F410848

General Info

Members Datasets Scaffolds Average Seq Length
332 166 332 219

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100024220|Ga0070706_1000242207
Length 225
Sequence MNFIIVGCGRVGAELAYRMFKSGHRIVVVDSNKEAFNRLHPDFRGRTLEGEGLAESVLERAGIKEAHGLAAVTNSDTLNAVVAHTARAFYNVPVVVARNYDPSLRMVIEAFGLQTVSSTYWGAQRVEELLTNPSEKMVYSAGNGEVEVYEVVISEAWNGRTLSELLGSLEQCYPVAITRAGRSSLPEATMQLQTGDVLNVSSTFEGIGALSSRLASNSKDKKAEA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
108 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
109 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
110 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
118 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
119 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
120 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
121 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
122 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
123 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
143 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.22
Nodule 0
Rhizoplane 0.3
Rhizosphere 95.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1033251 2162886007 Bacteria 14331
2 JGI25406J46586_10001015 3300003203 Bacteria 13153
3 Ga0065704_10012577 3300005289 Unclassified 2503
4 Ga0065704_10070402 3300005289 Bacteria 26643
5 Ga0065715_10015290 3300005293 Bacteria 1828
6 Ga0065707_10082149 3300005295 Bacteria 20712
7 Ga0065707_10087037 3300005295 Bacteria 5197
8 Ga0065707_10099026 3300005295 Bacteria 3027
9 Ga0065707_10130045 3300005295 Unclassified 1935
10 Ga0070676_10060614 3300005328 Bacteria 2248
11 Ga0070690_100053498 3300005330 Bacteria 2582
12 Ga0068869_100072891 3300005334 Bacteria 2545
13 Ga0068869_100892162 3300005334 Bacteria 769
14 Ga0068868_100015724 3300005338 Bacteria 5605
15 Ga0070689_100068774 3300005340 Unclassified 2762
16 Ga0070689_100083549 3300005340 Bacteria 2509
17 Ga0070687_100050432 3300005343 Bacteria 2149
18 Ga0070692_10100654 3300005345 Unclassified 1583
19 Ga0070668_100021500 3300005347 Bacteria 4874
20 Ga0070674_100003035 3300005356 Bacteria 9339
21 Ga0070673_100019854 3300005364 Bacteria 4834
22 Ga0070688_100002509 3300005365 Bacteria 9281
23 Ga0070659_100158476 3300005366 Bacteria 1850
24 Ga0070667_100091232 3300005367 Bacteria 2620
25 Ga0070703_10079591 3300005406 Unclassified 1113
26 Ga0070701_10137526 3300005438 Unclassified 1394
27 Ga0070705_100007833 3300005440 Bacteria 5276
28 Ga0070705_100076496 3300005440 Bacteria 2041
29 Ga0070700_100126284 3300005441 Bacteria 1720
30 Ga0070700_100196100 3300005441 Unclassified 1415
31 Ga0070694_100051955 3300005444 Bacteria 2769
32 Ga0070694_100096887 3300005444 Unclassified 2080
33 Ga0070694_100124797 3300005444 Bacteria 1852
34 Ga0070708_100065548 3300005445 Bacteria 3257
35 Ga0070663_100014173 3300005455 Bacteria 5111
36 Ga0070662_100220032 3300005457 Unclassified 1515
37 Ga0068867_100014382 3300005459 Bacteria 5607
38 Ga0070685_10174453 3300005466 Unclassified 1380
39 Ga0070706_100011258 3300005467 Bacteria 8307
40 Ga0070706_100024220 3300005467 Bacteria 5587
41 Ga0070706_100348659 3300005467 Unclassified 1380
42 Ga0070706_100711363 3300005467 Unclassified 931
43 Ga0070707_100028571 3300005468 Bacteria 5309
44 Ga0070707_100170528 3300005468 Bacteria 2121
45 Ga0070707_100401330 3300005468 Unclassified 1331
46 Ga0070698_100004210 3300005471 Bacteria 15812
47 Ga0070698_100065401 3300005471 Bacteria 3661
48 Ga0070698_100303795 3300005471 Bacteria 1526
49 Ga0070699_100025951 3300005518 Bacteria 5053
50 Ga0070699_100038062 3300005518 Bacteria 4165
51 Ga0070699_100093526 3300005518 Bacteria 2631
52 Ga0070699_100184954 3300005518 Bacteria 1850
53 Ga0070699_100243604 3300005518 Unclassified 1605
54 Ga0070699_100311929 3300005518 Bacteria 1412
55 Ga0070672_100020205 3300005543 Bacteria 4852
56 Ga0070686_100011661 3300005544 Bacteria 4992
57 Ga0070695_100066847 3300005545 Unclassified 2344
58 Ga0070696_100005760 3300005546 Bacteria 8271
59 Ga0070696_100310638 3300005546 Unclassified 1210
60 Ga0070665_101055429 3300005548 Bacteria 824
61 Ga0070704_100011451 3300005549 Bacteria 5437
62 Ga0070704_100133286 3300005549 Bacteria 1929
63 Ga0070704_100483653 3300005549 Unclassified 1072
64 Ga0068857_100648976 3300005577 Bacteria 1000
65 Ga0068852_100140431 3300005616 Bacteria 2235
66 Ga0068859_100007883 3300005617 Bacteria 10807
67 Ga0068859_100050219 3300005617 Bacteria 4190
68 Ga0068864_100030510 3300005618 Unclassified 4570
69 Ga0068864_100590621 3300005618 Unclassified 1077
70 Ga0068861_100180878 3300005719 Unclassified 1755
71 Ga0068870_10028545 3300005840 Bacteria 2803
72 Ga0068863_100029212 3300005841 Bacteria 5264
73 Ga0068858_100008759 3300005842 Bacteria 9709
74 Ga0068860_100061043 3300005843 Bacteria 3581
75 Ga0068862_100017238 3300005844 Bacteria 6011
76 Ga0068862_100020193 3300005844 Bacteria 5564
77 Ga0068862_100236066 3300005844 Bacteria 1660
78 Ga0068862_100255713 3300005844 Bacteria 1597
79 Ga0081539_10004513 3300005985 Bacteria 15297
80 Ga0081539_10004539 3300005985 Bacteria 15230
81 Ga0075365_10024764 3300006038 Bacteria 3792
82 Ga0075363_100154441 3300006048 Unclassified 1297
83 Ga0075364_10015349 3300006051 Unclassified 4748
84 Ga0075362_10001927 3300006177 Bacteria 6816
85 Ga0075367_10034987 3300006178 Bacteria 2904
86 Ga0075369_10067138 3300006186 Unclassified 1574
87 Ga0075427_10000128 3300006194 Bacteria 6814
88 Ga0075366_10003460 3300006195 Bacteria 8334
89 Ga0075428_100006886 3300006844 Bacteria 12631
90 Ga0075428_100169860 3300006844 Unclassified 2364
91 Ga0075428_100206241 3300006844 Bacteria 2124
92 Ga0075428_100645714 3300006844 Unclassified 1129
93 Ga0075430_100067672 3300006846 Unclassified 2997
94 Ga0075431_100022524 3300006847 Bacteria 6441
95 Ga0075431_100039543 3300006847 Bacteria 4858
96 Ga0075431_100162071 3300006847 Bacteria 2299
97 Ga0075431_100264500 3300006847 Unclassified 1745
98 Ga0075431_100299961 3300006847 Bacteria 1623
99 Ga0075433_10010058 3300006852 Bacteria 7582
100 Ga0075433_10050292 3300006852 Bacteria 3628
101 Ga0075433_10327990 3300006852 Bacteria 1354
102 Ga0075433_10377990 3300006852 Bacteria 1251
103 Ga0075434_100050635 3300006871 Bacteria 4126
104 Ga0075434_100073474 3300006871 Bacteria 3412
105 Ga0075429_100003526 3300006880 Bacteria 13330
106 Ga0075429_100008414 3300006880 Bacteria 8977
107 Ga0075429_100168225 3300006880 Unclassified 1920
108 Ga0075429_100273508 3300006880 Unclassified 1479
109 Ga0075429_100352072 3300006880 Unclassified 1289
110 Ga0075429_100485773 3300006880 Unclassified 1082
111 Ga0097620_100007883 3300006931 Bacteria 10807
112 Ga0097620_100050219 3300006931 Bacteria 4190
113 Ga0075435_100018070 3300007076 Bacteria 5351
114 Ga0111539_10000603 3300009094 Bacteria 46477
115 Ga0111539_10057586 3300009094 Bacteria 4614
116 Ga0105245_10186968 3300009098 Bacteria 1982
117 Ga0114129_10001125 3300009147 Bacteria 35324
118 Ga0114129_10004628 3300009147 Bacteria 19421
119 Ga0114129_10037920 3300009147 Bacteria 6799
120 Ga0114129_10038499 3300009147 Bacteria 6744
121 Ga0114129_10098765 3300009147 Bacteria 4041
122 Ga0114129_10105716 3300009147 Bacteria 3889
123 Ga0114129_10158321 3300009147 Unclassified 3096
124 Ga0114129_10160139 3300009147 Bacteria 3075
125 Ga0114129_10198007 3300009147 Bacteria 2723
126 Ga0114129_11167470 3300009147 Unclassified 961
127 Ga0105243_10011131 3300009148 Bacteria 6806
128 Ga0105243_10039059 3300009148 Bacteria 3699
129 Ga0105243_10041942 3300009148 Archaea 3580
130 Ga0105243_10217677 3300009148 Bacteria 1686
131 Ga0105248_10022141 3300009177 Bacteria 7045
132 Ga0105249_10126810 3300009553 Bacteria 2431
133 Ga0105249_10160318 3300009553 Bacteria 2173
134 Ga0105249_10352911 3300009553 Unclassified 1490
135 Ga0157378_10061001 3300013297 Bacteria 3365
136 Ga0157375_10014556 3300013308 Bacteria 7022
137 Ga0157380_10014948 3300014326 Bacteria 5692
138 Ga0157380_11005191 3300014326 Unclassified 868
139 Ga0157379_10251198 3300014968 Unclassified 1605
140 Ga0163161_10069419 3300017792 Bacteria 2576
141 Ga0207645_10068631 3300025907 Bacteria 2267
142 Ga0207643_10015242 3300025908 Bacteria 4181
143 Ga0207684_10021019 3300025910 Bacteria 5573
144 Ga0207684_10022300 3300025910 Bacteria 5405
145 Ga0207662_10000998 3300025918 Bacteria 13214
146 Ga0207646_10085355 3300025922 Unclassified 2824
147 Ga0207646_10181750 3300025922 Unclassified 1899
148 Ga0207646_10414424 3300025922 Unclassified 1216
149 Ga0207659_10080181 3300025926 Bacteria 2410
150 Ga0207706_10019464 3300025933 Bacteria 6107
151 Ga0207709_10029400 3300025935 Unclassified 3187
152 Ga0207670_10120416 3300025936 Bacteria 1907
153 Ga0207670_10213976 3300025936 Bacteria 1471
154 Ga0207691_10042276 3300025940 Bacteria 4202
155 Ga0207689_10027103 3300025942 Bacteria 4797
156 Ga0207679_10316151 3300025945 Bacteria 1351
157 Ga0207651_10488581 3300025960 Unclassified 1062
158 Ga0207712_10099203 3300025961 Bacteria 2162
159 Ga0207712_10280270 3300025961 Bacteria 1360
160 Ga0207668_10013982 3300025972 Bacteria 4959
161 Ga0207658_10109716 3300025986 Bacteria 2179
162 Ga0207677_10080027 3300026023 Bacteria 2339
163 Ga0207703_10338831 3300026035 Bacteria 1381
164 Ga0207678_10018034 3300026067 Bacteria 6201
165 Ga0207708_10023760 3300026075 Bacteria 4633
166 Ga0207708_10136278 3300026075 Unclassified 1923
167 Ga0207641_10531951 3300026088 Unclassified 1144
168 Ga0207641_10842129 3300026088 Unclassified 909
169 Ga0207648_10001348 3300026089 Bacteria 27180
170 Ga0207676_10303424 3300026095 Unclassified 1459
171 Ga0207674_10212376 3300026116 Bacteria 1884
172 Ga0207674_10397946 3300026116 Bacteria 1331
173 Ga0207675_100078380 3300026118 Bacteria 3096
174 Ga0207675_100148499 3300026118 Unclassified 2230
175 Ga0207683_10019003 3300026121 Bacteria 5864
176 Ga0207698_10332702 3300026142 Unclassified 1427
177 Ga0207428_10000174 3300027907 Bacteria 89762
178 Ga0268265_10054344 3300028380 Bacteria 3038
179 Ga0268265_10155468 3300028380 Bacteria 1934
180 Ga0307408_100407672 3300031548 Unclassified 1169
181 Ga0316575_10009460 3300031665 Unclassified 3570
182 Ga0316579_10001456 3300031691 Bacteria 8604
183 Ga0316579_10107935 3300031691 Bacteria 1335
184 Ga0316576_10068799 3300031727 Bacteria 2610
185 Ga0316577_10117165 3300031733 Bacteria 1496
186 Ga0307410_10169854 3300031852 Unclassified 1642
187 Ga0307410_10326567 3300031852 Bacteria 1219
188 Ga0307407_10050741 3300031903 Bacteria 2375
189 Ga0307412_10297675 3300031911 Bacteria 1274
190 Ga0307412_11012693 3300031911 Unclassified 734
191 Ga0307409_100772341 3300031995 Unclassified 966
192 Ga0307416_100066053 3300032002 Unclassified 2976
193 Ga0307411_10628110 3300032005 Unclassified 927
194 Ga0316585_10066279 3300032137 Bacteria 1170
195 Ga0373940_0095331 3300035088 Unclassified 897
196 Ga0316574_0379640 3300035398 Bacteria 892
197 Ga0316582_0031804 3300036647 Bacteria 3229
198 Ga0316582_0043863 3300036647 Unclassified 2808
199 Ga0316584_0065922 3300036712 Unclassified 2713
200 Ga0316584_0292903 3300036712 Bacteria 1180
201 Ga0316581_0000465 3300037588 Bacteria 7756
202 Ga0439446_0067477 3300042156 Bacteria 1090
203 Ga0451577_0030296 3300042876 Bacteria 4889
204 Ga0451577_0042206 3300042876 Bacteria 4092
205 Ga0451577_0088300 3300042876 Bacteria 2766
206 Ga0451577_0121650 3300042876 Bacteria 2338
207 Ga0451577_0126328 3300042876 Bacteria 2292
208 Ga0451577_0140865 3300042876 Bacteria 2167
209 Ga0451577_0157311 3300042876 Bacteria 2046
210 Ga0451577_0232501 3300042876 Unclassified 1667
211 Ga0451577_0294896 3300042876 Bacteria 1469
212 Ga0451577_0308503 3300042876 Bacteria 1434
213 Ga0451577_0361718 3300042876 Bacteria 1316
214 Ga0453683_0000523 3300044673 Bacteria 43101
215 Ga0453683_0044497 3300044673 Unclassified 2786
216 Ga0453683_0236031 3300044673 Unclassified 1164
217 Ga0453683_0378765 3300044673 Unclassified 911
218 Ga0453683_0582378 3300044673 Unclassified 729
219 Ga0453684_0001487 3300044712 Bacteria 66111
220 Ga0453684_0001638 3300044712 Bacteria 60803
221 Ga0453684_0002811 3300044712 Bacteria 41136
222 Ga0453684_0006097 3300044712 Bacteria 23247
223 Ga0453684_0017807 3300044712 Bacteria 10964
224 Ga0453684_0028334 3300044712 Bacteria 7997
225 Ga0453684_0052223 3300044712 Bacteria 5348
226 Ga0453684_0074149 3300044712 Unclassified 4286
227 Ga0453684_0091254 3300044712 Unclassified 3761
228 Ga0453684_0091802 3300044712 Bacteria 3747
229 Ga0453684_0104923 3300044712 Bacteria 3449
230 Ga0453684_0105312 3300044712 Viruses 3440
231 Ga0453684_0154715 3300044712 Unclassified 2720
232 Ga0453684_0162847 3300044712 Bacteria 2636
233 Ga0453684_0173953 3300044712 Bacteria 2535
234 Ga0453684_0197645 3300044712 Unclassified 2346
235 Ga0453684_0207356 3300044712 Bacteria 2280
236 Ga0453684_0208211 3300044712 Bacteria 2275
237 Ga0453684_0246445 3300044712 Unclassified 2054
238 Ga0453684_0306496 3300044712 Bacteria 1804
239 Ga0453684_0328855 3300044712 Bacteria 1729
240 Ga0453684_0396117 3300044712 Unclassified 1547
241 Ga0453684_0454811 3300044712 Unclassified 1424
242 Ga0453684_0458237 3300044712 Bacteria 1418
243 Ga0453684_0478105 3300044712 Bacteria 1382
244 Ga0453684_0478170 3300044712 Bacteria 1382
245 Ga0453684_0498521 3300044712 Bacteria 1349
246 Ga0453684_0541677 3300044712 Unclassified 1283
247 Ga0453684_0587341 3300044712 Unclassified 1222
248 Ga0453684_0664832 3300044712 Unclassified 1135
249 Ga0453684_0905300 3300044712 Unclassified 944
250 Ga0451576_0008815 3300045051 Bacteria 11785
251 Ga0451576_0026604 3300045051 Bacteria 6221
252 Ga0451576_0027131 3300045051 Bacteria 6155
253 Ga0451576_0033663 3300045051 Bacteria 5446
254 Ga0451576_0039081 3300045051 Bacteria 5022
255 Ga0451576_0146888 3300045051 Bacteria 2458
256 Ga0495656_0052612 3300046615 Bacteria 1747
257 Ga0496106_0144065 3300048909 Bacteria 1876
258 Ga0501031_0200132 3300049568 Unclassified 1303
259 Ga0501036_0295699 3300049572 Unclassified 1354
260 Ga0501039_0284717 3300049575 Unclassified 1299
261 Ga0501041_0156730 3300049577 Unclassified 1423
262 Ga0501042_0079932 3300049578 Unclassified 2343
263 Ga0501046_0289150 3300049580 Unclassified 1199
264 Ga0501048_0194419 3300049582 Unclassified 1438
265 Ga0501048_0352057 3300049582 Unclassified 1050
266 Ga0501072_0111749 3300049588 Unclassified 2175
267 Ga0501072_0321278 3300049588 Unclassified 1230
268 Ga0501074_0590937 3300049590 Unclassified 785
269 Ga0501075_0004325 3300049591 Bacteria 9611
270 Ga0501075_0080437 3300049591 Bacteria 2467
271 Ga0501075_0102834 3300049591 Unclassified 2170
272 Ga0501075_0440892 3300049591 Bacteria 993
273 Ga0501075_0637155 3300049591 Bacteria 813
274 Ga0501076_0001634 3300049592 Bacteria 15122
275 Ga0501076_0017751 3300049592 Bacteria 5410
276 Ga0501076_0245175 3300049592 Bacteria 1466
277 Ga0501076_0738935 3300049592 Bacteria 812
278 Ga0501077_0255786 3300049593 Unclassified 1114
279 Ga0501227_050791 3300049665 Unclassified 1046
280 Ga0501257_054301 3300049686 Bacteria 1004
281 Ga0501079_0180746 3300049741 Unclassified 1646
282 Ga0501079_0731388 3300049741 Unclassified 779
283 Ga0501080_0174576 3300049742 Unclassified 1981
284 Ga0501080_0329733 3300049742 Unclassified 1380
285 Ga0501080_0572535 3300049742 Bacteria 1005
286 Ga0501080_0810237 3300049742 Bacteria 821
287 Ga0501081_0146668 3300049743 Bacteria 1694
288 Ga0501081_0226474 3300049743 Bacteria 1361
289 Ga0501081_0466571 3300049743 Bacteria 939
290 Ga0501044_0967665 3300049823 Unclassified 724
291 Ga0501045_0129221 3300049824 Unclassified 1878
292 nmdc:mga03683_79740_c1 3300050489 Unclassified 1412
293 nmdc:mga00v17_384266_c1 3300050491 Unclassified 913
294 nmdc:mga0yw44_31492_c1 3300050492 Unclassified 3085
295 nmdc:mga0k408_3466_c1 3300050493 Bacteria 8347
296 nmdc:mga06z11_8833_c1 3300050494 Bacteria 4221
297 nmdc:mga04h51_61728_c1 3300050495 Bacteria 1286
298 nmdc:mga05p37_101744_c1 3300050507 Bacteria 3538
299 nmdc:mga05p37_158288_c1 3300050507 Bacteria 2767
300 nmdc:mga05p37_2237_c1 3300050507 Bacteria 22548
301 nmdc:mga05p37_39732_c1 3300050507 Bacteria 5777
302 nmdc:mga05p37_42479_c1 3300050507 Bacteria 5586
303 nmdc:mga05p37_4443_c1 3300050507 Bacteria 16393
304 nmdc:mga05p37_652092_c1 3300050507 Bacteria 1179
305 nmdc:mga05p37_90454_c2 3300050507 Bacteria 2952
306 nmdc:mga09592_143453_c1 3300050508 Unclassified 2059
307 nmdc:mga09592_25117_c1 3300050508 Bacteria 4929
308 nmdc:mga09592_396668_c1 3300050508 Unclassified 1193
309 nmdc:mga09592_471524_c1 3300050508 Unclassified 1082
310 nmdc:mga0qj67_168388_c1 3300050509 Unclassified 1779
311 nmdc:mga06r32_121395_c1 3300050510 Bacteria 2578
312 nmdc:mga06r32_167264_c1 3300050510 Bacteria 2182
313 nmdc:mga06r32_36780_c1 3300050510 Bacteria 4629
314 nmdc:mga06r32_63400_c1 3300050510 Bacteria 3562
315 nmdc:mga06r32_714811_c1 3300050510 Bacteria 967
316 nmdc:mga06r32_88300_c1 3300050510 Bacteria 3026
317 nmdc:mga08y16_9058_c1 3300050511 Bacteria 10448
318 nmdc:mga0n895_17829_c1 3300050512 Bacteria 6555
319 nmdc:mga0n895_980747_c1 3300050512 Bacteria 827
320 nmdc:mga0rr50_15993_c1 3300050513 Bacteria 4969
321 nmdc:mga0a205_166564_c1 3300050515 Unclassified 2099
322 nmdc:mga0a205_181901_c1 3300050515 Unclassified 1996
323 nmdc:mga0a205_245221_c1 3300050515 Bacteria 1672
324 nmdc:mga0a205_31786_c1 3300050515 Bacteria 5060
325 nmdc:mga0a205_68914_c1 3300050515 Bacteria 3416
326 nmdc:mga0sz30_249259_c1 3300050516 Unclassified 790
327 Ga0501084_0472622 3300054114 Bacteria 1060
328 Ga0501082_0087707 3300060353 Bacteria 2685
329 Ga0501082_0168842 3300060353 Unclassified 1902
330 Ga0501082_0181034 3300060353 Bacteria 1833
331 Ga0530510_0096509 3300061734 Bacteria 2161
332 Ga0530510_0720799 3300061734 Bacteria 760

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049742 Ga0501080_0329733 Ga0501080_0329733_809_1369 185
2 3300009147 Ga0114129_10038499 Ga0114129_100384994 191
3 3300049588 Ga0501072_0111749 Ga0501072_0111749_1586_2164 191
4 3300050507 nmdc:mga05p37_42479_c1 nmdc:mga05p37_42479_c1_2263_2841 191
5 3300050508 nmdc:mga09592_143453_c1 nmdc:mga09592_143453_c1_1122_1700 191
6 3300050510 nmdc:mga06r32_63400_c1 nmdc:mga06r32_63400_c1_776_1354 191
7 3300044712 Ga0453684_0458237 Ga0453684_0458237_31_609 192
8 3300048909 Ga0496106_0144065 Ga0496106_0144065_623_1201 192
9 3300050507 nmdc:mga05p37_101744_c1 nmdc:mga05p37_101744_c1_2890_3468 192
10 3300050492 nmdc:mga0yw44_31492_c1 nmdc:mga0yw44_31492_c1_31_618 193
11 3300050512 nmdc:mga0n895_17829_c1 nmdc:mga0n895_17829_c1_2969_3553 194
12 3300050515 nmdc:mga0a205_31786_c1 nmdc:mga0a205_31786_c1_877_1461 194
13 3300049582 Ga0501048_0194419 Ga0501048_0194419_542_1132 195
14 3300031548 Ga0307408_100407672 Ga0307408_1004076722 204
15 3300050489 nmdc:mga03683_79740_c1 nmdc:mga03683_79740_c1_12_644 208
16 3300050510 nmdc:mga06r32_714811_c1 nmdc:mga06r32_714811_c1_310_942 208
17 3300049741 Ga0501079_0731388 Ga0501079_0731388_134_766 210
18 3300049743 Ga0501081_0466571 Ga0501081_0466571_288_923 210
19 3300025936 Ga0207670_10213976 Ga0207670_102139762 213
20 3300006844 Ga0075428_100645714 Ga0075428_1006457142 216
21 3300006880 Ga0075429_100485773 Ga0075429_1004857732 216
22 3300009147 Ga0114129_10004628 Ga0114129_1000462821 216
23 3300042876 Ga0451577_0042206 Ga0451577_0042206_2447_3100 216
24 3300042876 Ga0451577_0361718 Ga0451577_0361718_387_1040 216
25 3300044712 Ga0453684_0154715 Ga0453684_0154715_994_1647 216
26 3300044712 Ga0453684_0328855 Ga0453684_0328855_647_1300 216
27 3300044712 Ga0453684_0396117 Ga0453684_0396117_760_1413 216
28 3300045051 Ga0451576_0027131 Ga0451576_0027131_4494_5147 216
29 3300045051 Ga0451576_0033663 Ga0451576_0033663_1921_2574 216
30 3300049568 Ga0501031_0200132 Ga0501031_0200132_99_752 216
31 3300049572 Ga0501036_0295699 Ga0501036_0295699_476_1129 216
32 3300049575 Ga0501039_0284717 Ga0501039_0284717_300_953 216
33 3300049577 Ga0501041_0156730 Ga0501041_0156730_12_665 216
34 3300049582 Ga0501048_0352057 Ga0501048_0352057_374_1027 216
35 3300049590 Ga0501074_0590937 Ga0501074_0590937_96_749 216
36 3300049591 Ga0501075_0102834 Ga0501075_0102834_1204_1857 216
37 3300049592 Ga0501076_0001634 Ga0501076_0001634_301_954 216
38 3300049743 Ga0501081_0226474 Ga0501081_0226474_549_1202 216
39 3300049823 Ga0501044_0967665 Ga0501044_0967665_42_695 216
40 3300049824 Ga0501045_0129221 Ga0501045_0129221_937_1590 216
41 3300050507 nmdc:mga05p37_39732_c1 nmdc:mga05p37_39732_c1_3864_4517 216
42 3300050508 nmdc:mga09592_471524_c1 nmdc:mga09592_471524_c1_327_980 216
43 3300060353 Ga0501082_0181034 Ga0501082_0181034_255_908 216
44 3300061734 Ga0530510_0096509 Ga0530510_0096509_1054_1707 216
45 3300061734 Ga0530510_0720799 Ga0530510_0720799_84_737 216
46 3300044673 Ga0453683_0000523 Ga0453683_0000523_14212_14871 217
47 3300044712 Ga0453684_0001487 Ga0453684_0001487_5335_5994 217
48 3300044712 Ga0453684_0028334 Ga0453684_0028334_6455_7111 217
49 3300044712 Ga0453684_0498521 Ga0453684_0498521_571_1227 217
50 3300045051 Ga0451576_0008815 Ga0451576_0008815_5728_6387 217
51 3300005328 Ga0070676_10060614 Ga0070676_100606141 218
52 3300005330 Ga0070690_100053498 Ga0070690_1000534982 218
53 3300005334 Ga0068869_100072891 Ga0068869_1000728912 218
54 3300005334 Ga0068869_100892162 Ga0068869_1008921621 218
55 3300005338 Ga0068868_100015724 Ga0068868_1000157242 218
56 3300005340 Ga0070689_100083549 Ga0070689_1000835492 218
57 3300005343 Ga0070687_100050432 Ga0070687_1000504322 218
58 3300005345 Ga0070692_10100654 Ga0070692_101006542 218
59 3300005347 Ga0070668_100021500 Ga0070668_1000215004 218
60 3300005356 Ga0070674_100003035 Ga0070674_1000030353 218
61 3300005364 Ga0070673_100019854 Ga0070673_1000198542 218
62 3300005365 Ga0070688_100002509 Ga0070688_1000025097 218
63 3300005366 Ga0070659_100158476 Ga0070659_1001584762 218
64 3300005367 Ga0070667_100091232 Ga0070667_1000912323 218
65 3300005406 Ga0070703_10079591 Ga0070703_100795911 218
66 3300005438 Ga0070701_10137526 Ga0070701_101375261 218
67 3300005441 Ga0070700_100126284 Ga0070700_1001262842 218
68 3300005445 Ga0070708_100065548 Ga0070708_1000655483 218
69 3300005455 Ga0070663_100014173 Ga0070663_1000141734 218
70 3300005457 Ga0070662_100220032 Ga0070662_1002200322 218
71 3300005459 Ga0068867_100014382 Ga0068867_1000143827 218
72 3300005466 Ga0070685_10174453 Ga0070685_101744532 218
73 3300005467 Ga0070706_100011258 Ga0070706_1000112586 218
74 3300005471 Ga0070698_100303795 Ga0070698_1003037952 218
75 3300005518 Ga0070699_100184954 Ga0070699_1001849542 218
76 3300005518 Ga0070699_100243604 Ga0070699_1002436042 218
77 3300005543 Ga0070672_100020205 Ga0070672_1000202054 218
78 3300005544 Ga0070686_100011661 Ga0070686_1000116614 218
79 3300005546 Ga0070696_100310638 Ga0070696_1003106382 218
80 3300005548 Ga0070665_101055429 Ga0070665_1010554291 218
81 3300005549 Ga0070704_100483653 Ga0070704_1004836532 218
82 3300005616 Ga0068852_100140431 Ga0068852_1001404312 218
83 3300005617 Ga0068859_100050219 Ga0068859_1000502193 218
84 3300005618 Ga0068864_100590621 Ga0068864_1005906212 218
85 3300005840 Ga0068870_10028545 Ga0068870_100285452 218
86 3300005841 Ga0068863_100029212 Ga0068863_1000292122 218
87 3300005842 Ga0068858_100008759 Ga0068858_1000087596 218
88 3300005843 Ga0068860_100061043 Ga0068860_1000610432 218
89 3300005844 Ga0068862_100017238 Ga0068862_1000172383 218
90 3300006038 Ga0075365_10024764 Ga0075365_100247643 218
91 3300006048 Ga0075363_100154441 Ga0075363_1001544412 218
92 3300006051 Ga0075364_10015349 Ga0075364_100153492 218
93 3300006177 Ga0075362_10001927 Ga0075362_100019272 218
94 3300006178 Ga0075367_10034987 Ga0075367_100349872 218
95 3300006186 Ga0075369_10067138 Ga0075369_100671382 218
96 3300006195 Ga0075366_10003460 Ga0075366_1000346010 218
97 3300006844 Ga0075428_100206241 Ga0075428_1002062412 218
98 3300006847 Ga0075431_100022524 Ga0075431_1000225243 218
99 3300006847 Ga0075431_100299961 Ga0075431_1002999613 218
100 3300006852 Ga0075433_10050292 Ga0075433_100502922 218
101 3300006852 Ga0075433_10377990 Ga0075433_103779902 218
102 3300006871 Ga0075434_100050635 Ga0075434_1000506354 218
103 3300006880 Ga0075429_100008414 Ga0075429_1000084145 218
104 3300006880 Ga0075429_100273508 Ga0075429_1002735082 218
105 3300006931 Ga0097620_100050219 Ga0097620_1000502193 218
106 3300007076 Ga0075435_100018070 Ga0075435_1000180704 218
107 3300009094 Ga0111539_10000603 Ga0111539_1000060314 218
108 3300009098 Ga0105245_10186968 Ga0105245_101869683 218
109 3300009147 Ga0114129_10160139 Ga0114129_101601392 218
110 3300009147 Ga0114129_11167470 Ga0114129_111674702 218
111 3300009148 Ga0105243_10217677 Ga0105243_102176772 218
112 3300009177 Ga0105248_10022141 Ga0105248_100221415 218
113 3300009553 Ga0105249_10160318 Ga0105249_101603182 218
114 3300013297 Ga0157378_10061001 Ga0157378_100610012 218
115 3300013308 Ga0157375_10014556 Ga0157375_100145564 218
116 3300014326 Ga0157380_10014948 Ga0157380_100149482 218
117 3300014326 Ga0157380_11005191 Ga0157380_110051911 218
118 3300014968 Ga0157379_10251198 Ga0157379_102511982 218
119 3300017792 Ga0163161_10069419 Ga0163161_100694192 218
120 3300025907 Ga0207645_10068631 Ga0207645_100686313 218
121 3300025908 Ga0207643_10015242 Ga0207643_100152423 218
122 3300025910 Ga0207684_10021019 Ga0207684_100210198 218
123 3300025918 Ga0207662_10000998 Ga0207662_100009988 218
124 3300025922 Ga0207646_10085355 Ga0207646_100853554 218
125 3300025926 Ga0207659_10080181 Ga0207659_100801812 218
126 3300025933 Ga0207706_10019464 Ga0207706_100194645 218
127 3300025940 Ga0207691_10042276 Ga0207691_100422763 218
128 3300025942 Ga0207689_10027103 Ga0207689_100271032 218
129 3300025945 Ga0207679_10316151 Ga0207679_103161511 218
130 3300025960 Ga0207651_10488581 Ga0207651_104885812 218
131 3300025972 Ga0207668_10013982 Ga0207668_100139822 218
132 3300025986 Ga0207658_10109716 Ga0207658_101097162 218
133 3300026023 Ga0207677_10080027 Ga0207677_100800272 218
134 3300026035 Ga0207703_10338831 Ga0207703_103388312 218
135 3300026067 Ga0207678_10018034 Ga0207678_100180344 218
136 3300026075 Ga0207708_10023760 Ga0207708_100237605 218
137 3300026088 Ga0207641_10531951 Ga0207641_105319512 218
138 3300026089 Ga0207648_10001348 Ga0207648_100013486 218
139 3300026095 Ga0207676_10303424 Ga0207676_103034241 218
140 3300026116 Ga0207674_10212376 Ga0207674_102123762 218
141 3300026118 Ga0207675_100078380 Ga0207675_1000783802 218
142 3300026121 Ga0207683_10019003 Ga0207683_100190036 218
143 3300026142 Ga0207698_10332702 Ga0207698_103327022 218
144 3300027907 Ga0207428_10000174 Ga0207428_1000017463 218
145 3300028380 Ga0268265_10155468 Ga0268265_101554682 218
146 3300035088 Ga0373940_0095331 Ga0373940_0095331_157_819 218
147 3300036647 Ga0316582_0031804 Ga0316582_0031804_2287_2952 218
148 3300042876 Ga0451577_0121650 Ga0451577_0121650_919_1575 218
149 3300044673 Ga0453683_0044497 Ga0453683_0044497_1643_2305 218
150 3300044712 Ga0453684_0017807 Ga0453684_0017807_4969_5634 218
151 3300044712 Ga0453684_0162847 Ga0453684_0162847_1685_2344 218
152 3300044712 Ga0453684_0208211 Ga0453684_0208211_627_1283 218
153 3300044712 Ga0453684_0306496 Ga0453684_0306496_931_1596 218
154 3300046615 Ga0495656_0052612 Ga0495656_0052612_505_1167 218
155 3300049591 Ga0501075_0637155 Ga0501075_0637155_142_801 218
156 3300049742 Ga0501080_0810237 Ga0501080_0810237_68_727 218
157 3300050491 nmdc:mga00v17_384266_c1 nmdc:mga00v17_384266_c1_88_750 218
158 3300050493 nmdc:mga0k408_3466_c1 nmdc:mga0k408_3466_c1_1964_2626 218
159 3300050494 nmdc:mga06z11_8833_c1 nmdc:mga06z11_8833_c1_230_892 218
160 3300050495 nmdc:mga04h51_61728_c1 nmdc:mga04h51_61728_c1_60_722 218
161 3300050507 nmdc:mga05p37_90454_c2 nmdc:mga05p37_90454_c2_1500_2162 218
162 3300050508 nmdc:mga09592_25117_c1 nmdc:mga09592_25117_c1_729_1391 218
163 3300050510 nmdc:mga06r32_36780_c1 nmdc:mga06r32_36780_c1_3824_4486 218
164 3300050511 nmdc:mga08y16_9058_c1 nmdc:mga08y16_9058_c1_6459_7121 218
165 3300050512 nmdc:mga0n895_980747_c1 nmdc:mga0n895_980747_c1_154_816 218
166 3300050513 nmdc:mga0rr50_15993_c1 nmdc:mga0rr50_15993_c1_1680_2342 218
167 3300050515 nmdc:mga0a205_166564_c1 nmdc:mga0a205_166564_c1_435_1097 218
168 3300050515 nmdc:mga0a205_181901_c1 nmdc:mga0a205_181901_c1_1067_1729 218
169 3300050515 nmdc:mga0a205_245221_c1 nmdc:mga0a205_245221_c1_760_1422 218
170 3300050516 nmdc:mga0sz30_249259_c1 nmdc:mga0sz30_249259_c1_84_746 218
171 3300035398 Ga0316574_0379640 Ga0316574_0379640_38_697 219
172 2162886007 SwRhRL2b_contig_1033251 SwRhRL2b_0603.00007880 220
173 3300003203 JGI25406J46586_10001015 JGI25406J46586_1000101512 220
174 3300005289 Ga0065704_10012577 Ga0065704_100125772 220
175 3300005289 Ga0065704_10070402 Ga0065704_100704029 220
176 3300005293 Ga0065715_10015290 Ga0065715_100152901 220
177 3300005295 Ga0065707_10082149 Ga0065707_1008214919 220
178 3300005295 Ga0065707_10087037 Ga0065707_100870372 220
179 3300005295 Ga0065707_10099026 Ga0065707_100990262 220
180 3300005295 Ga0065707_10130045 Ga0065707_101300452 220
181 3300005340 Ga0070689_100068774 Ga0070689_1000687742 220
182 3300005440 Ga0070705_100007833 Ga0070705_1000078333 220
183 3300005440 Ga0070705_100076496 Ga0070705_1000764963 220
184 3300005441 Ga0070700_100196100 Ga0070700_1001961002 220
185 3300005444 Ga0070694_100051955 Ga0070694_1000519555 220
186 3300005444 Ga0070694_100096887 Ga0070694_1000968872 220
187 3300005444 Ga0070694_100124797 Ga0070694_1001247973 220
188 3300005467 Ga0070706_100024220 Ga0070706_1000242207 220
189 3300005467 Ga0070706_100348659 Ga0070706_1003486592 220
190 3300005467 Ga0070706_100711363 Ga0070706_1007113632 220
191 3300005468 Ga0070707_100028571 Ga0070707_1000285714 220
192 3300005468 Ga0070707_100170528 Ga0070707_1001705282 220
193 3300005468 Ga0070707_100401330 Ga0070707_1004013301 220
194 3300005471 Ga0070698_100004210 Ga0070698_10000421017 220
195 3300005471 Ga0070698_100065401 Ga0070698_1000654012 220
196 3300005518 Ga0070699_100025951 Ga0070699_1000259514 220
197 3300005518 Ga0070699_100038062 Ga0070699_1000380623 220
198 3300005518 Ga0070699_100093526 Ga0070699_1000935262 220
199 3300005518 Ga0070699_100311929 Ga0070699_1003119292 220
200 3300005545 Ga0070695_100066847 Ga0070695_1000668471 220
201 3300005546 Ga0070696_100005760 Ga0070696_1000057603 220
202 3300005549 Ga0070704_100011451 Ga0070704_1000114516 220
203 3300005549 Ga0070704_100133286 Ga0070704_1001332862 220
204 3300005577 Ga0068857_100648976 Ga0068857_1006489762 220
205 3300005617 Ga0068859_100007883 Ga0068859_1000078838 220
206 3300005618 Ga0068864_100030510 Ga0068864_1000305103 220
207 3300005719 Ga0068861_100180878 Ga0068861_1001808782 220
208 3300005844 Ga0068862_100020193 Ga0068862_1000201932 220
209 3300005844 Ga0068862_100236066 Ga0068862_1002360662 220
210 3300005844 Ga0068862_100255713 Ga0068862_1002557132 220
211 3300005985 Ga0081539_10004513 Ga0081539_100045134 220
212 3300005985 Ga0081539_10004539 Ga0081539_100045399 220
213 3300006194 Ga0075427_10000128 Ga0075427_100001281 220
214 3300006844 Ga0075428_100006886 Ga0075428_1000068869 220
215 3300006844 Ga0075428_100169860 Ga0075428_1001698602 220
216 3300006846 Ga0075430_100067672 Ga0075430_1000676724 220
217 3300006847 Ga0075431_100039543 Ga0075431_1000395436 220
218 3300006847 Ga0075431_100162071 Ga0075431_1001620714 220
219 3300006847 Ga0075431_100264500 Ga0075431_1002645003 220
220 3300006852 Ga0075433_10010058 Ga0075433_100100584 220
221 3300006852 Ga0075433_10327990 Ga0075433_103279902 220
222 3300006871 Ga0075434_100073474 Ga0075434_1000734744 220
223 3300006880 Ga0075429_100003526 Ga0075429_1000035266 220
224 3300006880 Ga0075429_100168225 Ga0075429_1001682254 220
225 3300006880 Ga0075429_100352072 Ga0075429_1003520721 220
226 3300006931 Ga0097620_100007883 Ga0097620_1000078838 220
227 3300009094 Ga0111539_10057586 Ga0111539_100575863 220
228 3300009147 Ga0114129_10001125 Ga0114129_1000112511 220
229 3300009147 Ga0114129_10037920 Ga0114129_100379204 220
230 3300009147 Ga0114129_10098765 Ga0114129_100987656 220
231 3300009147 Ga0114129_10105716 Ga0114129_101057167 220
232 3300009147 Ga0114129_10158321 Ga0114129_101583215 220
233 3300009147 Ga0114129_10198007 Ga0114129_101980076 220
234 3300009148 Ga0105243_10011131 Ga0105243_100111312 220
235 3300009148 Ga0105243_10039059 Ga0105243_100390596 220
236 3300009148 Ga0105243_10041942 Ga0105243_100419422 220
237 3300009553 Ga0105249_10126810 Ga0105249_101268104 220
238 3300009553 Ga0105249_10352911 Ga0105249_103529112 220
239 3300025910 Ga0207684_10022300 Ga0207684_100223007 220
240 3300025922 Ga0207646_10181750 Ga0207646_101817501 220
241 3300025922 Ga0207646_10414424 Ga0207646_104144242 220
242 3300025935 Ga0207709_10029400 Ga0207709_100294002 220
243 3300025936 Ga0207670_10120416 Ga0207670_101204162 220
244 3300025961 Ga0207712_10099203 Ga0207712_100992033 220
245 3300025961 Ga0207712_10280270 Ga0207712_102802702 220
246 3300026075 Ga0207708_10136278 Ga0207708_101362783 220
247 3300026088 Ga0207641_10842129 Ga0207641_108421291 220
248 3300026116 Ga0207674_10397946 Ga0207674_103979462 220
249 3300026118 Ga0207675_100148499 Ga0207675_1001484992 220
250 3300028380 Ga0268265_10054344 Ga0268265_100543442 220
251 3300031665 Ga0316575_10009460 Ga0316575_100094602 220
252 3300031691 Ga0316579_10001456 Ga0316579_100014563 220
253 3300031691 Ga0316579_10107935 Ga0316579_101079352 220
254 3300031727 Ga0316576_10068799 Ga0316576_100687992 220
255 3300031733 Ga0316577_10117165 Ga0316577_101171652 220
256 3300031852 Ga0307410_10169854 Ga0307410_101698541 220
257 3300031852 Ga0307410_10326567 Ga0307410_103265672 220
258 3300031903 Ga0307407_10050741 Ga0307407_100507412 220
259 3300031911 Ga0307412_10297675 Ga0307412_102976752 220
260 3300031911 Ga0307412_11012693 Ga0307412_110126931 220
261 3300031995 Ga0307409_100772341 Ga0307409_1007723411 220
262 3300032002 Ga0307416_100066053 Ga0307416_1000660532 220
263 3300032005 Ga0307411_10628110 Ga0307411_106281102 220
264 3300032137 Ga0316585_10066279 Ga0316585_100662792 220
265 3300036647 Ga0316582_0043863 Ga0316582_0043863_1426_2094 220
266 3300036712 Ga0316584_0065922 Ga0316584_0065922_1565_2233 220
267 3300036712 Ga0316584_0292903 Ga0316584_0292903_305_973 220
268 3300037588 Ga0316581_0000465 Ga0316581_0000465_6926_7594 220
269 3300042156 Ga0439446_0067477 Ga0439446_0067477_20_682 220
270 3300042876 Ga0451577_0030296 Ga0451577_0030296_521_1183 220
271 3300042876 Ga0451577_0088300 Ga0451577_0088300_552_1214 220
272 3300042876 Ga0451577_0126328 Ga0451577_0126328_794_1456 220
273 3300042876 Ga0451577_0140865 Ga0451577_0140865_1053_1721 220
274 3300042876 Ga0451577_0157311 Ga0451577_0157311_1142_1804 220
275 3300042876 Ga0451577_0232501 Ga0451577_0232501_962_1624 220
276 3300042876 Ga0451577_0294896 Ga0451577_0294896_103_765 220
277 3300042876 Ga0451577_0308503 Ga0451577_0308503_230_892 220
278 3300044673 Ga0453683_0236031 Ga0453683_0236031_215_877 220
279 3300044673 Ga0453683_0378765 Ga0453683_0378765_112_774 220
280 3300044673 Ga0453683_0582378 Ga0453683_0582378_40_702 220
281 3300044712 Ga0453684_0001638 Ga0453684_0001638_27441_28103 220
282 3300044712 Ga0453684_0002811 Ga0453684_0002811_38387_39049 220
283 3300044712 Ga0453684_0006097 Ga0453684_0006097_8681_9346 220
284 3300044712 Ga0453684_0052223 Ga0453684_0052223_4042_4704 220
285 3300044712 Ga0453684_0074149 Ga0453684_0074149_3205_3867 220
286 3300044712 Ga0453684_0091254 Ga0453684_0091254_21_695 220
287 3300044712 Ga0453684_0091802 Ga0453684_0091802_2606_3268 220
288 3300044712 Ga0453684_0104923 Ga0453684_0104923_2037_2699 220
289 3300044712 Ga0453684_0105312 Ga0453684_0105312_2225_2887 220
290 3300044712 Ga0453684_0173953 Ga0453684_0173953_727_1389 220
291 3300044712 Ga0453684_0197645 Ga0453684_0197645_983_1645 220
292 3300044712 Ga0453684_0207356 Ga0453684_0207356_964_1632 220
293 3300044712 Ga0453684_0246445 Ga0453684_0246445_687_1349 220
294 3300044712 Ga0453684_0454811 Ga0453684_0454811_45_707 220
295 3300044712 Ga0453684_0478105 Ga0453684_0478105_625_1287 220
296 3300044712 Ga0453684_0478170 Ga0453684_0478170_269_934 220
297 3300044712 Ga0453684_0541677 Ga0453684_0541677_493_1155 220
298 3300044712 Ga0453684_0587341 Ga0453684_0587341_489_1151 220
299 3300044712 Ga0453684_0664832 Ga0453684_0664832_414_1076 220
300 3300044712 Ga0453684_0905300 Ga0453684_0905300_235_897 220
301 3300045051 Ga0451576_0026604 Ga0451576_0026604_1203_1865 220
302 3300045051 Ga0451576_0039081 Ga0451576_0039081_3806_4474 220
303 3300045051 Ga0451576_0146888 Ga0451576_0146888_130_792 220
304 3300049578 Ga0501042_0079932 Ga0501042_0079932_848_1510 220
305 3300049580 Ga0501046_0289150 Ga0501046_0289150_403_1065 220
306 3300049588 Ga0501072_0321278 Ga0501072_0321278_14_676 220
307 3300049591 Ga0501075_0004325 Ga0501075_0004325_4289_4951 220
308 3300049591 Ga0501075_0080437 Ga0501075_0080437_424_1086 220
309 3300049591 Ga0501075_0440892 Ga0501075_0440892_227_889 220
310 3300049592 Ga0501076_0017751 Ga0501076_0017751_43_705 220
311 3300049592 Ga0501076_0245175 Ga0501076_0245175_303_965 220
312 3300049592 Ga0501076_0738935 Ga0501076_0738935_23_685 220
313 3300049593 Ga0501077_0255786 Ga0501077_0255786_305_967 220
314 3300049665 Ga0501227_050791 Ga0501227_050791_226_888 220
315 3300049686 Ga0501257_054301 Ga0501257_054301_41_703 220
316 3300049741 Ga0501079_0180746 Ga0501079_0180746_968_1630 220
317 3300049742 Ga0501080_0174576 Ga0501080_0174576_134_796 220
318 3300049742 Ga0501080_0572535 Ga0501080_0572535_158_820 220
319 3300049743 Ga0501081_0146668 Ga0501081_0146668_782_1444 220
320 3300050507 nmdc:mga05p37_158288_c1 nmdc:mga05p37_158288_c1_1745_2407 220
321 3300050507 nmdc:mga05p37_2237_c1 nmdc:mga05p37_2237_c1_5264_5926 220
322 3300050507 nmdc:mga05p37_4443_c1 nmdc:mga05p37_4443_c1_14348_15010 220
323 3300050507 nmdc:mga05p37_652092_c1 nmdc:mga05p37_652092_c1_356_1018 220
324 3300050508 nmdc:mga09592_396668_c1 nmdc:mga09592_396668_c1_520_1182 220
325 3300050509 nmdc:mga0qj67_168388_c1 nmdc:mga0qj67_168388_c1_933_1595 220
326 3300050510 nmdc:mga06r32_121395_c1 nmdc:mga06r32_121395_c1_185_847 220
327 3300050510 nmdc:mga06r32_167264_c1 nmdc:mga06r32_167264_c1_436_1098 220
328 3300050510 nmdc:mga06r32_88300_c1 nmdc:mga06r32_88300_c1_2110_2772 220
329 3300050515 nmdc:mga0a205_68914_c1 nmdc:mga0a205_68914_c1_688_1350 220
330 3300054114 Ga0501084_0472622 Ga0501084_0472622_321_983 220
331 3300060353 Ga0501082_0087707 Ga0501082_0087707_1593_2255 220
332 3300060353 Ga0501082_0168842 Ga0501082_0168842_560_1222 220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02254

TrkA_N

TrkA-N domain

3

119

0.96

PF13241

NAD_binding_7

Putative NAD(P)-binding

1

108

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7exs-assembly1.cif.gz_A thermomicrobium roseum sarcosine oxidase mutant - s320r 1.012 1 31
2vvm-assembly1.cif.gz_B the structure of mao-n-d5, a variant of monoamine oxidase from aspergillus niger. 0.9993 2 31
3zdn-assembly2.cif.gz_D d11-c mutant of monoamine oxidase from aspergillus niger 0.9987 2 31
2vvm-assembly1.cif.gz_A the structure of mao-n-d5, a variant of monoamine oxidase from aspergillus niger. 0.9986 2 31
2vvl-assembly1.cif.gz_E the structure of mao-n-d3, a variant of monoamine oxidase from aspergillus niger. 0.9984 2 31
ID Description Score Start End Superfamily
af_B0G160_35_582_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 1 3 29 3.50.50.60
af_A4HWA7_1_176_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9973 2 31 3.50.50.60
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9967 3 31 3.50.50.60
5er0A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9966 2 31 3.50.50.60
3zdnC01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9955 2 31 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2M8NK00-F1-model_v4 Potassium transporter TrkA 0.9807 2 79 GO:0005886
GO:0015079
AF-A0A1G8FLJ9-F1-model_v4 deleted 0.9752 1 113
AF-A0A3S9H2J3-F1-model_v4 deleted 0.9671 1 117
AF-X1INN7-F1-model_v4 RCK N-terminal domain-containing protein 0.9575 5 91 GO:0005886
GO:0015079
AF-A0A5J4PKC0-F1-model_v4 Trk system potassium uptake protein TrkA 0.947 1 86 GO:0005886
GO:0015079

Feature Viewer

pLDDT pTM Quality
88.15 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map