F411027
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 332 | 159 | 664 | 64 |
Family's Representative Sequence
| Representative Sequence | 3300041511|Ga0451855_0153706|Ga0451855_0153706_577_783 |
| Length | 68 |
| Sequence | MPKMKTKSGAKKRFELTGTGRIKRKHAYHGHILTKKSQKRKRNLDHTAIVETADERLSNKCFSSKSIV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 12 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 13 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 14 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 15 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 16 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 17 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 18 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 19 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 20 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 21 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 22 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 23 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 24 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 25 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 26 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 33 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 34 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 35 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 36 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 37 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 38 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 39 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 40 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 41 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 42 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 43 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 44 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 45 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 46 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 47 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 48 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 49 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 50 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 51 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 52 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 53 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 54 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 55 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 56 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 57 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 58 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 59 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 60 | 3300041442 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT | Metatranscriptome | Rhizoplane |
| 61 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 62 | 3300041445 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT | Metatranscriptome | Rhizoplane |
| 63 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 64 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 65 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 66 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 67 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 68 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 69 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 70 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 71 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 72 | 3300041508 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT | Metatranscriptome | Unclassified |
| 73 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 74 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 75 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 76 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 77 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 78 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 81 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 82 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 83 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 84 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 85 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 86 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 87 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 88 | 3300049163 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 89 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 90 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 91 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 92 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 93 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 94 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 95 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 97 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 98 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 99 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 100 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 101 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 102 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 103 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 105 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 109 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 110 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 113 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 116 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 117 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 118 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 119 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 122 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 125 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 126 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 129 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 130 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 132 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 135 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 136 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 139 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 140 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 141 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 142 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300060244 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 2R_CW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300060245 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 6R_CD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300060246 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 152 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 153 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 154 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 155 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 156 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 157 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 158 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 159 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 49.1 |
| Metatranscriptomes | 48.19 |
| Isolates | 2.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.2 |
| Nodule | 0 |
| Rhizoplane | 6.93 |
| Rhizosphere | 83.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451855_0153706 | 3300041511 | Bacteria | 1047 |
| 2 | SwRhRL2b_contig_1558670 | 2162886007 | Bacteria | 826 |
| 3 | Ga0065165_1000715 | 3300005262 | Bacteria | 46870 |
| 4 | Ga0065704_10290576 | 3300005289 | Bacteria | 902 |
| 5 | Ga0070670_101613834 | 3300005331 | Bacteria | 596 |
| 6 | Ga0070677_10546647 | 3300005333 | Bacteria | 634 |
| 7 | Ga0070687_100337711 | 3300005343 | Bacteria | 968 |
| 8 | Ga0070673_100163985 | 3300005364 | Bacteria | 1892 |
| 9 | Ga0070705_100379558 | 3300005440 | Bacteria | 1040 |
| 10 | Ga0070686_100764477 | 3300005544 | Bacteria | 776 |
| 11 | Ga0068857_102394267 | 3300005577 | Bacteria | 518 |
| 12 | Ga0075433_10653757 | 3300006852 | Bacteria | 922 |
| 13 | Ga0075429_101816545 | 3300006880 | Bacteria | 529 |
| 14 | Ga0075435_100112546 | 3300007076 | Bacteria | 2265 |
| 15 | Ga0105249_11549165 | 3300009553 | Bacteria | 735 |
| 16 | Ga0157371_10222228 | 3300013102 | Bacteria | 1356 |
| 17 | Ga0157371_10430986 | 3300013102 | Bacteria | 968 |
| 18 | Ga0157371_10774659 | 3300013102 | Bacteria | 722 |
| 19 | Ga0157370_10263046 | 3300013104 | Bacteria | 1594 |
| 20 | Ga0157370_10348351 | 3300013104 | Bacteria | 1365 |
| 21 | Ga0157370_10456781 | 3300013104 | Bacteria | 1174 |
| 22 | Ga0157370_10804587 | 3300013104 | Bacteria | 855 |
| 23 | Ga0157380_12673956 | 3300014326 | Bacteria | 565 |
| 24 | Ga0163161_11361986 | 3300017792 | Bacteria | 619 |
| 25 | Ga0206349_1330230 | 3300020075 | Bacteria | 654 |
| 26 | Ga0206350_10455860 | 3300020080 | Bacteria | 644 |
| 27 | Ga0206354_10908449 | 3300020081 | Bacteria | 632 |
| 28 | Ga0206353_10382911 | 3300020082 | Bacteria | 664 |
| 29 | Ga0209455_1025222 | 3300025272 | Bacteria | 1085 |
| 30 | Ga0209676_1000864 | 3300025292 | Bacteria | 38959 |
| 31 | Ga0207662_10064447 | 3300025918 | Bacteria | 2205 |
| 32 | Ga0207650_11336637 | 3300025925 | Bacteria | 610 |
| 33 | Ga0207670_10059571 | 3300025936 | Bacteria | 2597 |
| 34 | Ga0207689_10023793 | 3300025942 | Bacteria | 5139 |
| 35 | Ga0207651_10685592 | 3300025960 | Bacteria | 902 |
| 36 | Ga0207712_11017938 | 3300025961 | Bacteria | 735 |
| 37 | Ga0265334_10061593 | 3300028573 | Bacteria | 1414 |
| 38 | Ga0265322_10043437 | 3300028654 | Bacteria | 1279 |
| 39 | Ga0265336_10048045 | 3300028666 | Bacteria | 1294 |
| 40 | Ga0265338_10055426 | 3300028800 | Bacteria | 3526 |
| 41 | Ga0265316_10006883 | 3300031344 | Bacteria | 10789 |
| 42 | Ga0265316_10298229 | 3300031344 | Bacteria | 1174 |
| 43 | Ga0316575_10214545 | 3300031665 | Bacteria | 803 |
| 44 | Ga0265342_10293539 | 3300031712 | Bacteria | 858 |
| 45 | Ga0316576_10185200 | 3300031727 | Bacteria | 1570 |
| 46 | Ga0316576_10415709 | 3300031727 | Bacteria | 996 |
| 47 | Ga0316576_10519081 | 3300031727 | Unclassified | 875 |
| 48 | Ga0316576_10762948 | 3300031727 | Bacteria | 698 |
| 49 | Ga0316576_10918799 | 3300031727 | Bacteria | 626 |
| 50 | Ga0316576_11316779 | 3300031727 | Bacteria | 508 |
| 51 | Ga0316578_10356174 | 3300031728 | Bacteria | 871 |
| 52 | Ga0316578_10734281 | 3300031728 | Bacteria | 574 |
| 53 | Ga0307405_10001859 | 3300031731 | Bacteria | 9061 |
| 54 | Ga0316577_10287404 | 3300031733 | Bacteria | 931 |
| 55 | Ga0316577_10797602 | 3300031733 | Unclassified | 536 |
| 56 | Ga0307413_11577569 | 3300031824 | Bacteria | 582 |
| 57 | Ga0307412_10070771 | 3300031911 | Bacteria | 2379 |
| 58 | Ga0307414_10005288 | 3300032004 | Bacteria | 7092 |
| 59 | Ga0307414_10030541 | 3300032004 | Bacteria | 3522 |
| 60 | Ga0307414_10162127 | 3300032004 | Bacteria | 1777 |
| 61 | Ga0307414_10396097 | 3300032004 | Bacteria | 1198 |
| 62 | Ga0307414_11793735 | 3300032004 | Bacteria | 572 |
| 63 | Ga0316585_10280047 | 3300032137 | Bacteria | 553 |
| 64 | Ga0316580_10088530 | 3300032139 | Bacteria | 948 |
| 65 | Ga0316593_10128044 | 3300032168 | Bacteria | 915 |
| 66 | Ga0316593_10148049 | 3300032168 | Bacteria | 853 |
| 67 | Ga0316593_10202863 | 3300032168 | Bacteria | 733 |
| 68 | Ga0316593_10243126 | 3300032168 | Bacteria | 672 |
| 69 | Ga0316592_1010398 | 3300033524 | Bacteria | 1877 |
| 70 | Ga0316592_1033207 | 3300033524 | Bacteria | 1127 |
| 71 | Ga0316592_1060697 | 3300033524 | Bacteria | 849 |
| 72 | Ga0316592_1067896 | 3300033524 | Bacteria | 804 |
| 73 | Ga0316592_1070813 | 3300033524 | Bacteria | 788 |
| 74 | Ga0316592_1073832 | 3300033524 | Bacteria | 773 |
| 75 | Ga0316592_1078432 | 3300033524 | Bacteria | 750 |
| 76 | Ga0316592_1078732 | 3300033524 | Bacteria | 749 |
| 77 | Ga0316592_1090434 | 3300033524 | Bacteria | 700 |
| 78 | Ga0316592_1093711 | 3300033524 | Bacteria | 688 |
| 79 | Ga0316592_1144749 | 3300033524 | Bacteria | 559 |
| 80 | Ga0316592_1145801 | 3300033524 | Bacteria | 557 |
| 81 | Ga0316586_1015760 | 3300033527 | Bacteria | 1205 |
| 82 | Ga0316586_1052589 | 3300033527 | Bacteria | 731 |
| 83 | Ga0316586_1056214 | 3300033527 | Bacteria | 710 |
| 84 | Ga0316588_1027862 | 3300033528 | Bacteria | 1315 |
| 85 | Ga0316588_1056024 | 3300033528 | Bacteria | 959 |
| 86 | Ga0316588_1065871 | 3300033528 | Bacteria | 887 |
| 87 | Ga0316588_1109950 | 3300033528 | Bacteria | 693 |
| 88 | Ga0316588_1110806 | 3300033528 | Bacteria | 691 |
| 89 | Ga0316588_1111693 | 3300033528 | Bacteria | 688 |
| 90 | Ga0316588_1181214 | 3300033528 | Bacteria | 547 |
| 91 | Ga0316588_1209983 | 3300033528 | Bacteria | 511 |
| 92 | Ga0316587_1106728 | 3300033529 | Bacteria | 542 |
| 93 | Ga0316587_1123720 | 3300033529 | Bacteria | 508 |
| 94 | Ga0316596_1017800 | 3300033541 | Bacteria | 1791 |
| 95 | Ga0316596_1059862 | 3300033541 | Bacteria | 1015 |
| 96 | Ga0316596_1078011 | 3300033541 | Bacteria | 889 |
| 97 | Ga0316596_1080266 | 3300033541 | Bacteria | 877 |
| 98 | Ga0316596_1084582 | 3300033541 | Bacteria | 853 |
| 99 | Ga0316596_1100105 | 3300033541 | Bacteria | 784 |
| 100 | Ga0316596_1144681 | 3300033541 | Bacteria | 652 |
| 101 | Ga0316596_1146897 | 3300033541 | Bacteria | 647 |
| 102 | Ga0316596_1160214 | 3300033541 | Bacteria | 619 |
| 103 | Ga0316596_1212593 | 3300033541 | Bacteria | 540 |
| 104 | Ga0316596_1248485 | 3300033541 | Bacteria | 501 |
| 105 | Ga0316596_1249409 | 3300033541 | Bacteria | 501 |
| 106 | Ga0373929_0109545 | 3300035085 | Bacteria | 705 |
| 107 | Ga0316574_0047104 | 3300035398 | Bacteria | 2675 |
| 108 | Ga0316574_0307072 | 3300035398 | Bacteria | 1008 |
| 109 | Ga0316574_0498826 | 3300035398 | Bacteria | 759 |
| 110 | Ga0316574_0577453 | 3300035398 | Bacteria | 696 |
| 111 | Ga0316582_0728035 | 3300036647 | Bacteria | 681 |
| 112 | Ga0316584_0079471 | 3300036712 | Bacteria | 2457 |
| 113 | Ga0316584_0285998 | 3300036712 | Bacteria | 1197 |
| 114 | Ga0316584_0538859 | 3300036712 | Unclassified | 816 |
| 115 | Ga0316584_0851751 | 3300036712 | Bacteria | 616 |
| 116 | Ga0400483_119519 | 3300039062 | Bacteria | 1316 |
| 117 | Ga0400483_272151 | 3300039062 | Unclassified | 1538 |
| 118 | Ga0451787_093291 | 3300041441 | Bacteria | 694 |
| 119 | Ga0451787_094547 | 3300041441 | Bacteria | 1085 |
| 120 | Ga0451787_202879 | 3300041441 | Bacteria | 954 |
| 121 | Ga0451788_22422 | 3300041442 | Bacteria | 663 |
| 122 | Ga0451790_00599 | 3300041444 | Bacteria | 505 |
| 123 | Ga0451790_16030 | 3300041444 | Bacteria | 660 |
| 124 | Ga0451790_24943 | 3300041444 | Bacteria | 671 |
| 125 | Ga0451792_22531 | 3300041445 | Bacteria | 667 |
| 126 | Ga0451794_12333 | 3300041446 | Bacteria | 667 |
| 127 | Ga0451794_50871 | 3300041446 | Bacteria | 561 |
| 128 | Ga0451791_0054541 | 3300041451 | Bacteria | 517 |
| 129 | Ga0451791_1163913 | 3300041451 | Bacteria | 853 |
| 130 | Ga0451797_1583127 | 3300041453 | Bacteria | 544 |
| 131 | Ga0451801_31699 | 3300041455 | Bacteria | 672 |
| 132 | Ga0451795_0530236 | 3300041456 | Bacteria | 1086 |
| 133 | Ga0451795_0573892 | 3300041456 | Bacteria | 690 |
| 134 | Ga0451795_1003494 | 3300041456 | Bacteria | 942 |
| 135 | Ga0451795_1206974 | 3300041456 | Unclassified | 504 |
| 136 | Ga0451795_1372776 | 3300041456 | Bacteria | 742 |
| 137 | Ga0451795_1424520 | 3300041456 | Bacteria | 1806 |
| 138 | Ga0451795_1665665 | 3300041456 | Bacteria | 1929 |
| 139 | Ga0451805_008148 | 3300041461 | Bacteria | 624 |
| 140 | Ga0451805_009886 | 3300041461 | Bacteria | 660 |
| 141 | Ga0451837_1106928 | 3300041494 | Bacteria | 1906 |
| 142 | Ga0451837_1755060 | 3300041494 | Bacteria | 1644 |
| 143 | Ga0451847_0543797 | 3300041503 | Bacteria | 613 |
| 144 | Ga0451850_10628 | 3300041506 | Bacteria | 637 |
| 145 | Ga0451852_11299 | 3300041508 | Bacteria | 593 |
| 146 | Ga0451852_16112 | 3300041508 | Bacteria | 701 |
| 147 | Ga0451852_26315 | 3300041508 | Bacteria | 935 |
| 148 | Ga0451852_27963 | 3300041508 | Bacteria | 765 |
| 149 | Ga0451852_28226 | 3300041508 | Bacteria | 706 |
| 150 | Ga0451852_36249 | 3300041508 | Unclassified | 659 |
| 151 | Ga0451854_37019 | 3300041510 | Bacteria | 579 |
| 152 | Ga0451855_0207010 | 3300041511 | Bacteria | 966 |
| 153 | Ga0451855_0499843 | 3300041511 | Bacteria | 1232 |
| 154 | Ga0451855_0617259 | 3300041511 | Bacteria | 587 |
| 155 | Ga0451855_0924094 | 3300041511 | Unclassified | 591 |
| 156 | Ga0451855_0955669 | 3300041511 | Bacteria | 650 |
| 157 | Ga0451855_1068724 | 3300041511 | Bacteria | 2047 |
| 158 | Ga0451855_1073347 | 3300041511 | Unclassified | 691 |
| 159 | Ga0451855_1452030 | 3300041511 | Bacteria | 1384 |
| 160 | Ga0451855_1869274 | 3300041511 | Bacteria | 1086 |
| 161 | Ga0451855_2061264 | 3300041511 | Bacteria | 566 |
| 162 | Ga0451577_0000568 | 3300042876 | Bacteria | 60186 |
| 163 | Ga0451577_0090601 | 3300042876 | Bacteria | 2730 |
| 164 | Ga0451577_0176690 | 3300042876 | Bacteria | 1925 |
| 165 | Ga0451577_0450797 | 3300042876 | Bacteria | 1168 |
| 166 | Ga0451577_0851113 | 3300042876 | Unclassified | 823 |
| 167 | Ga0451577_1474511 | 3300042876 | Bacteria | 602 |
| 168 | Ga0453683_0000449 | 3300044673 | Bacteria | 47293 |
| 169 | Ga0453683_0013728 | 3300044673 | Bacteria | 5274 |
| 170 | Ga0453683_0119406 | 3300044673 | Bacteria | 1659 |
| 171 | Ga0453683_0141607 | 3300044673 | Bacteria | 1518 |
| 172 | Ga0453683_0353217 | 3300044673 | Bacteria | 944 |
| 173 | Ga0453683_0363415 | 3300044673 | Bacteria | 930 |
| 174 | Ga0453683_0454978 | 3300044673 | Bacteria | 828 |
| 175 | Ga0453683_0599199 | 3300044673 | Bacteria | 718 |
| 176 | Ga0453683_0930330 | 3300044673 | Bacteria | 575 |
| 177 | Ga0453684_0000086 | 3300044712 | Bacteria | 397278 |
| 178 | Ga0453684_0000771 | 3300044712 | Bacteria | 110664 |
| 179 | Ga0453684_0001666 | 3300044712 | Bacteria | 60186 |
| 180 | Ga0453684_0002929 | 3300044712 | Bacteria | 40015 |
| 181 | Ga0453684_0012739 | 3300044712 | Bacteria | 13809 |
| 182 | Ga0453684_0022004 | 3300044712 | Bacteria | 9485 |
| 183 | Ga0453684_0072286 | 3300044712 | Bacteria | 4356 |
| 184 | Ga0453684_0083110 | 3300044712 | Bacteria | 3986 |
| 185 | Ga0453684_0109163 | 3300044712 | Bacteria | 3366 |
| 186 | Ga0453684_0235807 | 3300044712 | Bacteria | 2109 |
| 187 | Ga0453684_0284353 | 3300044712 | Bacteria | 1885 |
| 188 | Ga0453684_0346775 | 3300044712 | Unclassified | 1675 |
| 189 | Ga0453684_0353946 | 3300044712 | Bacteria | 1655 |
| 190 | Ga0453684_0615691 | 3300044712 | Bacteria | 1188 |
| 191 | Ga0453684_0947519 | 3300044712 | Bacteria | 919 |
| 192 | Ga0453684_1116675 | 3300044712 | Bacteria | 832 |
| 193 | Ga0453684_1621654 | 3300044712 | Bacteria | 663 |
| 194 | Ga0451576_0000832 | 3300045051 | Bacteria | 60186 |
| 195 | Ga0451576_0003874 | 3300045051 | Bacteria | 20066 |
| 196 | Ga0451576_0008967 | 3300045051 | Bacteria | 11659 |
| 197 | Ga0451576_0027723 | 3300045051 | Bacteria | 6080 |
| 198 | Ga0451576_0121674 | 3300045051 | Bacteria | 2717 |
| 199 | Ga0451576_0792385 | 3300045051 | Bacteria | 995 |
| 200 | Ga0451576_2061136 | 3300045051 | Bacteria | 587 |
| 201 | Ga0451576_2494872 | 3300045051 | Bacteria | 528 |
| 202 | Ga0451576_2577370 | 3300045051 | Bacteria | 519 |
| 203 | Ga0495661_0164565 | 3300046665 | Bacteria | 1188 |
| 204 | Ga0495661_0189580 | 3300046665 | Bacteria | 1084 |
| 205 | Ga0495670_0327003 | 3300046691 | Bacteria | 823 |
| 206 | Ga0501306_043383 | 3300049127 | Bacteria | 703 |
| 207 | Ga0501306_049032 | 3300049127 | Bacteria | 673 |
| 208 | Ga0501306_059807 | 3300049127 | Bacteria | 626 |
| 209 | Ga0501308_032892 | 3300049128 | Bacteria | 703 |
| 210 | Ga0501308_037283 | 3300049128 | Bacteria | 673 |
| 211 | Ga0501309_045601 | 3300049129 | Bacteria | 679 |
| 212 | Ga0501310_006390 | 3300049130 | Bacteria | 1236 |
| 213 | Ga0501310_045276 | 3300049130 | Bacteria | 623 |
| 214 | Ga0501343_011414 | 3300049132 | Bacteria | 731 |
| 215 | Ga0501343_017168 | 3300049132 | Bacteria | 624 |
| 216 | Ga0501343_017883 | 3300049132 | Bacteria | 614 |
| 217 | Ga0501304_013911 | 3300049160 | Bacteria | 741 |
| 218 | Ga0501304_022370 | 3300049160 | Bacteria | 634 |
| 219 | Ga0501305_011772 | 3300049161 | Bacteria | 1187 |
| 220 | Ga0501305_064958 | 3300049161 | Bacteria | 634 |
| 221 | Ga0501307_035670 | 3300049162 | Bacteria | 706 |
| 222 | Ga0501307_038116 | 3300049162 | Bacteria | 690 |
| 223 | Ga0501307_040649 | 3300049162 | Bacteria | 675 |
| 224 | Ga0501342_02286 | 3300049163 | Bacteria | 644 |
| 225 | Ga0501311_045486 | 3300049527 | Bacteria | 676 |
| 226 | Ga0501311_082621 | 3300049527 | Bacteria | 548 |
| 227 | Ga0501312_036268 | 3300049528 | Bacteria | 791 |
| 228 | Ga0501312_066018 | 3300049528 | Bacteria | 634 |
| 229 | Ga0501313_027110 | 3300049529 | Bacteria | 731 |
| 230 | Ga0501313_035012 | 3300049529 | Bacteria | 661 |
| 231 | Ga0501314_014482 | 3300049530 | Bacteria | 773 |
| 232 | Ga0501314_018550 | 3300049530 | Bacteria | 709 |
| 233 | Ga0501315_006711 | 3300049531 | Bacteria | 1290 |
| 234 | Ga0501315_043243 | 3300049531 | Bacteria | 688 |
| 235 | Ga0501315_079531 | 3300049531 | Bacteria | 555 |
| 236 | Ga0501316_038372 | 3300049532 | Bacteria | 661 |
| 237 | Ga0501316_039671 | 3300049532 | Bacteria | 653 |
| 238 | Ga0501317_018839 | 3300049533 | Bacteria | 917 |
| 239 | Ga0501317_033388 | 3300049533 | Bacteria | 757 |
| 240 | Ga0501318_026220 | 3300049534 | Bacteria | 768 |
| 241 | Ga0501319_015227 | 3300049535 | Bacteria | 652 |
| 242 | Ga0501319_015324 | 3300049535 | Bacteria | 650 |
| 243 | Ga0501319_016752 | 3300049535 | Bacteria | 632 |
| 244 | Ga0501319_030100 | 3300049535 | Bacteria | 520 |
| 245 | Ga0501320_035489 | 3300049536 | Bacteria | 636 |
| 246 | Ga0501320_037414 | 3300049536 | Bacteria | 625 |
| 247 | Ga0501320_049664 | 3300049536 | Bacteria | 569 |
| 248 | Ga0501320_063825 | 3300049536 | Bacteria | 522 |
| 249 | Ga0501321_041111 | 3300049537 | Bacteria | 651 |
| 250 | Ga0501321_069928 | 3300049537 | Bacteria | 544 |
| 251 | Ga0501322_015999 | 3300049538 | Bacteria | 624 |
| 252 | Ga0501323_015379 | 3300049539 | Bacteria | 966 |
| 253 | Ga0501323_030266 | 3300049539 | Bacteria | 757 |
| 254 | Ga0501323_044864 | 3300049539 | Bacteria | 657 |
| 255 | Ga0501323_045283 | 3300049539 | Bacteria | 655 |
| 256 | Ga0501323_048755 | 3300049539 | Bacteria | 638 |
| 257 | Ga0501324_015438 | 3300049540 | Bacteria | 741 |
| 258 | Ga0501324_024304 | 3300049540 | Bacteria | 635 |
| 259 | Ga0501324_042534 | 3300049540 | Bacteria | 522 |
| 260 | Ga0501325_024503 | 3300049541 | Bacteria | 657 |
| 261 | Ga0501326_03270 | 3300049542 | Bacteria | 826 |
| 262 | Ga0501326_05155 | 3300049542 | Bacteria | 706 |
| 263 | Ga0501328_02795 | 3300049544 | Bacteria | 783 |
| 264 | Ga0501329_12315 | 3300049545 | Bacteria | 553 |
| 265 | Ga0501329_16423 | 3300049545 | Bacteria | 508 |
| 266 | Ga0501331_06227 | 3300049547 | Bacteria | 694 |
| 267 | Ga0501331_08521 | 3300049547 | Bacteria | 621 |
| 268 | Ga0501331_09049 | 3300049547 | Bacteria | 609 |
| 269 | Ga0501332_06678 | 3300049548 | Bacteria | 726 |
| 270 | Ga0501334_19543 | 3300049550 | Bacteria | 539 |
| 271 | Ga0501335_014587 | 3300049551 | Bacteria | 795 |
| 272 | Ga0501335_020408 | 3300049551 | Bacteria | 705 |
| 273 | Ga0501335_023856 | 3300049551 | Bacteria | 665 |
| 274 | Ga0501335_048776 | 3300049551 | Bacteria | 512 |
| 275 | Ga0501336_018034 | 3300049552 | Bacteria | 624 |
| 276 | Ga0501336_024626 | 3300049552 | Bacteria | 565 |
| 277 | Ga0501337_003995 | 3300049553 | Bacteria | 952 |
| 278 | Ga0501337_016416 | 3300049553 | Bacteria | 578 |
| 279 | Ga0501338_06725 | 3300049554 | Bacteria | 731 |
| 280 | Ga0501338_09753 | 3300049554 | Bacteria | 642 |
| 281 | Ga0501031_0001827 | 3300049568 | Bacteria | 13390 |
| 282 | Ga0501032_0062988 | 3300049569 | Bacteria | 2483 |
| 283 | Ga0501032_0503995 | 3300049569 | Bacteria | 773 |
| 284 | Ga0501033_0000005 | 3300049570 | Bacteria | 379089 |
| 285 | Ga0501034_0000052 | 3300049571 | Bacteria | 207572 |
| 286 | Ga0501034_0105407 | 3300049571 | Bacteria | 2812 |
| 287 | Ga0501034_0119998 | 3300049571 | Bacteria | 2616 |
| 288 | Ga0501036_0020099 | 3300049572 | Bacteria | 5606 |
| 289 | Ga0501037_0002049 | 3300049573 | Bacteria | 14611 |
| 290 | Ga0501038_0016395 | 3300049574 | Bacteria | 6714 |
| 291 | Ga0501039_0013205 | 3300049575 | Bacteria | 6312 |
| 292 | Ga0501043_0003573 | 3300049579 | Bacteria | 12760 |
| 293 | Ga0501048_0804170 | 3300049582 | Bacteria | 675 |
| 294 | Ga0501217_081767 | 3300049661 | Bacteria | 895 |
| 295 | Ga0501249_060351 | 3300049679 | Bacteria | 878 |
| 296 | Ga0501035_0011547 | 3300049822 | Bacteria | 8187 |
| 297 | Ga0501044_0000262 | 3300049823 | Bacteria | 66683 |
| 298 | Ga0501045_0000001 | 3300049824 | Bacteria | 94584 |
| 299 | nmdc:mga0n895_704592_c1 | 3300050512 | Bacteria | 1005 |
| 300 | nmdc:mga0rr50_261886_c1 | 3300050513 | Bacteria | 1439 |
| 301 | Ga0500618_051862 | 3300053125 | Bacteria | 928 |
| 302 | Ga0587070_073843 | 3300059491 | Bacteria | 733 |
| 303 | Ga0587077_015829 | 3300059493 | Bacteria | 1262 |
| 304 | Ga0587077_024734 | 3300059493 | Bacteria | 1096 |
| 305 | Ga0587082_081641 | 3300059504 | Bacteria | 675 |
| 306 | Ga0587082_088599 | 3300059504 | Bacteria | 656 |
| 307 | Ga0587085_029243 | 3300059506 | Bacteria | 895 |
| 308 | Ga0587090_004313 | 3300059510 | Bacteria | 1719 |
| 309 | Ga0587091_093941 | 3300059511 | Bacteria | 693 |
| 310 | Ga0587125_018152 | 3300059607 | Bacteria | 806 |
| 311 | Ga0587101_036486 | 3300059623 | Bacteria | 792 |
| 312 | Ga0587109_184587 | 3300059624 | Bacteria | 535 |
| 313 | Ga0587128_017268 | 3300059630 | Bacteria | 1067 |
| 314 | Ga0587062_008502 | 3300059639 | Bacteria | 1226 |
| 315 | Ga0587076_072678 | 3300059645 | Bacteria | 717 |
| 316 | Ga0587076_106968 | 3300059645 | Bacteria | 632 |
| 317 | Ga0587100_013915 | 3300059648 | Bacteria | 721 |
| 318 | Ga0587107_031252 | 3300059652 | Bacteria | 811 |
| 319 | Ga0587108_006121 | 3300059653 | Bacteria | 922 |
| 320 | Ga0587124_010588 | 3300059660 | Bacteria | 825 |
| 321 | Ga0587061_03417 | 3300060244 | Bacteria | 703 |
| 322 | Ga0587065_10214 | 3300060245 | Bacteria | 590 |
| 323 | Ga0587081_11448 | 3300060246 | Bacteria | 642 |
| 324 | 2522550964 | 2522125168 | Bacteria | 7376607 |
| 325 | 2738700356 | 2738541273 | Bacteria | 4048577 |
| 326 | 2739254105 | 2738543014 | Bacteria | 4048139 |
| 327 | 2740032920 | 2739367866 | Bacteria | 4215900 |
| 328 | 2833640164 | 2833640130 | Bacteria | 4858325 |
| 329 | 2839991643 | 2839989709 | Bacteria | 3773432 |
| 330 | 2842903965 | 2842903701 | Bacteria | 6986368 |
| 331 | 2911142114 | 2911138879 | Bacteria | 5811561 |
| 332 | 2919695257 | 2919692658 | Bacteria | 5943958 |
| 333 | Ga0451855_0153706 | |||
| 334 | SwRhRL2b_contig_1558670 | |||
| 335 | Ga0065165_1000715 | |||
| 336 | Ga0065704_10290576 | |||
| 337 | Ga0070670_101613834 | |||
| 338 | Ga0070677_10546647 | |||
| 339 | Ga0070687_100337711 | |||
| 340 | Ga0070673_100163985 | |||
| 341 | Ga0070705_100379558 | |||
| 342 | Ga0070686_100764477 | |||
| 343 | Ga0068857_102394267 | |||
| 344 | Ga0075433_10653757 | |||
| 345 | Ga0075429_101816545 | |||
| 346 | Ga0075435_100112546 | |||
| 347 | Ga0105249_11549165 | |||
| 348 | Ga0157371_10222228 | |||
| 349 | Ga0157371_10430986 | |||
| 350 | Ga0157371_10774659 | |||
| 351 | Ga0157370_10263046 | |||
| 352 | Ga0157370_10348351 | |||
| 353 | Ga0157370_10456781 | |||
| 354 | Ga0157370_10804587 | |||
| 355 | Ga0157380_12673956 | |||
| 356 | Ga0163161_11361986 | |||
| 357 | Ga0206349_1330230 | |||
| 358 | Ga0206350_10455860 | |||
| 359 | Ga0206354_10908449 | |||
| 360 | Ga0206353_10382911 | |||
| 361 | Ga0209455_1025222 | |||
| 362 | Ga0209676_1000864 | |||
| 363 | Ga0207662_10064447 | |||
| 364 | Ga0207650_11336637 | |||
| 365 | Ga0207670_10059571 | |||
| 366 | Ga0207689_10023793 | |||
| 367 | Ga0207651_10685592 | |||
| 368 | Ga0207712_11017938 | |||
| 369 | Ga0265334_10061593 | |||
| 370 | Ga0265322_10043437 | |||
| 371 | Ga0265336_10048045 | |||
| 372 | Ga0265338_10055426 | |||
| 373 | Ga0265316_10006883 | |||
| 374 | Ga0265316_10298229 | |||
| 375 | Ga0316575_10214545 | |||
| 376 | Ga0265342_10293539 | |||
| 377 | Ga0316576_10185200 | |||
| 378 | Ga0316576_10415709 | |||
| 379 | Ga0316576_10519081 | |||
| 380 | Ga0316576_10762948 | |||
| 381 | Ga0316576_10918799 | |||
| 382 | Ga0316576_11316779 | |||
| 383 | Ga0316578_10356174 | |||
| 384 | Ga0316578_10734281 | |||
| 385 | Ga0307405_10001859 | |||
| 386 | Ga0316577_10287404 | |||
| 387 | Ga0316577_10797602 | |||
| 388 | Ga0307413_11577569 | |||
| 389 | Ga0307412_10070771 | |||
| 390 | Ga0307414_10005288 | |||
| 391 | Ga0307414_10030541 | |||
| 392 | Ga0307414_10162127 | |||
| 393 | Ga0307414_10396097 | |||
| 394 | Ga0307414_11793735 | |||
| 395 | Ga0316585_10280047 | |||
| 396 | Ga0316580_10088530 | |||
| 397 | Ga0316593_10128044 | |||
| 398 | Ga0316593_10148049 | |||
| 399 | Ga0316593_10202863 | |||
| 400 | Ga0316593_10243126 | |||
| 401 | Ga0316592_1010398 | |||
| 402 | Ga0316592_1033207 | |||
| 403 | Ga0316592_1060697 | |||
| 404 | Ga0316592_1067896 | |||
| 405 | Ga0316592_1070813 | |||
| 406 | Ga0316592_1073832 | |||
| 407 | Ga0316592_1078432 | |||
| 408 | Ga0316592_1078732 | |||
| 409 | Ga0316592_1090434 | |||
| 410 | Ga0316592_1093711 | |||
| 411 | Ga0316592_1144749 | |||
| 412 | Ga0316592_1145801 | |||
| 413 | Ga0316586_1015760 | |||
| 414 | Ga0316586_1052589 | |||
| 415 | Ga0316586_1056214 | |||
| 416 | Ga0316588_1027862 | |||
| 417 | Ga0316588_1056024 | |||
| 418 | Ga0316588_1065871 | |||
| 419 | Ga0316588_1109950 | |||
| 420 | Ga0316588_1110806 | |||
| 421 | Ga0316588_1111693 | |||
| 422 | Ga0316588_1181214 | |||
| 423 | Ga0316588_1209983 | |||
| 424 | Ga0316587_1106728 | |||
| 425 | Ga0316587_1123720 | |||
| 426 | Ga0316596_1017800 | |||
| 427 | Ga0316596_1059862 | |||
| 428 | Ga0316596_1078011 | |||
| 429 | Ga0316596_1080266 | |||
| 430 | Ga0316596_1084582 | |||
| 431 | Ga0316596_1100105 | |||
| 432 | Ga0316596_1144681 | |||
| 433 | Ga0316596_1146897 | |||
| 434 | Ga0316596_1160214 | |||
| 435 | Ga0316596_1212593 | |||
| 436 | Ga0316596_1248485 | |||
| 437 | Ga0316596_1249409 | |||
| 438 | Ga0373929_0109545 | |||
| 439 | Ga0316574_0047104 | |||
| 440 | Ga0316574_0307072 | |||
| 441 | Ga0316574_0498826 | |||
| 442 | Ga0316574_0577453 | |||
| 443 | Ga0316582_0728035 | |||
| 444 | Ga0316584_0079471 | |||
| 445 | Ga0316584_0285998 | |||
| 446 | Ga0316584_0538859 | |||
| 447 | Ga0316584_0851751 | |||
| 448 | Ga0400483_119519 | |||
| 449 | Ga0400483_272151 | |||
| 450 | Ga0451787_093291 | |||
| 451 | Ga0451787_094547 | |||
| 452 | Ga0451787_202879 | |||
| 453 | Ga0451788_22422 | |||
| 454 | Ga0451790_00599 | |||
| 455 | Ga0451790_16030 | |||
| 456 | Ga0451790_24943 | |||
| 457 | Ga0451792_22531 | |||
| 458 | Ga0451794_12333 | |||
| 459 | Ga0451794_50871 | |||
| 460 | Ga0451791_0054541 | |||
| 461 | Ga0451791_1163913 | |||
| 462 | Ga0451797_1583127 | |||
| 463 | Ga0451801_31699 | |||
| 464 | Ga0451795_0530236 | |||
| 465 | Ga0451795_0573892 | |||
| 466 | Ga0451795_1003494 | |||
| 467 | Ga0451795_1206974 | |||
| 468 | Ga0451795_1372776 | |||
| 469 | Ga0451795_1424520 | |||
| 470 | Ga0451795_1665665 | |||
| 471 | Ga0451805_008148 | |||
| 472 | Ga0451805_009886 | |||
| 473 | Ga0451837_1106928 | |||
| 474 | Ga0451837_1755060 | |||
| 475 | Ga0451847_0543797 | |||
| 476 | Ga0451850_10628 | |||
| 477 | Ga0451852_11299 | |||
| 478 | Ga0451852_16112 | |||
| 479 | Ga0451852_26315 | |||
| 480 | Ga0451852_27963 | |||
| 481 | Ga0451852_28226 | |||
| 482 | Ga0451852_36249 | |||
| 483 | Ga0451854_37019 | |||
| 484 | Ga0451855_0207010 | |||
| 485 | Ga0451855_0499843 | |||
| 486 | Ga0451855_0617259 | |||
| 487 | Ga0451855_0924094 | |||
| 488 | Ga0451855_0955669 | |||
| 489 | Ga0451855_1068724 | |||
| 490 | Ga0451855_1073347 | |||
| 491 | Ga0451855_1452030 | |||
| 492 | Ga0451855_1869274 | |||
| 493 | Ga0451855_2061264 | |||
| 494 | Ga0451577_0000568 | |||
| 495 | Ga0451577_0090601 | |||
| 496 | Ga0451577_0176690 | |||
| 497 | Ga0451577_0450797 | |||
| 498 | Ga0451577_0851113 | |||
| 499 | Ga0451577_1474511 | |||
| 500 | Ga0453683_0000449 | |||
| 501 | Ga0453683_0013728 | |||
| 502 | Ga0453683_0119406 | |||
| 503 | Ga0453683_0141607 | |||
| 504 | Ga0453683_0353217 | |||
| 505 | Ga0453683_0363415 | |||
| 506 | Ga0453683_0454978 | |||
| 507 | Ga0453683_0599199 | |||
| 508 | Ga0453683_0930330 | |||
| 509 | Ga0453684_0000086 | |||
| 510 | Ga0453684_0000771 | |||
| 511 | Ga0453684_0001666 | |||
| 512 | Ga0453684_0002929 | |||
| 513 | Ga0453684_0012739 | |||
| 514 | Ga0453684_0022004 | |||
| 515 | Ga0453684_0072286 | |||
| 516 | Ga0453684_0083110 | |||
| 517 | Ga0453684_0109163 | |||
| 518 | Ga0453684_0235807 | |||
| 519 | Ga0453684_0284353 | |||
| 520 | Ga0453684_0346775 | |||
| 521 | Ga0453684_0353946 | |||
| 522 | Ga0453684_0615691 | |||
| 523 | Ga0453684_0947519 | |||
| 524 | Ga0453684_1116675 | |||
| 525 | Ga0453684_1621654 | |||
| 526 | Ga0451576_0000832 | |||
| 527 | Ga0451576_0003874 | |||
| 528 | Ga0451576_0008967 | |||
| 529 | Ga0451576_0027723 | |||
| 530 | Ga0451576_0121674 | |||
| 531 | Ga0451576_0792385 | |||
| 532 | Ga0451576_2061136 | |||
| 533 | Ga0451576_2494872 | |||
| 534 | Ga0451576_2577370 | |||
| 535 | Ga0495661_0164565 | |||
| 536 | Ga0495661_0189580 | |||
| 537 | Ga0495670_0327003 | |||
| 538 | Ga0501306_043383 | |||
| 539 | Ga0501306_049032 | |||
| 540 | Ga0501306_059807 | |||
| 541 | Ga0501308_032892 | |||
| 542 | Ga0501308_037283 | |||
| 543 | Ga0501309_045601 | |||
| 544 | Ga0501310_006390 | |||
| 545 | Ga0501310_045276 | |||
| 546 | Ga0501343_011414 | |||
| 547 | Ga0501343_017168 | |||
| 548 | Ga0501343_017883 | |||
| 549 | Ga0501304_013911 | |||
| 550 | Ga0501304_022370 | |||
| 551 | Ga0501305_011772 | |||
| 552 | Ga0501305_064958 | |||
| 553 | Ga0501307_035670 | |||
| 554 | Ga0501307_038116 | |||
| 555 | Ga0501307_040649 | |||
| 556 | Ga0501342_02286 | |||
| 557 | Ga0501311_045486 | |||
| 558 | Ga0501311_082621 | |||
| 559 | Ga0501312_036268 | |||
| 560 | Ga0501312_066018 | |||
| 561 | Ga0501313_027110 | |||
| 562 | Ga0501313_035012 | |||
| 563 | Ga0501314_014482 | |||
| 564 | Ga0501314_018550 | |||
| 565 | Ga0501315_006711 | |||
| 566 | Ga0501315_043243 | |||
| 567 | Ga0501315_079531 | |||
| 568 | Ga0501316_038372 | |||
| 569 | Ga0501316_039671 | |||
| 570 | Ga0501317_018839 | |||
| 571 | Ga0501317_033388 | |||
| 572 | Ga0501318_026220 | |||
| 573 | Ga0501319_015227 | |||
| 574 | Ga0501319_015324 | |||
| 575 | Ga0501319_016752 | |||
| 576 | Ga0501319_030100 | |||
| 577 | Ga0501320_035489 | |||
| 578 | Ga0501320_037414 | |||
| 579 | Ga0501320_049664 | |||
| 580 | Ga0501320_063825 | |||
| 581 | Ga0501321_041111 | |||
| 582 | Ga0501321_069928 | |||
| 583 | Ga0501322_015999 | |||
| 584 | Ga0501323_015379 | |||
| 585 | Ga0501323_030266 | |||
| 586 | Ga0501323_044864 | |||
| 587 | Ga0501323_045283 | |||
| 588 | Ga0501323_048755 | |||
| 589 | Ga0501324_015438 | |||
| 590 | Ga0501324_024304 | |||
| 591 | Ga0501324_042534 | |||
| 592 | Ga0501325_024503 | |||
| 593 | Ga0501326_03270 | |||
| 594 | Ga0501326_05155 | |||
| 595 | Ga0501328_02795 | |||
| 596 | Ga0501329_12315 | |||
| 597 | Ga0501329_16423 | |||
| 598 | Ga0501331_06227 | |||
| 599 | Ga0501331_08521 | |||
| 600 | Ga0501331_09049 | |||
| 601 | Ga0501332_06678 | |||
| 602 | Ga0501334_19543 | |||
| 603 | Ga0501335_014587 | |||
| 604 | Ga0501335_020408 | |||
| 605 | Ga0501335_023856 | |||
| 606 | Ga0501335_048776 | |||
| 607 | Ga0501336_018034 | |||
| 608 | Ga0501336_024626 | |||
| 609 | Ga0501337_003995 | |||
| 610 | Ga0501337_016416 | |||
| 611 | Ga0501338_06725 | |||
| 612 | Ga0501338_09753 | |||
| 613 | Ga0501031_0001827 | |||
| 614 | Ga0501032_0062988 | |||
| 615 | Ga0501032_0503995 | |||
| 616 | Ga0501033_0000005 | |||
| 617 | Ga0501034_0000052 | |||
| 618 | Ga0501034_0105407 | |||
| 619 | Ga0501034_0119998 | |||
| 620 | Ga0501036_0020099 | |||
| 621 | Ga0501037_0002049 | |||
| 622 | Ga0501038_0016395 | |||
| 623 | Ga0501039_0013205 | |||
| 624 | Ga0501043_0003573 | |||
| 625 | Ga0501048_0804170 | |||
| 626 | Ga0501217_081767 | |||
| 627 | Ga0501249_060351 | |||
| 628 | Ga0501035_0011547 | |||
| 629 | Ga0501044_0000262 | |||
| 630 | Ga0501045_0000001 | |||
| 631 | nmdc:mga0n895_704592_c1 | |||
| 632 | nmdc:mga0rr50_261886_c1 | |||
| 633 | Ga0500618_051862 | |||
| 634 | Ga0587070_073843 | |||
| 635 | Ga0587077_015829 | |||
| 636 | Ga0587077_024734 | |||
| 637 | Ga0587082_081641 | |||
| 638 | Ga0587082_088599 | |||
| 639 | Ga0587085_029243 | |||
| 640 | Ga0587090_004313 | |||
| 641 | Ga0587091_093941 | |||
| 642 | Ga0587125_018152 | |||
| 643 | Ga0587101_036486 | |||
| 644 | Ga0587109_184587 | |||
| 645 | Ga0587128_017268 | |||
| 646 | Ga0587062_008502 | |||
| 647 | Ga0587076_072678 | |||
| 648 | Ga0587076_106968 | |||
| 649 | Ga0587100_013915 | |||
| 650 | Ga0587107_031252 | |||
| 651 | Ga0587108_006121 | |||
| 652 | Ga0587124_010588 | |||
| 653 | Ga0587061_03417 | |||
| 654 | Ga0587065_10214 | |||
| 655 | Ga0587081_11448 | |||
| 656 | 2522550964 | |||
| 657 | 2738700356 | |||
| 658 | 2739254105 | |||
| 659 | 2740032920 | |||
| 660 | 2833640164 | |||
| 661 | 2839991643 | |||
| 662 | 2842903965 | |||
| 663 | 2911142114 | |||
| 664 | 2919695257 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v61-assembly1.cif.gz_BI | homology model for the spinach chloroplast 30s subunit fitted to 9.4a cryo-em map of the 70s chlororibosome. | 0.5585 | 13 | 53 |
| 4wq1-assembly1.cif.gz_Q8 | complex of 70s ribosome with trna-tyr and mrna with c-a mismatch in the first position in the a-site. | 0.5303 | 2 | 52 |
| 1wdt-assembly1.cif.gz_A | crystal structure of ttk003000868 from thermus thermophilus hb8 | 0.5177 | 19 | 63 |
| 4wsm-assembly2.cif.gz_M5 | complex of 70s ribosome with trna-leu and mrna with g-u mismatch in the first position in the a- and p-sites | 0.5146 | 2 | 50 |
| 4v9a-assembly2.cif.gz_D8 | crystal structure of the 70s ribosome with tetracycline. | 0.4865 | 2 | 62 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O21037_77_170_3.90.930.12 | Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 | 0.6184 | 13 | 52 | 3.90.930.12 |
| af_Q4DM18_250_366_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.5512 | 11 | 58 | 2.30.29.30 |
| af_Q9TZG9_1_178_3.80.10.10 | Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor | 0.542 | 14 | 62 | 3.80.10.10 |
| af_K7MLZ2_1_202_2.120.10.80 | Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller | 0.5369 | 1 | 52 | 2.120.10.80 |
| af_Q4D7F5_4_114_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.5358 | 14 | 62 | 2.30.29.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F2UFY9-F1-model_v4 | 50S ribosomal protein L35 | 0.5019 | 1 | 64 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7Y5PVS4-F1-model_v4 | 50S ribosomal protein L35 | 0.4986 | 1 | 64 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-F2UFY9-F1-model_v4 | 50S ribosomal protein L35 | 0.4977 | 1 | 64 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A2D5AZQ9-F1-model_v4 | 50S ribosomal protein L35 | 0.4943 | 1 | 62 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A1F4VFN8-F1-model_v4 | 50S ribosomal protein L35 | 0.4943 | 1 | 62 |
|