F411027

General Info

Members Datasets Scaffolds Average Seq Length
332 159 664 64

Family's Representative Sequence

Representative Sequence 3300041511|Ga0451855_0153706|Ga0451855_0153706_577_783
Length 68
Sequence MPKMKTKSGAKKRFELTGTGRIKRKHAYHGHILTKKSQKRKRNLDHTAIVETADERLSNKCFSSKSIV

Samples

Sample ID Description Type Environment
1 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
13 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
14 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
15 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
16 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
17 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
18 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
19 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
20 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
21 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
22 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
23 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
33 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
34 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
35 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
36 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
37 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
38 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
39 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
40 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
41 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
42 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
43 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
44 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
45 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
46 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
47 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
48 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
55 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
56 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
57 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
58 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
59 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
60 3300041442 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT Metatranscriptome Rhizoplane
61 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
62 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
63 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
64 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
65 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
66 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
67 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
68 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
69 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
70 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
71 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
72 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
73 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
74 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
75 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
79 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
80 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
125 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
131 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
132 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300060244 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 2R_CW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300060245 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 6R_CD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300060246 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
152 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
153 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
154 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
155 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
156 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
157 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
158 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
159 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 49.1
Metatranscriptomes 48.19
Isolates 2.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0
Rhizoplane 6.93
Rhizosphere 83.13
Stem 0
Stem Tuber 0
Unclassified 3.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451855_0153706 3300041511 Bacteria 1047
2 SwRhRL2b_contig_1558670 2162886007 Bacteria 826
3 Ga0065165_1000715 3300005262 Bacteria 46870
4 Ga0065704_10290576 3300005289 Bacteria 902
5 Ga0070670_101613834 3300005331 Bacteria 596
6 Ga0070677_10546647 3300005333 Bacteria 634
7 Ga0070687_100337711 3300005343 Bacteria 968
8 Ga0070673_100163985 3300005364 Bacteria 1892
9 Ga0070705_100379558 3300005440 Bacteria 1040
10 Ga0070686_100764477 3300005544 Bacteria 776
11 Ga0068857_102394267 3300005577 Bacteria 518
12 Ga0075433_10653757 3300006852 Bacteria 922
13 Ga0075429_101816545 3300006880 Bacteria 529
14 Ga0075435_100112546 3300007076 Bacteria 2265
15 Ga0105249_11549165 3300009553 Bacteria 735
16 Ga0157371_10222228 3300013102 Bacteria 1356
17 Ga0157371_10430986 3300013102 Bacteria 968
18 Ga0157371_10774659 3300013102 Bacteria 722
19 Ga0157370_10263046 3300013104 Bacteria 1594
20 Ga0157370_10348351 3300013104 Bacteria 1365
21 Ga0157370_10456781 3300013104 Bacteria 1174
22 Ga0157370_10804587 3300013104 Bacteria 855
23 Ga0157380_12673956 3300014326 Bacteria 565
24 Ga0163161_11361986 3300017792 Bacteria 619
25 Ga0206349_1330230 3300020075 Bacteria 654
26 Ga0206350_10455860 3300020080 Bacteria 644
27 Ga0206354_10908449 3300020081 Bacteria 632
28 Ga0206353_10382911 3300020082 Bacteria 664
29 Ga0209455_1025222 3300025272 Bacteria 1085
30 Ga0209676_1000864 3300025292 Bacteria 38959
31 Ga0207662_10064447 3300025918 Bacteria 2205
32 Ga0207650_11336637 3300025925 Bacteria 610
33 Ga0207670_10059571 3300025936 Bacteria 2597
34 Ga0207689_10023793 3300025942 Bacteria 5139
35 Ga0207651_10685592 3300025960 Bacteria 902
36 Ga0207712_11017938 3300025961 Bacteria 735
37 Ga0265334_10061593 3300028573 Bacteria 1414
38 Ga0265322_10043437 3300028654 Bacteria 1279
39 Ga0265336_10048045 3300028666 Bacteria 1294
40 Ga0265338_10055426 3300028800 Bacteria 3526
41 Ga0265316_10006883 3300031344 Bacteria 10789
42 Ga0265316_10298229 3300031344 Bacteria 1174
43 Ga0316575_10214545 3300031665 Bacteria 803
44 Ga0265342_10293539 3300031712 Bacteria 858
45 Ga0316576_10185200 3300031727 Bacteria 1570
46 Ga0316576_10415709 3300031727 Bacteria 996
47 Ga0316576_10519081 3300031727 Unclassified 875
48 Ga0316576_10762948 3300031727 Bacteria 698
49 Ga0316576_10918799 3300031727 Bacteria 626
50 Ga0316576_11316779 3300031727 Bacteria 508
51 Ga0316578_10356174 3300031728 Bacteria 871
52 Ga0316578_10734281 3300031728 Bacteria 574
53 Ga0307405_10001859 3300031731 Bacteria 9061
54 Ga0316577_10287404 3300031733 Bacteria 931
55 Ga0316577_10797602 3300031733 Unclassified 536
56 Ga0307413_11577569 3300031824 Bacteria 582
57 Ga0307412_10070771 3300031911 Bacteria 2379
58 Ga0307414_10005288 3300032004 Bacteria 7092
59 Ga0307414_10030541 3300032004 Bacteria 3522
60 Ga0307414_10162127 3300032004 Bacteria 1777
61 Ga0307414_10396097 3300032004 Bacteria 1198
62 Ga0307414_11793735 3300032004 Bacteria 572
63 Ga0316585_10280047 3300032137 Bacteria 553
64 Ga0316580_10088530 3300032139 Bacteria 948
65 Ga0316593_10128044 3300032168 Bacteria 915
66 Ga0316593_10148049 3300032168 Bacteria 853
67 Ga0316593_10202863 3300032168 Bacteria 733
68 Ga0316593_10243126 3300032168 Bacteria 672
69 Ga0316592_1010398 3300033524 Bacteria 1877
70 Ga0316592_1033207 3300033524 Bacteria 1127
71 Ga0316592_1060697 3300033524 Bacteria 849
72 Ga0316592_1067896 3300033524 Bacteria 804
73 Ga0316592_1070813 3300033524 Bacteria 788
74 Ga0316592_1073832 3300033524 Bacteria 773
75 Ga0316592_1078432 3300033524 Bacteria 750
76 Ga0316592_1078732 3300033524 Bacteria 749
77 Ga0316592_1090434 3300033524 Bacteria 700
78 Ga0316592_1093711 3300033524 Bacteria 688
79 Ga0316592_1144749 3300033524 Bacteria 559
80 Ga0316592_1145801 3300033524 Bacteria 557
81 Ga0316586_1015760 3300033527 Bacteria 1205
82 Ga0316586_1052589 3300033527 Bacteria 731
83 Ga0316586_1056214 3300033527 Bacteria 710
84 Ga0316588_1027862 3300033528 Bacteria 1315
85 Ga0316588_1056024 3300033528 Bacteria 959
86 Ga0316588_1065871 3300033528 Bacteria 887
87 Ga0316588_1109950 3300033528 Bacteria 693
88 Ga0316588_1110806 3300033528 Bacteria 691
89 Ga0316588_1111693 3300033528 Bacteria 688
90 Ga0316588_1181214 3300033528 Bacteria 547
91 Ga0316588_1209983 3300033528 Bacteria 511
92 Ga0316587_1106728 3300033529 Bacteria 542
93 Ga0316587_1123720 3300033529 Bacteria 508
94 Ga0316596_1017800 3300033541 Bacteria 1791
95 Ga0316596_1059862 3300033541 Bacteria 1015
96 Ga0316596_1078011 3300033541 Bacteria 889
97 Ga0316596_1080266 3300033541 Bacteria 877
98 Ga0316596_1084582 3300033541 Bacteria 853
99 Ga0316596_1100105 3300033541 Bacteria 784
100 Ga0316596_1144681 3300033541 Bacteria 652
101 Ga0316596_1146897 3300033541 Bacteria 647
102 Ga0316596_1160214 3300033541 Bacteria 619
103 Ga0316596_1212593 3300033541 Bacteria 540
104 Ga0316596_1248485 3300033541 Bacteria 501
105 Ga0316596_1249409 3300033541 Bacteria 501
106 Ga0373929_0109545 3300035085 Bacteria 705
107 Ga0316574_0047104 3300035398 Bacteria 2675
108 Ga0316574_0307072 3300035398 Bacteria 1008
109 Ga0316574_0498826 3300035398 Bacteria 759
110 Ga0316574_0577453 3300035398 Bacteria 696
111 Ga0316582_0728035 3300036647 Bacteria 681
112 Ga0316584_0079471 3300036712 Bacteria 2457
113 Ga0316584_0285998 3300036712 Bacteria 1197
114 Ga0316584_0538859 3300036712 Unclassified 816
115 Ga0316584_0851751 3300036712 Bacteria 616
116 Ga0400483_119519 3300039062 Bacteria 1316
117 Ga0400483_272151 3300039062 Unclassified 1538
118 Ga0451787_093291 3300041441 Bacteria 694
119 Ga0451787_094547 3300041441 Bacteria 1085
120 Ga0451787_202879 3300041441 Bacteria 954
121 Ga0451788_22422 3300041442 Bacteria 663
122 Ga0451790_00599 3300041444 Bacteria 505
123 Ga0451790_16030 3300041444 Bacteria 660
124 Ga0451790_24943 3300041444 Bacteria 671
125 Ga0451792_22531 3300041445 Bacteria 667
126 Ga0451794_12333 3300041446 Bacteria 667
127 Ga0451794_50871 3300041446 Bacteria 561
128 Ga0451791_0054541 3300041451 Bacteria 517
129 Ga0451791_1163913 3300041451 Bacteria 853
130 Ga0451797_1583127 3300041453 Bacteria 544
131 Ga0451801_31699 3300041455 Bacteria 672
132 Ga0451795_0530236 3300041456 Bacteria 1086
133 Ga0451795_0573892 3300041456 Bacteria 690
134 Ga0451795_1003494 3300041456 Bacteria 942
135 Ga0451795_1206974 3300041456 Unclassified 504
136 Ga0451795_1372776 3300041456 Bacteria 742
137 Ga0451795_1424520 3300041456 Bacteria 1806
138 Ga0451795_1665665 3300041456 Bacteria 1929
139 Ga0451805_008148 3300041461 Bacteria 624
140 Ga0451805_009886 3300041461 Bacteria 660
141 Ga0451837_1106928 3300041494 Bacteria 1906
142 Ga0451837_1755060 3300041494 Bacteria 1644
143 Ga0451847_0543797 3300041503 Bacteria 613
144 Ga0451850_10628 3300041506 Bacteria 637
145 Ga0451852_11299 3300041508 Bacteria 593
146 Ga0451852_16112 3300041508 Bacteria 701
147 Ga0451852_26315 3300041508 Bacteria 935
148 Ga0451852_27963 3300041508 Bacteria 765
149 Ga0451852_28226 3300041508 Bacteria 706
150 Ga0451852_36249 3300041508 Unclassified 659
151 Ga0451854_37019 3300041510 Bacteria 579
152 Ga0451855_0207010 3300041511 Bacteria 966
153 Ga0451855_0499843 3300041511 Bacteria 1232
154 Ga0451855_0617259 3300041511 Bacteria 587
155 Ga0451855_0924094 3300041511 Unclassified 591
156 Ga0451855_0955669 3300041511 Bacteria 650
157 Ga0451855_1068724 3300041511 Bacteria 2047
158 Ga0451855_1073347 3300041511 Unclassified 691
159 Ga0451855_1452030 3300041511 Bacteria 1384
160 Ga0451855_1869274 3300041511 Bacteria 1086
161 Ga0451855_2061264 3300041511 Bacteria 566
162 Ga0451577_0000568 3300042876 Bacteria 60186
163 Ga0451577_0090601 3300042876 Bacteria 2730
164 Ga0451577_0176690 3300042876 Bacteria 1925
165 Ga0451577_0450797 3300042876 Bacteria 1168
166 Ga0451577_0851113 3300042876 Unclassified 823
167 Ga0451577_1474511 3300042876 Bacteria 602
168 Ga0453683_0000449 3300044673 Bacteria 47293
169 Ga0453683_0013728 3300044673 Bacteria 5274
170 Ga0453683_0119406 3300044673 Bacteria 1659
171 Ga0453683_0141607 3300044673 Bacteria 1518
172 Ga0453683_0353217 3300044673 Bacteria 944
173 Ga0453683_0363415 3300044673 Bacteria 930
174 Ga0453683_0454978 3300044673 Bacteria 828
175 Ga0453683_0599199 3300044673 Bacteria 718
176 Ga0453683_0930330 3300044673 Bacteria 575
177 Ga0453684_0000086 3300044712 Bacteria 397278
178 Ga0453684_0000771 3300044712 Bacteria 110664
179 Ga0453684_0001666 3300044712 Bacteria 60186
180 Ga0453684_0002929 3300044712 Bacteria 40015
181 Ga0453684_0012739 3300044712 Bacteria 13809
182 Ga0453684_0022004 3300044712 Bacteria 9485
183 Ga0453684_0072286 3300044712 Bacteria 4356
184 Ga0453684_0083110 3300044712 Bacteria 3986
185 Ga0453684_0109163 3300044712 Bacteria 3366
186 Ga0453684_0235807 3300044712 Bacteria 2109
187 Ga0453684_0284353 3300044712 Bacteria 1885
188 Ga0453684_0346775 3300044712 Unclassified 1675
189 Ga0453684_0353946 3300044712 Bacteria 1655
190 Ga0453684_0615691 3300044712 Bacteria 1188
191 Ga0453684_0947519 3300044712 Bacteria 919
192 Ga0453684_1116675 3300044712 Bacteria 832
193 Ga0453684_1621654 3300044712 Bacteria 663
194 Ga0451576_0000832 3300045051 Bacteria 60186
195 Ga0451576_0003874 3300045051 Bacteria 20066
196 Ga0451576_0008967 3300045051 Bacteria 11659
197 Ga0451576_0027723 3300045051 Bacteria 6080
198 Ga0451576_0121674 3300045051 Bacteria 2717
199 Ga0451576_0792385 3300045051 Bacteria 995
200 Ga0451576_2061136 3300045051 Bacteria 587
201 Ga0451576_2494872 3300045051 Bacteria 528
202 Ga0451576_2577370 3300045051 Bacteria 519
203 Ga0495661_0164565 3300046665 Bacteria 1188
204 Ga0495661_0189580 3300046665 Bacteria 1084
205 Ga0495670_0327003 3300046691 Bacteria 823
206 Ga0501306_043383 3300049127 Bacteria 703
207 Ga0501306_049032 3300049127 Bacteria 673
208 Ga0501306_059807 3300049127 Bacteria 626
209 Ga0501308_032892 3300049128 Bacteria 703
210 Ga0501308_037283 3300049128 Bacteria 673
211 Ga0501309_045601 3300049129 Bacteria 679
212 Ga0501310_006390 3300049130 Bacteria 1236
213 Ga0501310_045276 3300049130 Bacteria 623
214 Ga0501343_011414 3300049132 Bacteria 731
215 Ga0501343_017168 3300049132 Bacteria 624
216 Ga0501343_017883 3300049132 Bacteria 614
217 Ga0501304_013911 3300049160 Bacteria 741
218 Ga0501304_022370 3300049160 Bacteria 634
219 Ga0501305_011772 3300049161 Bacteria 1187
220 Ga0501305_064958 3300049161 Bacteria 634
221 Ga0501307_035670 3300049162 Bacteria 706
222 Ga0501307_038116 3300049162 Bacteria 690
223 Ga0501307_040649 3300049162 Bacteria 675
224 Ga0501342_02286 3300049163 Bacteria 644
225 Ga0501311_045486 3300049527 Bacteria 676
226 Ga0501311_082621 3300049527 Bacteria 548
227 Ga0501312_036268 3300049528 Bacteria 791
228 Ga0501312_066018 3300049528 Bacteria 634
229 Ga0501313_027110 3300049529 Bacteria 731
230 Ga0501313_035012 3300049529 Bacteria 661
231 Ga0501314_014482 3300049530 Bacteria 773
232 Ga0501314_018550 3300049530 Bacteria 709
233 Ga0501315_006711 3300049531 Bacteria 1290
234 Ga0501315_043243 3300049531 Bacteria 688
235 Ga0501315_079531 3300049531 Bacteria 555
236 Ga0501316_038372 3300049532 Bacteria 661
237 Ga0501316_039671 3300049532 Bacteria 653
238 Ga0501317_018839 3300049533 Bacteria 917
239 Ga0501317_033388 3300049533 Bacteria 757
240 Ga0501318_026220 3300049534 Bacteria 768
241 Ga0501319_015227 3300049535 Bacteria 652
242 Ga0501319_015324 3300049535 Bacteria 650
243 Ga0501319_016752 3300049535 Bacteria 632
244 Ga0501319_030100 3300049535 Bacteria 520
245 Ga0501320_035489 3300049536 Bacteria 636
246 Ga0501320_037414 3300049536 Bacteria 625
247 Ga0501320_049664 3300049536 Bacteria 569
248 Ga0501320_063825 3300049536 Bacteria 522
249 Ga0501321_041111 3300049537 Bacteria 651
250 Ga0501321_069928 3300049537 Bacteria 544
251 Ga0501322_015999 3300049538 Bacteria 624
252 Ga0501323_015379 3300049539 Bacteria 966
253 Ga0501323_030266 3300049539 Bacteria 757
254 Ga0501323_044864 3300049539 Bacteria 657
255 Ga0501323_045283 3300049539 Bacteria 655
256 Ga0501323_048755 3300049539 Bacteria 638
257 Ga0501324_015438 3300049540 Bacteria 741
258 Ga0501324_024304 3300049540 Bacteria 635
259 Ga0501324_042534 3300049540 Bacteria 522
260 Ga0501325_024503 3300049541 Bacteria 657
261 Ga0501326_03270 3300049542 Bacteria 826
262 Ga0501326_05155 3300049542 Bacteria 706
263 Ga0501328_02795 3300049544 Bacteria 783
264 Ga0501329_12315 3300049545 Bacteria 553
265 Ga0501329_16423 3300049545 Bacteria 508
266 Ga0501331_06227 3300049547 Bacteria 694
267 Ga0501331_08521 3300049547 Bacteria 621
268 Ga0501331_09049 3300049547 Bacteria 609
269 Ga0501332_06678 3300049548 Bacteria 726
270 Ga0501334_19543 3300049550 Bacteria 539
271 Ga0501335_014587 3300049551 Bacteria 795
272 Ga0501335_020408 3300049551 Bacteria 705
273 Ga0501335_023856 3300049551 Bacteria 665
274 Ga0501335_048776 3300049551 Bacteria 512
275 Ga0501336_018034 3300049552 Bacteria 624
276 Ga0501336_024626 3300049552 Bacteria 565
277 Ga0501337_003995 3300049553 Bacteria 952
278 Ga0501337_016416 3300049553 Bacteria 578
279 Ga0501338_06725 3300049554 Bacteria 731
280 Ga0501338_09753 3300049554 Bacteria 642
281 Ga0501031_0001827 3300049568 Bacteria 13390
282 Ga0501032_0062988 3300049569 Bacteria 2483
283 Ga0501032_0503995 3300049569 Bacteria 773
284 Ga0501033_0000005 3300049570 Bacteria 379089
285 Ga0501034_0000052 3300049571 Bacteria 207572
286 Ga0501034_0105407 3300049571 Bacteria 2812
287 Ga0501034_0119998 3300049571 Bacteria 2616
288 Ga0501036_0020099 3300049572 Bacteria 5606
289 Ga0501037_0002049 3300049573 Bacteria 14611
290 Ga0501038_0016395 3300049574 Bacteria 6714
291 Ga0501039_0013205 3300049575 Bacteria 6312
292 Ga0501043_0003573 3300049579 Bacteria 12760
293 Ga0501048_0804170 3300049582 Bacteria 675
294 Ga0501217_081767 3300049661 Bacteria 895
295 Ga0501249_060351 3300049679 Bacteria 878
296 Ga0501035_0011547 3300049822 Bacteria 8187
297 Ga0501044_0000262 3300049823 Bacteria 66683
298 Ga0501045_0000001 3300049824 Bacteria 94584
299 nmdc:mga0n895_704592_c1 3300050512 Bacteria 1005
300 nmdc:mga0rr50_261886_c1 3300050513 Bacteria 1439
301 Ga0500618_051862 3300053125 Bacteria 928
302 Ga0587070_073843 3300059491 Bacteria 733
303 Ga0587077_015829 3300059493 Bacteria 1262
304 Ga0587077_024734 3300059493 Bacteria 1096
305 Ga0587082_081641 3300059504 Bacteria 675
306 Ga0587082_088599 3300059504 Bacteria 656
307 Ga0587085_029243 3300059506 Bacteria 895
308 Ga0587090_004313 3300059510 Bacteria 1719
309 Ga0587091_093941 3300059511 Bacteria 693
310 Ga0587125_018152 3300059607 Bacteria 806
311 Ga0587101_036486 3300059623 Bacteria 792
312 Ga0587109_184587 3300059624 Bacteria 535
313 Ga0587128_017268 3300059630 Bacteria 1067
314 Ga0587062_008502 3300059639 Bacteria 1226
315 Ga0587076_072678 3300059645 Bacteria 717
316 Ga0587076_106968 3300059645 Bacteria 632
317 Ga0587100_013915 3300059648 Bacteria 721
318 Ga0587107_031252 3300059652 Bacteria 811
319 Ga0587108_006121 3300059653 Bacteria 922
320 Ga0587124_010588 3300059660 Bacteria 825
321 Ga0587061_03417 3300060244 Bacteria 703
322 Ga0587065_10214 3300060245 Bacteria 590
323 Ga0587081_11448 3300060246 Bacteria 642
324 2522550964 2522125168 Bacteria 7376607
325 2738700356 2738541273 Bacteria 4048577
326 2739254105 2738543014 Bacteria 4048139
327 2740032920 2739367866 Bacteria 4215900
328 2833640164 2833640130 Bacteria 4858325
329 2839991643 2839989709 Bacteria 3773432
330 2842903965 2842903701 Bacteria 6986368
331 2911142114 2911138879 Bacteria 5811561
332 2919695257 2919692658 Bacteria 5943958
333 Ga0451855_0153706
334 SwRhRL2b_contig_1558670
335 Ga0065165_1000715
336 Ga0065704_10290576
337 Ga0070670_101613834
338 Ga0070677_10546647
339 Ga0070687_100337711
340 Ga0070673_100163985
341 Ga0070705_100379558
342 Ga0070686_100764477
343 Ga0068857_102394267
344 Ga0075433_10653757
345 Ga0075429_101816545
346 Ga0075435_100112546
347 Ga0105249_11549165
348 Ga0157371_10222228
349 Ga0157371_10430986
350 Ga0157371_10774659
351 Ga0157370_10263046
352 Ga0157370_10348351
353 Ga0157370_10456781
354 Ga0157370_10804587
355 Ga0157380_12673956
356 Ga0163161_11361986
357 Ga0206349_1330230
358 Ga0206350_10455860
359 Ga0206354_10908449
360 Ga0206353_10382911
361 Ga0209455_1025222
362 Ga0209676_1000864
363 Ga0207662_10064447
364 Ga0207650_11336637
365 Ga0207670_10059571
366 Ga0207689_10023793
367 Ga0207651_10685592
368 Ga0207712_11017938
369 Ga0265334_10061593
370 Ga0265322_10043437
371 Ga0265336_10048045
372 Ga0265338_10055426
373 Ga0265316_10006883
374 Ga0265316_10298229
375 Ga0316575_10214545
376 Ga0265342_10293539
377 Ga0316576_10185200
378 Ga0316576_10415709
379 Ga0316576_10519081
380 Ga0316576_10762948
381 Ga0316576_10918799
382 Ga0316576_11316779
383 Ga0316578_10356174
384 Ga0316578_10734281
385 Ga0307405_10001859
386 Ga0316577_10287404
387 Ga0316577_10797602
388 Ga0307413_11577569
389 Ga0307412_10070771
390 Ga0307414_10005288
391 Ga0307414_10030541
392 Ga0307414_10162127
393 Ga0307414_10396097
394 Ga0307414_11793735
395 Ga0316585_10280047
396 Ga0316580_10088530
397 Ga0316593_10128044
398 Ga0316593_10148049
399 Ga0316593_10202863
400 Ga0316593_10243126
401 Ga0316592_1010398
402 Ga0316592_1033207
403 Ga0316592_1060697
404 Ga0316592_1067896
405 Ga0316592_1070813
406 Ga0316592_1073832
407 Ga0316592_1078432
408 Ga0316592_1078732
409 Ga0316592_1090434
410 Ga0316592_1093711
411 Ga0316592_1144749
412 Ga0316592_1145801
413 Ga0316586_1015760
414 Ga0316586_1052589
415 Ga0316586_1056214
416 Ga0316588_1027862
417 Ga0316588_1056024
418 Ga0316588_1065871
419 Ga0316588_1109950
420 Ga0316588_1110806
421 Ga0316588_1111693
422 Ga0316588_1181214
423 Ga0316588_1209983
424 Ga0316587_1106728
425 Ga0316587_1123720
426 Ga0316596_1017800
427 Ga0316596_1059862
428 Ga0316596_1078011
429 Ga0316596_1080266
430 Ga0316596_1084582
431 Ga0316596_1100105
432 Ga0316596_1144681
433 Ga0316596_1146897
434 Ga0316596_1160214
435 Ga0316596_1212593
436 Ga0316596_1248485
437 Ga0316596_1249409
438 Ga0373929_0109545
439 Ga0316574_0047104
440 Ga0316574_0307072
441 Ga0316574_0498826
442 Ga0316574_0577453
443 Ga0316582_0728035
444 Ga0316584_0079471
445 Ga0316584_0285998
446 Ga0316584_0538859
447 Ga0316584_0851751
448 Ga0400483_119519
449 Ga0400483_272151
450 Ga0451787_093291
451 Ga0451787_094547
452 Ga0451787_202879
453 Ga0451788_22422
454 Ga0451790_00599
455 Ga0451790_16030
456 Ga0451790_24943
457 Ga0451792_22531
458 Ga0451794_12333
459 Ga0451794_50871
460 Ga0451791_0054541
461 Ga0451791_1163913
462 Ga0451797_1583127
463 Ga0451801_31699
464 Ga0451795_0530236
465 Ga0451795_0573892
466 Ga0451795_1003494
467 Ga0451795_1206974
468 Ga0451795_1372776
469 Ga0451795_1424520
470 Ga0451795_1665665
471 Ga0451805_008148
472 Ga0451805_009886
473 Ga0451837_1106928
474 Ga0451837_1755060
475 Ga0451847_0543797
476 Ga0451850_10628
477 Ga0451852_11299
478 Ga0451852_16112
479 Ga0451852_26315
480 Ga0451852_27963
481 Ga0451852_28226
482 Ga0451852_36249
483 Ga0451854_37019
484 Ga0451855_0207010
485 Ga0451855_0499843
486 Ga0451855_0617259
487 Ga0451855_0924094
488 Ga0451855_0955669
489 Ga0451855_1068724
490 Ga0451855_1073347
491 Ga0451855_1452030
492 Ga0451855_1869274
493 Ga0451855_2061264
494 Ga0451577_0000568
495 Ga0451577_0090601
496 Ga0451577_0176690
497 Ga0451577_0450797
498 Ga0451577_0851113
499 Ga0451577_1474511
500 Ga0453683_0000449
501 Ga0453683_0013728
502 Ga0453683_0119406
503 Ga0453683_0141607
504 Ga0453683_0353217
505 Ga0453683_0363415
506 Ga0453683_0454978
507 Ga0453683_0599199
508 Ga0453683_0930330
509 Ga0453684_0000086
510 Ga0453684_0000771
511 Ga0453684_0001666
512 Ga0453684_0002929
513 Ga0453684_0012739
514 Ga0453684_0022004
515 Ga0453684_0072286
516 Ga0453684_0083110
517 Ga0453684_0109163
518 Ga0453684_0235807
519 Ga0453684_0284353
520 Ga0453684_0346775
521 Ga0453684_0353946
522 Ga0453684_0615691
523 Ga0453684_0947519
524 Ga0453684_1116675
525 Ga0453684_1621654
526 Ga0451576_0000832
527 Ga0451576_0003874
528 Ga0451576_0008967
529 Ga0451576_0027723
530 Ga0451576_0121674
531 Ga0451576_0792385
532 Ga0451576_2061136
533 Ga0451576_2494872
534 Ga0451576_2577370
535 Ga0495661_0164565
536 Ga0495661_0189580
537 Ga0495670_0327003
538 Ga0501306_043383
539 Ga0501306_049032
540 Ga0501306_059807
541 Ga0501308_032892
542 Ga0501308_037283
543 Ga0501309_045601
544 Ga0501310_006390
545 Ga0501310_045276
546 Ga0501343_011414
547 Ga0501343_017168
548 Ga0501343_017883
549 Ga0501304_013911
550 Ga0501304_022370
551 Ga0501305_011772
552 Ga0501305_064958
553 Ga0501307_035670
554 Ga0501307_038116
555 Ga0501307_040649
556 Ga0501342_02286
557 Ga0501311_045486
558 Ga0501311_082621
559 Ga0501312_036268
560 Ga0501312_066018
561 Ga0501313_027110
562 Ga0501313_035012
563 Ga0501314_014482
564 Ga0501314_018550
565 Ga0501315_006711
566 Ga0501315_043243
567 Ga0501315_079531
568 Ga0501316_038372
569 Ga0501316_039671
570 Ga0501317_018839
571 Ga0501317_033388
572 Ga0501318_026220
573 Ga0501319_015227
574 Ga0501319_015324
575 Ga0501319_016752
576 Ga0501319_030100
577 Ga0501320_035489
578 Ga0501320_037414
579 Ga0501320_049664
580 Ga0501320_063825
581 Ga0501321_041111
582 Ga0501321_069928
583 Ga0501322_015999
584 Ga0501323_015379
585 Ga0501323_030266
586 Ga0501323_044864
587 Ga0501323_045283
588 Ga0501323_048755
589 Ga0501324_015438
590 Ga0501324_024304
591 Ga0501324_042534
592 Ga0501325_024503
593 Ga0501326_03270
594 Ga0501326_05155
595 Ga0501328_02795
596 Ga0501329_12315
597 Ga0501329_16423
598 Ga0501331_06227
599 Ga0501331_08521
600 Ga0501331_09049
601 Ga0501332_06678
602 Ga0501334_19543
603 Ga0501335_014587
604 Ga0501335_020408
605 Ga0501335_023856
606 Ga0501335_048776
607 Ga0501336_018034
608 Ga0501336_024626
609 Ga0501337_003995
610 Ga0501337_016416
611 Ga0501338_06725
612 Ga0501338_09753
613 Ga0501031_0001827
614 Ga0501032_0062988
615 Ga0501032_0503995
616 Ga0501033_0000005
617 Ga0501034_0000052
618 Ga0501034_0105407
619 Ga0501034_0119998
620 Ga0501036_0020099
621 Ga0501037_0002049
622 Ga0501038_0016395
623 Ga0501039_0013205
624 Ga0501043_0003573
625 Ga0501048_0804170
626 Ga0501217_081767
627 Ga0501249_060351
628 Ga0501035_0011547
629 Ga0501044_0000262
630 Ga0501045_0000001
631 nmdc:mga0n895_704592_c1
632 nmdc:mga0rr50_261886_c1
633 Ga0500618_051862
634 Ga0587070_073843
635 Ga0587077_015829
636 Ga0587077_024734
637 Ga0587082_081641
638 Ga0587082_088599
639 Ga0587085_029243
640 Ga0587090_004313
641 Ga0587091_093941
642 Ga0587125_018152
643 Ga0587101_036486
644 Ga0587109_184587
645 Ga0587128_017268
646 Ga0587062_008502
647 Ga0587076_072678
648 Ga0587076_106968
649 Ga0587100_013915
650 Ga0587107_031252
651 Ga0587108_006121
652 Ga0587124_010588
653 Ga0587061_03417
654 Ga0587065_10214
655 Ga0587081_11448
656 2522550964
657 2738700356
658 2739254105
659 2740032920
660 2833640164
661 2839991643
662 2842903965
663 2911142114
664 2919695257

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01632

Ribosomal_L35p

Ribosomal protein L35

2

62

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v61-assembly1.cif.gz_BI homology model for the spinach chloroplast 30s subunit fitted to 9.4a cryo-em map of the 70s chlororibosome. 0.5585 13 53
4wq1-assembly1.cif.gz_Q8 complex of 70s ribosome with trna-tyr and mrna with c-a mismatch in the first position in the a-site. 0.5303 2 52
1wdt-assembly1.cif.gz_A crystal structure of ttk003000868 from thermus thermophilus hb8 0.5177 19 63
4wsm-assembly2.cif.gz_M5 complex of 70s ribosome with trna-leu and mrna with g-u mismatch in the first position in the a- and p-sites 0.5146 2 50
4v9a-assembly2.cif.gz_D8 crystal structure of the 70s ribosome with tetracycline. 0.4865 2 62
ID Description Score Start End Superfamily
af_O21037_77_170_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.6184 13 52 3.90.930.12
af_Q4DM18_250_366_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5512 11 58 2.30.29.30
af_Q9TZG9_1_178_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.542 14 62 3.80.10.10
af_K7MLZ2_1_202_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.5369 1 52 2.120.10.80
af_Q4D7F5_4_114_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5358 14 62 2.30.29.30
ID Description Score Start End GO Terms
AF-F2UFY9-F1-model_v4 50S ribosomal protein L35 0.5019 1 64 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7Y5PVS4-F1-model_v4 50S ribosomal protein L35 0.4986 1 64 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-F2UFY9-F1-model_v4 50S ribosomal protein L35 0.4977 1 64 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2D5AZQ9-F1-model_v4 50S ribosomal protein L35 0.4943 1 62 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A1F4VFN8-F1-model_v4 50S ribosomal protein L35 0.4943 1 62

Map