 3300046694 Bacteria 8478
167 Ga0495649_0049083 3300046694 Bacteria 2293
168 Ga0495660_0000357 3300046810 Bacteria 40440
169 Ga0495660_0009953 3300046810 Bacteria 5534
170 Ga0495687_000105 3300047443 Bacteria 128239
171 Ga0495687_003328 3300047443 Bacteria 11775
172 Ga0495677_0033514 3300047445 Bacteria 1872
173 Ga0495673_0000001 3300047469 Bacteria 1630730
174 Ga0495673_0000229 3300047469 Bacteria 82319
175 Ga0495673_0027409 3300047469 Bacteria 2713
176 Ga0495681_0000657 3300047470 Bacteria 26280
177 Ga0495681_0000663 3300047470 Bacteria 26140
178 Ga0495681_0015476 3300047470 Bacteria 4313
179 Ga0495686_0000115 3300047472 Bacteria 166876
180 Ga0495686_0000500 3300047472 Bacteria 57459
181 Ga0495686_0007132 3300047472 Bacteria 8416
182 Ga0495686_0034085 3300047472 Bacteria 3281
183 Ga0496102_0045408 3300048905 Bacteria 3989
184 Ga0496102_0125960 3300048905 Bacteria 2394
185 Ga0496104_0022128 3300048907 Bacteria 5842
186 Ga0496108_0335268 3300048911 Bacteria 1319
187 Ga0496113_0242167 3300048916 Bacteria 1439
188 Ga0496114_0126386 3300048917 Bacteria 2204
189 Ga0496117_0001184 3300048920 Bacteria 39200
190 Ga0496117_0031413 3300048920 Bacteria 4054
191 Ga0496118_0000005 3300048921 Bacteria 697350
192 Ga0496119_0009970 3300048922 Bacteria 8055
193 Ga0496119_0016870 3300048922 Bacteria 5525
194 Ga0496119_0047753 3300048922 Bacteria 2660
195 Ga0496120_0008706 3300048923 Bacteria 7309
196 Ga0496120_0009493 3300048923 Bacteria 6892
197 Ga0496121_0000115 3300048924 Bacteria 178411
198 Ga0496121_0000905 3300048924 Bacteria 53422
199 Ga0496121_0005507 3300048924 Bacteria 16184
200 Ga0496121_0039346 3300048924 Bacteria 4170
201 Ga0496122_0035767 3300048925 Bacteria 4032
202 Ga0496122_0100507 3300048925 Bacteria 1935
203 Ga0496123_0022809 3300048926 Bacteria 4810
204 Ga0496124_0021446 3300048927 Bacteria 5951
205 Ga0496124_0073817 3300048927 Bacteria 2821
206 Ga0496125_0012800 3300048928 Bacteria 8294
207 Ga0496125_0047754 3300048928 Bacteria 3575
208 Ga0496126_0033286 3300048929 Bacteria 4849
209 Ga0495678_000295 3300049459 Bacteria 54788
210 Ga0495682_0001413 3300049460 Bacteria 13055
211 Ga0495682_0002614 3300049460 Bacteria 8443
212 Ga0501033_0033386 3300049570 Bacteria 3863
213 Ga0501034_0047573 3300049571 Bacteria 4331
214 Ga0501034_0144387 3300049571 Bacteria 2358
215 Ga0501034_0184201 3300049571 Bacteria 2052
216 Ga0501036_0060874 3300049572 Bacteria 3197
217 Ga0501038_0045651 3300049574 Bacteria 3802
218 Ga0501046_0206977 3300049580 Bacteria 1458
219 Ga0501047_0171957 3300049581 Bacteria 2035
220 Ga0501035_0013973 3300049822 Bacteria 7407
221 Ga0501044_0045501 3300049823 Bacteria 4546
222 Ga0501044_0174714 3300049823 Bacteria 2118
223 nmdc:mga00v17_85_c1 3300050491 Bacteria 57269
224 nmdc:mga0yw44_75078_c1 3300050492 Bacteria 2107
225 Ga0500583_0000177 3300053092 Bacteria 26206
226 Ga0500555_001967 3300053103 Bacteria 6076
227 Ga0500556_0002969 3300053104 Bacteria 5123
228 Ga0500560_002483 3300053107 Bacteria 3535
229 Ga0500569_011224 3300053109 Bacteria 2133
230 Ga0500594_0004677 3300053118 Bacteria 3022
231 Ga0500597_003762 3300053120 Bacteria 4557
232 Ga0500608_000553 3300053122 Bacteria 14006
233 Ga0500568_0001853 3300053139 Bacteria 13012
234 Ga0500573_0032019 3300053140 Bacteria 3034
235 Ga0500574_000032 3300053141 Bacteria 18144
236 Ga0500588_0001160 3300053146 Bacteria 4855
237 Ga0500604_0008048 3300053151 Bacteria 2797
238 Ga0500616_0000720 3300053153 Bacteria 38307
239 Ga0500616_0002538 3300053153 Bacteria 15079
240 Ga0500619_005440 3300053154 Bacteria 2842
241 Ga0500622_0010051 3300053156 Bacteria 5213
242 Ga0500638_000187 3300053162 Bacteria 12623
243 Ga0500639_012579 3300053163 Bacteria 4444
244 Ga0500636_0031330 3300053177 Bacteria 3148
245 Ga0500636_0054564 3300053177 Bacteria 2342
246 Ga0500637_0001044 3300053178 Bacteria 11380
247 Ga0500625_006560 3300053729 Bacteria 4967
248 Ga0500645_001731 3300053730 Bacteria 10582
249 2501076674 2501025501 Bacteria 7768574
250 2503204274 2503198000 Bacteria 6884444
251 2509398609 2509276022 Bacteria 6200534
252 2509445154 2509276033 Bacteria 7180565
253 2509446531 2509276033 Bacteria 7180565
254 2511096842 2510917014 Bacteria 8296963
255 2511102502 2510917015 Bacteria 7950052
256 2511183003 2510917028 Bacteria 6185411
257 2512345710 2512047030 Bacteria 9031815
258 2513553886 2513237082 Bacteria 8640282
259 2513563134 2513237083 Bacteria 8410967
260 2513597440 2513237088 Bacteria 6927906
261 2513659730 2513237096 Bacteria 8722461
262 2513921751 2513237145 Bacteria 8979722
263 2514039218 2513237164 Bacteria 7563725
264 2517894328 2517572143 Bacteria 9484767
265 2520375857 2519899620 Bacteria 6499161
266 2530649344 2529292951 Bacteria 6916614
267 2535518193 2534681796 Bacteria 7146037
268 2585169836 2582581283 Bacteria 6030556
269 2585275712 2582581307 Bacteria 6597605
270 2585281725 2582581308 Bacteria 7413247
271 2585334802 2582581316 Bacteria 7774528
272 2585534377 2585427527 Bacteria 7273426
273 2585553923 2585427530 Bacteria 7383882
274 2585563665 2585427531 Bacteria 6992870
275 2585897363 2585427608 Bacteria 6544331
276 2585908944 2585427609 Bacteria 6667127
277 2587984267 2585428125 Bacteria 6662905
278 2595446280 2593339238 Bacteria 4182970
279 2617382245 2617270742 Bacteria 6808054
280 2644066815 2643221610 Bacteria 7480339
281 2644381260 2643221668 Bacteria 7306521
282 2644413923 2643221674 Bacteria 3919126
283 2644417761 2643221675 Bacteria 7473456
284 2644451037 2643221680 Bacteria 7473610
285 2644691744 2643221726 Bacteria 7455827
286 2725946992 2724679232 Bacteria 7646494
287 2739034477 2738541333 Bacteria 7106503
288 2778177984 2775507266 Bacteria 7392367
289 2787507536 2786546548 Bacteria 4745694
290 2793316683 2791355259 Bacteria 7254731
291 2793364050 2791355266 Bacteria 7116587
292 2805937636 2802429606 Bacteria 6346811
293 2819536166 2818991435 Bacteria 5433759
294 2819718916 2818991467 Bacteria 5893227
295 2841961726 2841957949 Bacteria 8652217
296 2842290139 2842285085 Bacteria 6011953
297 2842407873 2842402390 Bacteria 6681310
298 2842414715 2842409023 Bacteria 6687331
299 2842421104 2842415677 Bacteria 6596907
300 2871501000 2871495908 Bacteria 6935695
301 2878765037 2878760144 Bacteria 6823465
302 2878772189 2878767105 Bacteria 6898628
303 2885390181 2885383462 Bacteria 9473874
304 2888387362 2888378607 Bacteria 9652610
305 2903545817 2903540706 Bacteria 7062119
306 2908740172 2908739725 Bacteria 8628932
307 2917555459 2917554339 Bacteria 4987857
308 2923560346 2923556063 Bacteria 6793593
309 2929202902 2929199973 Bacteria 7260745
310 2935637277 2935630451 Bacteria 8169952
311 2937829523 2937822353 Bacteria 7290551
312 2937999667 2937994558 Bacteria 7036190
313 2941513990 2941507105 Bacteria 8166816
314 2941521951 2941515067 Bacteria 8166720
315 2941529620 2941523033 Bacteria 8169134
316 2958170138 2958165035 Bacteria 6906348
317 2961168591 2961163497 Bacteria 6901077
318 2965023413 2965018300 Bacteria 6883036
319 2968177003 2968171901 Bacteria 6894245
320 2970559885 2970554993 Bacteria 6814252
321 2977871343 2977864932 Bacteria 7534097
322 2987664619 2987659509 Bacteria 6966464
323 2996888070 2996887358 Bacteria 5795980
324 3004193671 3004188549 Bacteria 6952365
325 649875479 649633066 Bacteria 6690028
326 8003955202 8003955200 Bacteria 8601927
327 8005322597 8005321885 Bacteria 5795980
328 8006970623 8006964411 Bacteria 8966052
329 8006992863 8006984368 Bacteria 9651211
330 8007001072 8006994254 Bacteria 8309700
331 8057880105 8057874678 Bacteria 7494653
332 Ga0307511_10000676
333 SwRhRL2b_contig_1774094
334 JGI24735J21928_10005095
335 JGI25157J39369_1000369
336 JGI25157J39369_1000874
337 Ga0055526_1002542
338 Ga0055526_1003128
339 Ga0055526_1026146
340 Ga0055524_1017678
341 Ga0055528_1000248
342 Ga0055528_1000754
343 Ga0055528_1009939
344 Ga0055531_10000106
345 Ga0065165_1006133
346 Ga0065704_10070267
347 Ga0070658_10143665
348 Ga0070659_100163329
349 Ga0070713_100281042
350 Ga0070698_100029197
351 Ga0070697_100082913
352 Ga0068855_100226808
353 Ga0068859_100180890
354 Ga0068860_100222728
355 Ga0081455_10003107
356 Ga0070717_10005818
357 Ga0075364_10000203
358 Ga0075364_10051282
359 Ga0070712_100014511
360 Ga0097620_100180894
361 Ga0105240_10065958
362 Ga0105240_10067178
363 Ga0105240_10093921
364 Ga0105245_10424917
365 Ga0105248_10247166
366 Ga0123340_1036410
367 Ga0123341_1046854
368 Ga0105239_10005903
369 Ga0157371_10053274
370 Ga0157371_10185862
371 Ga0157370_10018241
372 Ga0157370_10182361
373 Ga0157369_10001156
374 Ga0157369_10007218
375 Ga0157369_10190815
376 Ga0171463_1016
377 Ga0157374_10000107
378 Ga0182008_10023918
379 Ga0182006_1000005
380 Ga0182007_10006577
381 Ga0183363_1064
382 Ga0163161_10015544
383 Ga0209672_102712
384 Ga0209026_1000002
385 Ga0209026_1000023
386 Ga0209148_1001123
387 Ga0209759_1000201
388 Ga0209759_1000325
389 Ga0209759_1014274
390 Ga0209129_1000424
391 Ga0209673_1000351
392 Ga0209673_1000708
393 Ga0209564_1000370
394 Ga0209564_1000727
395 Ga0209758_1004953
396 Ga0209256_1000349
397 Ga0209256_1001167
398 Ga0207426_1000968
399 Ga0209051_1000192
400 Ga0209051_1019012
401 Ga0209257_1000300
402 Ga0207710_10058451
403 Ga0207647_10000108
404 Ga0207705_10003468
405 Ga0207705_10051668
406 Ga0207695_10100728
407 Ga0207649_10010411
408 Ga0207700_10095999
409 Ga0207667_10003639
410 Ga0207667_10069619
411 Ga0207678_10072012
412 Ga0209371_1007253
413 Ga0268266_10070434
414 Ga0268264_10190779
415 Ga0307517_10000677
416 Ga0307515_10219437
417 Ga0268256_1003608
418 Ga0265330_10036684
419 Ga0307509_10000019
420 Ga0265313_10007478
421 Ga0265314_10020538
422 Ga0307516_10003144
423 Ga0373956_0010060
424 Ga0373937_0000611
425 Ga0395900_0001667
426 Ga0395900_0088537
427 Ga0395898_0010676
428 Ga0395898_0012627
429 Ga0395905_0000076
430 Ga0395905_0082301
431 Ga0395901_0000095
432 Ga0400490_28764
433 Ga0400483_270478
434 Ga0400483_283596
435 Ga0436365_1842415
436 Ga0450908_000157
437 Ga0466969_0023083
438 Ga0466961_0000195
439 Ga0466961_0026040
440 Ga0466970_0011704
441 Ga0466957_0003807
442 Ga0466957_0048009
443 Ga0466959_0008943
444 Ga0466959_0012394
445 Ga0466958_0001035
446 Ga0466958_0012427
447 Ga0495627_001849
448 Ga0495638_0000181
449 Ga0495650_0001261
450 Ga0495650_0002217
451 Ga0495605_0001214
452 Ga0495584_0005614
453 Ga0495585_0000780
454 Ga0495585_0003663
455 Ga0495585_0116609
456 Ga0495607_0088044
457 Ga0495606_0000469
458 Ga0495606_0001432
459 Ga0495606_0013217
460 Ga0495606_0016244
461 Ga0495610_0019085
462 Ga0495610_0045479
463 Ga0495616_0000001
464 Ga0495620_0000107
465 Ga0495620_0034928
466 Ga0495631_0000137
467 Ga0495631_0008042
468 Ga0495632_0000386
469 Ga0495632_0001321
470 Ga0495632_0028500
471 Ga0495637_0003943
472 Ga0495643_0002837
473 Ga0495648_0000798
474 Ga0495648_0004341
475 Ga0495663_0000103
476 Ga0495642_0032190
477 Ga0495654_0000835
478 Ga0495609_0002727
479 Ga0495633_0000506
480 Ga0495668_0005072
481 Ga0495611_0000068
482 Ga0495611_0000281
483 Ga0495625_0002122
484 Ga0495625_0009695
485 Ga0495625_0013585
486 Ga0495625_0017073
487 Ga0495661_0000885
488 Ga0495588_0001166
489 Ga0495588_0003245
490 Ga0495588_0036626
491 Ga0495588_0050707
492 Ga0495658_0015955
493 Ga0495613_0006751
494 Ga0495670_0001020
495 Ga0495670_0003862
496 Ga0495671_0001235
497 Ga0495649_0005050
498 Ga0495649_0049083
499 Ga0495660_0000357
500 Ga0495660_0009953
501 Ga0495687_000105
502 Ga0495687_003328
503 Ga0495677_0033514
504 Ga0495673_0000001
505 Ga0495673_0000229
506 Ga0495673_0027409
507 Ga0495681_0000657
508 Ga0495681_0000663
509 Ga0495681_0015476
510 Ga0495686_0000115
511 Ga0495686_0000500
512 Ga0495686_0007132
513 Ga0495686_0034085
514 Ga0496102_0045408
515 Ga0496102_0125960
516 Ga0496104_0022128
517 Ga0496108_0335268
518 Ga0496113_0242167
519 Ga0496114_0126386
520 Ga0496117_0001184
521 Ga0496117_0031413
522 Ga0496118_0000005
523 Ga0496119_0009970
524 Ga0496119_0016870
525 Ga0496119_0047753
526 Ga0496120_0008706
527 Ga0496120_0009493
528 Ga0496121_0000115
529 Ga0496121_0000905
530 Ga0496121_0005507
531 Ga0496121_0039346
532 Ga0496122_0035767
533 Ga0496122_0100507
534 Ga0496123_0022809
535 Ga0496124_0021446
536 Ga0496124_0073817
537 Ga0496125_0012800
538 Ga0496125_0047754
539 Ga0496126_0033286
540 Ga0495678_000295
541 Ga0495682_0001413
542 Ga0495682_0002614
543 Ga0501033_0033386
544 Ga0501034_0047573
545 Ga0501034_0144387
546 Ga0501034_0184201
547 Ga0501036_0060874
548 Ga0501038_0045651
549 Ga0501046_0206977
550 Ga0501047_0171957
551 Ga0501035_0013973
552 Ga0501044_0045501
553 Ga0501044_0174714
554 nmdc:mga00v17_85_c1
555 nmdc:mga0yw44_75078_c1
556 Ga0500583_0000177
557 Ga0500555_001967
558 Ga0500556_0002969
559 Ga0500560_002483
560 Ga0500569_011224
561 Ga0500594_0004677
562 Ga0500597_003762
563 Ga0500608_000553
564 Ga0500568_0001853
565 Ga0500573_0032019
566 Ga0500574_000032
567 Ga0500588_0001160
568 Ga0500604_0008048
569 Ga0500616_0000720
570 Ga0500616_0002538
571 Ga0500619_005440
572 Ga0500622_0010051
573 Ga0500638_000187
574 Ga0500639_012579
575 Ga0500636_0031330
576 Ga0500636_0054564
577 Ga0500637_0001044
578 Ga0500625_006560
579 Ga0500645_001731
580 2501076674
581 2503204274
582 2509398609
583 2509445154
584 2509446531
585 2511096842
586 2511102502
587 2511183003
588 2512345710
589 2513553886
590 2513563134
591 2513597440
592 2513659730
593 2513921751
594 2514039218
595 2517894328
596 2520375857
597 2530649344
598 2535518193
599 2585169836
600 2585275712
601 2585281725
602 2585334802
603 2585534377
604 2585553923
605 2585563665
606 2585897363
607 2585908944
608 2587984267
609 2595446280
610 2617382245
611 2644066815
612 2644381260
613 2644413923
614 2644417761
615 2644451037
616 2644691744
617 2725946992
618 2739034477
619 2778177984
620 2787507536
621 2793316683
622 2793364050
623 2805937636
624 2819536166
625 2819718916
626 2841961726
627 2842290139
628 2842407873
629 2842414715
630 2842421104
631 2871501000
632 2878765037
633 2878772189
634 2885390181
635 2888387362
636 2903545817
637 2908740172
638 2917555459
639 2923560346
640 2929202902
641 2935637277
642 2937829523
643 2937999667
644 2941513990
645 2941521951
646 2941529620
647 2958170138
648 2961168591
649 2965023413
650 2968177003
651 2970559885
652 2977871343
653 2987664619
654 2996888070
655 3004193671
656 649875479
657 8003955202
658 8005322597
659 8006970623
660 8006992863
661 8007001072
662 8057880105

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07804

HipA_C

HipA-like C-terminal domain

215

426

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ab4-assembly1.cif.gz_C crystal structure of the escherichia coli toxin-antitoxin system hipbst (hipt s59a) 0.796 171 412
7vkb-assembly1.cif.gz_A crystal structure of the a bacterial kinase complex 0.7908 183 414
7ab5-assembly1.cif.gz_F crystal structure of the escherichia coli toxin-antitoxin system hipbst (hipt d233q) 0.7662 171 412
7vkc-assembly1.cif.gz_A crystal structure of a bacterial ser/thr kinase 0.7192 137 414
7vkb-assembly1.cif.gz_A crystal structure of the a bacterial kinase complex 0.7079 183 414
ID Description Score Start End Superfamily
3akjB01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; 0.8917 180 244 3.30.200.120
3aklB01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; 0.8078 175 241 3.30.200.120
3akjB01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1; 0.7261 180 244 3.30.200.120
af_Q18055_21_94_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.674 175 238 3.30.200.20
af_Q8JHE0_3_364_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.6719 175 238 1.10.510.10
ID Description Score Start End GO Terms
AF-F0J6V9-F1-model_v4 HipA-like C-terminal domain-containing protein 0.9349 71 413 GO:0004674
GO:0005829
AF-A0A7X4BEP4-F1-model_v4 HipA domain-containing protein 0.9292 202 414 GO:0004674
GO:0005829
AF-A0A838ITJ4-F1-model_v4 HipA domain-containing protein 0.928 169 415 GO:0004674
GO:0005829
AF-A0A2V5UEP0-F1-model_v4 HipA-like C-terminal domain-containing protein 0.9278 180 414 GO:0004674
GO:0005829
AF-A0A5C9DIC1-F1-model_v4 HipA-like C-terminal domain-containing protein 0.9203 102 404 GO:0004674
GO:0005829

Map