F411069

General Info

Members Datasets Scaffolds Average Seq Length
332 221 664 269

Family's Representative Sequence

Representative Sequence 3300046520|Ga0495637_0004619|Ga0495637_0004619_3643_4542
Length 299
Sequence MIDVIDDNDEKSSFQYLIRCRYDEPIDTTGKPHVMKIGKETIPRSAISTSDEHSITVRGADLCRDLIGRLSFTDYFHLLVTGRRASAPAIAILDATLVAIAEHGLVPSVQASRMTLAAAPDALQGAVAAGILGCGSVILGASESAGRLFAEVDALAGAGGDLDAAALRVVRAYRAAKHAIPGYGHPLHKQRDPRVDALFAVARDQRIELRFIAIAEAVETAVAEVLGKPLKLNVSAAIPALLLGIGFPLAALKGVPILARAAGLIAHLTEEQERPIGFALSYQAARGLVYDGAAPDPQP

Samples

Sample ID Description Type Environment
1 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
104 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
105 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
106 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
135 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
136 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
137 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
138 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
139 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
140 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
161 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
192 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
204 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
205 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
206 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
207 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
208 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
212 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
213 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
214 2738543013 Variovorax sp. BT01 Isolate Unclassified
215 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
216 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
217 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
218 2904456579 Variovorax sp. 2002 Isolate Unclassified
219 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
220 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
221 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.39
Metatranscriptomes 0.6
Isolates 3.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.04
Nodule 0.9
Rhizoplane 2.41
Rhizosphere 81.02
Stem 0
Stem Tuber 0
Unclassified 1.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495637_0004619 3300046520 Bacteria 7111
2 JGI25151J46595_10000357 3300003187 Bacteria 48666
3 rootH2_10078893 3300003320 Bacteria 1489
4 Ga0006562J51391_1073707 3300003578 Bacteria 7900
5 Ga0006562J51391_1073710 3300003578 Bacteria 4910
6 Ga0055540_1000916 3300003792 Bacteria 19242
7 Ga0070670_100201893 3300005331 Bacteria 1728
8 Ga0068869_100307561 3300005334 Bacteria 1282
9 Ga0068869_100538534 3300005334 Bacteria 979
10 Ga0070680_100112033 3300005336 Bacteria 2272
11 Ga0070682_100092181 3300005337 Bacteria 1984
12 Ga0068868_100099220 3300005338 Bacteria 2356
13 Ga0068868_100157441 3300005338 Bacteria 1874
14 Ga0070689_100089541 3300005340 Bacteria 2424
15 Ga0070661_100253436 3300005344 Bacteria 1359
16 Ga0070669_100021314 3300005353 Bacteria 4632
17 Ga0070669_100063292 3300005353 Bacteria 2723
18 Ga0070675_100072215 3300005354 Bacteria 2865
19 Ga0070675_100103738 3300005354 Bacteria 2398
20 Ga0070674_100064659 3300005356 Bacteria 2564
21 Ga0070674_100269895 3300005356 Bacteria 1344
22 Ga0070688_100141490 3300005365 Bacteria 1635
23 Ga0070659_100206197 3300005366 Bacteria 1619
24 Ga0070667_100004212 3300005367 Bacteria 12144
25 Ga0070667_100183054 3300005367 Bacteria 1853
26 Ga0070667_100256171 3300005367 Bacteria 1565
27 Ga0070667_100546635 3300005367 Bacteria 1064
28 Ga0070714_100124674 3300005435 Bacteria 2295
29 Ga0070713_100100429 3300005436 Bacteria 2505
30 Ga0070713_100263731 3300005436 Bacteria 1575
31 Ga0070701_10022995 3300005438 Bacteria 2996
32 Ga0070701_10080301 3300005438 Bacteria 1764
33 Ga0070701_10265030 3300005438 Bacteria 1043
34 Ga0070711_100091708 3300005439 Bacteria 2191
35 Ga0070711_100207604 3300005439 Unclassified 1515
36 Ga0070678_100094008 3300005456 Bacteria 2307
37 Ga0070662_100058506 3300005457 Bacteria 2805
38 Ga0070662_100164818 3300005457 Bacteria 1736
39 Ga0070681_10010823 3300005458 Bacteria 9016
40 Ga0068867_100048172 3300005459 Bacteria 3135
41 Ga0068867_100155594 3300005459 Bacteria 1799
42 Ga0070685_10060970 3300005466 Bacteria 2208
43 Ga0070685_10276924 3300005466 Bacteria 1122
44 Ga0070685_10351567 3300005466 Bacteria 1008
45 Ga0070684_100271017 3300005535 Bacteria 1554
46 Ga0068853_100396182 3300005539 Bacteria 1292
47 Ga0070672_100017856 3300005543 Bacteria 5115
48 Ga0070672_100056228 3300005543 Bacteria 3085
49 Ga0070695_100004700 3300005545 Bacteria 8034
50 Ga0070665_100012754 3300005548 Bacteria 8465
51 Ga0070665_100046891 3300005548 Bacteria 4338
52 Ga0070664_100077187 3300005564 Bacteria 2864
53 Ga0068857_100090709 3300005577 Bacteria 2735
54 Ga0068852_100642086 3300005616 Bacteria 1068
55 Ga0068859_100121470 3300005617 Bacteria 2679
56 Ga0068859_100599280 3300005617 Bacteria 1195
57 Ga0068864_100197009 3300005618 Bacteria 1849
58 Ga0068861_100101387 3300005719 Bacteria 2290
59 Ga0068861_100321438 3300005719 Bacteria 1348
60 Ga0068851_10013540 3300005834 Bacteria 3859
61 Ga0068863_100044210 3300005841 Bacteria 4228
62 Ga0068858_100073119 3300005842 Bacteria 3182
63 Ga0075363_100116778 3300006048 Bacteria 1487
64 Ga0075364_10044509 3300006051 Bacteria 2887
65 Ga0075362_10000661 3300006177 Bacteria 10159
66 Ga0075362_10037973 3300006177 Bacteria 2114
67 Ga0075367_10214765 3300006178 Bacteria 1203
68 Ga0075369_10033499 3300006186 Bacteria 2178
69 Ga0075366_10029548 3300006195 Bacteria 3220
70 Ga0075366_10031251 3300006195 Bacteria 3133
71 Ga0097621_100005591 3300006237 Bacteria 8862
72 Ga0075370_10066063 3300006353 Bacteria 2063
73 Ga0068871_100029884 3300006358 Bacteria 4285
74 Ga0075428_100007405 3300006844 Bacteria 12167
75 Ga0075428_100021183 3300006844 Bacteria 7198
76 Ga0075430_100103756 3300006846 Bacteria 2374
77 Ga0075430_100167025 3300006846 Bacteria 1831
78 Ga0075431_100000011 3300006847 Bacteria 95501
79 Ga0075431_100071016 3300006847 Bacteria 3592
80 Ga0075429_100005334 3300006880 Bacteria 11062
81 Ga0097620_100121468 3300006931 Bacteria 2679
82 Ga0097620_100599306 3300006931 Bacteria 1195
83 Ga0105240_10087784 3300009093 Bacteria 3807
84 Ga0111539_10003199 3300009094 Bacteria 21666
85 Ga0111539_11069777 3300009094 Bacteria 937
86 Ga0105243_10049972 3300009148 Bacteria 3302
87 Ga0105243_10172539 3300009148 Bacteria 1874
88 Ga0105242_10777702 3300009176 Bacteria 945
89 Ga0105237_10012264 3300009545 Bacteria 9034
90 Ga0157370_10087775 3300013104 Bacteria 2921
91 Ga0157370_10185772 3300013104 Bacteria 1930
92 Ga0163162_10205042 3300013306 Bacteria 2101
93 Ga0157372_10079362 3300013307 Bacteria 3712
94 Ga0157375_10027539 3300013308 Bacteria 5313
95 Ga0157375_10462760 3300013308 Bacteria 1434
96 Ga0163163_10008641 3300014325 Bacteria 9060
97 Ga0163163_10010812 3300014325 Bacteria 8239
98 Ga0157380_10001615 3300014326 Bacteria 14859
99 Ga0157380_10019159 3300014326 Bacteria 5097
100 Ga0157380_10030838 3300014326 Bacteria 4110
101 Ga0157380_10248455 3300014326 Bacteria 1609
102 Ga0157379_10020265 3300014968 Bacteria 5879
103 Ga0157379_10370862 3300014968 Bacteria 1312
104 Ga0157376_11020016 3300014969 Bacteria 851
105 Ga0209025_1000003 3300025294 Bacteria 1366495
106 Ga0209051_1000355 3300025303 Bacteria 67873
107 Ga0207688_10010941 3300025901 Bacteria 4937
108 Ga0207680_10284565 3300025903 Bacteria 1149
109 Ga0207707_10049023 3300025912 Bacteria 3680
110 Ga0207695_10221924 3300025913 Bacteria 1797
111 Ga0207671_10024511 3300025914 Bacteria 4534
112 Ga0207663_10091261 3300025916 Bacteria 2022
113 Ga0207649_10303894 3300025920 Bacteria 1167
114 Ga0207649_10455509 3300025920 Bacteria 966
115 Ga0207650_10086490 3300025925 Bacteria 2386
116 Ga0207650_10398913 3300025925 Bacteria 1138
117 Ga0207700_10112096 3300025928 Bacteria 2197
118 Ga0207690_10049559 3300025932 Bacteria 2801
119 Ga0207706_10021921 3300025933 Bacteria 5734
120 Ga0207706_10063806 3300025933 Bacteria 3243
121 Ga0207706_10111765 3300025933 Bacteria 2403
122 Ga0207709_10028524 3300025935 Bacteria 3227
123 Ga0207669_10036203 3300025937 Bacteria 2818
124 Ga0207669_10247069 3300025937 Bacteria 1326
125 Ga0207691_10025164 3300025940 Bacteria 5590
126 Ga0207691_10041143 3300025940 Bacteria 4268
127 Ga0207689_10140094 3300025942 Bacteria 1992
128 Ga0207689_10170093 3300025942 Bacteria 1796
129 Ga0207689_10365322 3300025942 Bacteria 1200
130 Ga0207679_10130970 3300025945 Bacteria 2012
131 Ga0207651_10101092 3300025960 Bacteria 2139
132 Ga0207658_10010187 3300025986 Bacteria 6388
133 Ga0207658_10082664 3300025986 Bacteria 2467
134 Ga0207658_10303303 3300025986 Bacteria 1377
135 Ga0207677_10399460 3300026023 Bacteria 1165
136 Ga0207639_10063553 3300026041 Bacteria 2859
137 Ga0207639_10254828 3300026041 Bacteria 1532
138 Ga0207678_10175440 3300026067 Bacteria 1830
139 Ga0207641_10020142 3300026088 Bacteria 5476
140 Ga0207641_10242709 3300026088 Bacteria 1679
141 Ga0207648_10028033 3300026089 Bacteria 4996
142 Ga0207648_10040725 3300026089 Bacteria 4081
143 Ga0207648_10224167 3300026089 Bacteria 1671
144 Ga0207648_10391798 3300026089 Bacteria 1257
145 Ga0207648_10623495 3300026089 Bacteria 995
146 Ga0207674_10067384 3300026116 Bacteria 3604
147 Ga0207675_100065365 3300026118 Bacteria 3400
148 Ga0207675_100074919 3300026118 Bacteria 3167
149 Ga0207675_100178576 3300026118 Bacteria 2032
150 Ga0207683_10111808 3300026121 Bacteria 2446
151 Ga0207683_10273707 3300026121 Bacteria 1543
152 Ga0207698_10029096 3300026142 Bacteria 3951
153 Ga0209998_10010003 3300027717 Bacteria 1965
154 Ga0207428_10001843 3300027907 Bacteria 21667
155 Ga0268265_10128517 3300028380 Bacteria 2101
156 Ga0268265_10134268 3300028380 Bacteria 2062
157 Ga0307515_10015833 3300028794 Bacteria 13863
158 Ga0307515_10021806 3300028794 Bacteria 11332
159 Ga0265338_10066009 3300028800 Bacteria 3135
160 Ga0307512_10148324 3300030522 Bacteria 1411
161 Ga0316183_1087709 3300030742 Bacteria 6762
162 Ga0265330_10025205 3300031235 Bacteria 2696
163 Ga0265332_10003009 3300031238 Bacteria 8269
164 Ga0307513_10031475 3300031456 Bacteria 6006
165 Ga0307513_10055370 3300031456 Bacteria 4245
166 Ga0307513_10282075 3300031456 Bacteria 1438
167 Ga0307509_10003989 3300031507 Bacteria 21735
168 Ga0307509_10510374 3300031507 Bacteria 885
169 Ga0307408_100080596 3300031548 Bacteria 2432
170 Ga0265314_10008127 3300031711 Bacteria 9029
171 Ga0265314_10039466 3300031711 Bacteria 3400
172 Ga0265342_10044894 3300031712 Bacteria 2662
173 Ga0265342_10046263 3300031712 Bacteria 2616
174 Ga0307516_10000610 3300031730 Bacteria 48458
175 Ga0307405_10000546 3300031731 Bacteria 14301
176 Ga0307405_10081589 3300031731 Bacteria 2114
177 Ga0307405_10372222 3300031731 Bacteria 1109
178 Ga0307413_10021474 3300031824 Bacteria 3459
179 Ga0307410_10021858 3300031852 Bacteria 3942
180 Ga0307410_10048098 3300031852 Bacteria 2854
181 Ga0307410_10169438 3300031852 Bacteria 1644
182 Ga0307407_10007455 3300031903 Bacteria 4957
183 Ga0307412_10004957 3300031911 Bacteria 7439
184 Ga0307409_100087059 3300031995 Bacteria 2544
185 Ga0307409_100092124 3300031995 Bacteria 2486
186 Ga0307409_100361126 3300031995 Bacteria 1374
187 Ga0307416_100019723 3300032002 Bacteria 4789
188 Ga0307414_10011513 3300032004 Bacteria 5192
189 Ga0307510_10001144 3300033180 Bacteria 28515
190 Ga0307510_10246557 3300033180 Bacteria 1277
191 Ga0373923_0158662 3300035111 Unclassified 1031
192 Ga0373936_0141282 3300035113 Bacteria 1040
193 Ga0373945_0115942 3300035116 Unclassified 1061
194 Ga0373956_0053162 3300035119 Bacteria 1823
195 Ga0373955_0008292 3300035172 Bacteria 4820
196 Ga0373955_0233291 3300035172 Bacteria 1101
197 Ga0373927_0150819 3300035695 Bacteria 1522
198 Ga0373933_0065556 3300035724 Bacteria 2199
199 Ga0373937_0004955 3300036401 Bacteria 11321
200 Ga0373937_0059129 3300036401 Bacteria 3522
201 Ga0373937_0400700 3300036401 Bacteria 1302
202 Ga0373925_0459602 3300037068 Bacteria 1043
203 Ga0395900_0246212 3300037418 Bacteria 1791
204 Ga0395898_0758983 3300037466 Bacteria 911
205 Ga0395905_0183988 3300037471 Bacteria 1961
206 Ga0439453_0018061 3300041408 Bacteria 1244
207 Ga0439461_0008378 3300041410 Bacteria 1851
208 Ga0450923_003369 3300042125 Bacteria 2405
209 Ga0450908_007105 3300042184 Bacteria 2115
210 Ga0439434_0012810 3300042435 Bacteria 2485
211 Ga0439435_0060541 3300042436 Bacteria 1102
212 Ga0439444_0003707 3300042437 Bacteria 2175
213 Ga0495592_0006307 3300046454 Bacteria 8825
214 Ga0495638_0007350 3300046460 Bacteria 7907
215 Ga0495606_0166895 3300046507 Bacteria 1280
216 Ga0495616_0000360 3300046513 Bacteria 35740
217 Ga0495616_0077708 3300046513 Bacteria 1593
218 Ga0495620_0093133 3300046515 Bacteria 1207
219 Ga0495597_0000746 3300046542 Bacteria 25742
220 Ga0495625_0053181 3300046660 Bacteria 2898
221 Ga0495646_0237587 3300046680 Bacteria 980
222 Ga0495671_0003435 3300046692 Bacteria 9731
223 Ga0495589_0000641 3300046794 Bacteria 22902
224 Ga0495680_0293569 3300047322 Bacteria 1143
225 Ga0495687_000161 3300047443 Bacteria 100635
226 Ga0495673_0000121 3300047469 Bacteria 144619
227 Ga0496100_0096002 3300048903 Bacteria 2033
228 Ga0496101_0200355 3300048904 Bacteria 1543
229 Ga0496104_0030657 3300048907 Bacteria 4998
230 Ga0496104_0053299 3300048907 Bacteria 3821
231 Ga0496105_0015522 3300048908 Bacteria 6071
232 Ga0496105_0407262 3300048908 Bacteria 1079
233 Ga0496114_0004383 3300048917 Bacteria 10937
234 Ga0496115_0001081 3300048918 Bacteria 19747
235 Ga0496117_0120279 3300048920 Bacteria 1615
236 Ga0496118_0089416 3300048921 Bacteria 2126
237 Ga0496121_0007402 3300048924 Bacteria 13268
238 Ga0501031_0089240 3300049568 Bacteria 2010
239 Ga0501032_0003926 3300049569 Bacteria 11289
240 Ga0501033_0004984 3300049570 Bacteria 10557
241 Ga0501034_0000163 3300049571 Bacteria 125417
242 Ga0501034_0418946 3300049571 Bacteria 1260
243 Ga0501034_0460004 3300049571 Bacteria 1189
244 Ga0501036_0012997 3300049572 Bacteria 6913
245 Ga0501036_0598296 3300049572 Unclassified 915
246 Ga0501037_0000124 3300049573 Bacteria 71522
247 Ga0501039_0047476 3300049575 Bacteria 3319
248 Ga0501039_0252044 3300049575 Bacteria 1388
249 Ga0501040_0217314 3300049576 Bacteria 1360
250 Ga0501041_0061681 3300049577 Bacteria 2295
251 Ga0501041_0325113 3300049577 Bacteria 970
252 Ga0501043_0000003 3300049579 Bacteria 318844
253 Ga0501047_0009205 3300049581 Bacteria 9323
254 Ga0501047_0059028 3300049581 Bacteria 3705
255 Ga0501067_0006251 3300049583 Bacteria 6606
256 Ga0501067_0023177 3300049583 Bacteria 3439
257 Ga0501068_0000771 3300049584 Bacteria 16509
258 Ga0501068_0027347 3300049584 Bacteria 3367
259 Ga0501068_0054843 3300049584 Bacteria 2415
260 Ga0501069_0000003 3300049585 Bacteria 210301
261 Ga0501070_0001085 3300049586 Bacteria 24426
262 Ga0501070_0080719 3300049586 Bacteria 2691
263 Ga0501072_0107947 3300049588 Bacteria 2214
264 Ga0501072_0154334 3300049588 Bacteria 1831
265 Ga0501073_0002694 3300049589 Bacteria 13298
266 Ga0501073_0013427 3300049589 Bacteria 5957
267 Ga0501074_0000007 3300049590 Bacteria 111136
268 Ga0501074_0011200 3300049590 Bacteria 6514
269 Ga0501075_0034461 3300049591 Bacteria 3770
270 Ga0501075_0116263 3300049591 Bacteria 2033
271 Ga0501075_0380521 3300049591 Bacteria 1076
272 Ga0501076_0148512 3300049592 Bacteria 1906
273 Ga0501077_0038985 3300049593 Bacteria 3025
274 Ga0501077_0052603 3300049593 Bacteria 2586
275 Ga0501079_0000016 3300049741 Bacteria 65975
276 Ga0501079_0047072 3300049741 Bacteria 3328
277 Ga0501079_0061817 3300049741 Bacteria 2889
278 Ga0501079_0087194 3300049741 Bacteria 2416
279 Ga0501079_0124639 3300049741 Bacteria 2004
280 Ga0501079_0400129 3300049741 Bacteria 1077
281 Ga0501080_0000319 3300049742 Bacteria 36724
282 Ga0501080_0000365 3300049742 Bacteria 34986
283 Ga0501081_0099332 3300049743 Bacteria 2056
284 Ga0501081_0143470 3300049743 Bacteria 1712
285 Ga0501081_0299104 3300049743 Bacteria 1180
286 Ga0501083_0000024 3300049744 Bacteria 123029
287 Ga0501083_0015178 3300049744 Bacteria 5393
288 Ga0501035_0000941 3300049822 Bacteria 30729
289 Ga0501044_0000016 3300049823 Bacteria 231626
290 Ga0501044_0142247 3300049823 Bacteria 2387
291 Ga0501045_0032868 3300049824 Bacteria 3760
292 Ga0501045_0144564 3300049824 Bacteria 1769
293 nmdc:mga03683_13458_c1 3300050489 Bacteria 3012
294 nmdc:mga03683_24447_c1 3300050489 Bacteria 2364
295 nmdc:mga03n38_237260_c1 3300050490 Bacteria 958
296 nmdc:mga00v17_68670_c1 3300050491 Bacteria 2191
297 nmdc:mga0k408_156430_c1 3300050493 Bacteria 1358
298 nmdc:mga0k408_300724_c1 3300050493 Bacteria 958
299 nmdc:mga0k408_9214_c1 3300050493 Bacteria 5318
300 nmdc:mga06z11_48173_c1 3300050494 Bacteria 1376
301 nmdc:mga07m45_56601_c1 3300050496 Bacteria 2216
302 nmdc:mga09592_860_c1 3300050508 Bacteria 23700
303 nmdc:mga0qj67_140588_c1 3300050509 Bacteria 1957
304 nmdc:mga0qj67_96721_c1 3300050509 Bacteria 2377
305 nmdc:mga06r32_45463_c1 3300050510 Bacteria 4185
306 nmdc:mga06r32_842_c1 3300050510 Bacteria 27157
307 nmdc:mga08y16_1802_c1 3300050511 Bacteria 21723
308 nmdc:mga08y16_262925_c1 3300050511 Bacteria 1782
309 nmdc:mga08y16_78728_c1 3300050511 Bacteria 3436
310 nmdc:mga0sz30_36473_c1 3300050516 Bacteria 2055
311 Ga0495619_0209838 3300053085 Bacteria 1349
312 Ga0500651_0014652 3300053093 Bacteria 4800
313 Ga0500651_0080866 3300053093 Bacteria 2012
314 Ga0500559_0000020 3300053136 Bacteria 134858
315 Ga0500564_056022 3300053138 Bacteria 1796
316 Ga0500619_005185 3300053154 Bacteria 2880
317 Ga0500622_0003341 3300053156 Bacteria 10815
318 Ga0500587_001869 3300053739 Bacteria 3002
319 Ga0501084_0089264 3300054114 Bacteria 2587
320 Ga0501082_0024508 3300060353 Bacteria 5201
321 Ga0501082_0090412 3300060353 Bacteria 2643
322 Ga0530510_0143495 3300061734 Bacteria 1760
323 2512352740 2512047030 Bacteria 9031815
324 2513953321 2513237150 Bacteria 6553639
325 2739252369 2738543013 Bacteria 5618633
326 2858697682 2858688981 Bacteria 8184122
327 2881415665 2881412998 Bacteria 6492157
328 2904453726 2904449895 Bacteria 6927402
329 2904458970 2904456579 Bacteria 6819253
330 2919707788 2919704043 Bacteria 5560311
331 2945972633 2945972063 Bacteria 6086495
332 644746992 644736347 Bacteria 6476522
333 Ga0495637_0004619
334 JGI25151J46595_10000357
335 rootH2_10078893
336 Ga0006562J51391_1073707
337 Ga0006562J51391_1073710
338 Ga0055540_1000916
339 Ga0070670_100201893
340 Ga0068869_100307561
341 Ga0068869_100538534
342 Ga0070680_100112033
343 Ga0070682_100092181
344 Ga0068868_100099220
345 Ga0068868_100157441
346 Ga0070689_100089541
347 Ga0070661_100253436
348 Ga0070669_100021314
349 Ga0070669_100063292
350 Ga0070675_100072215
351 Ga0070675_100103738
352 Ga0070674_100064659
353 Ga0070674_100269895
354 Ga0070688_100141490
355 Ga0070659_100206197
356 Ga0070667_100004212
357 Ga0070667_100183054
358 Ga0070667_100256171
359 Ga0070667_100546635
360 Ga0070714_100124674
361 Ga0070713_100100429
362 Ga0070713_100263731
363 Ga0070701_10022995
364 Ga0070701_10080301
365 Ga0070701_10265030
366 Ga0070711_100091708
367 Ga0070711_100207604
368 Ga0070678_100094008
369 Ga0070662_100058506
370 Ga0070662_100164818
371 Ga0070681_10010823
372 Ga0068867_100048172
373 Ga0068867_100155594
374 Ga0070685_10060970
375 Ga0070685_10276924
376 Ga0070685_10351567
377 Ga0070684_100271017
378 Ga0068853_100396182
379 Ga0070672_100017856
380 Ga0070672_100056228
381 Ga0070695_100004700
382 Ga0070665_100012754
383 Ga0070665_100046891
384 Ga0070664_100077187
385 Ga0068857_100090709
386 Ga0068852_100642086
387 Ga0068859_100121470
388 Ga0068859_100599280
389 Ga0068864_100197009
390 Ga0068861_100101387
391 Ga0068861_100321438
392 Ga0068851_10013540
393 Ga0068863_100044210
394 Ga0068858_100073119
395 Ga0075363_100116778
396 Ga0075364_10044509
397 Ga0075362_10000661
398 Ga0075362_10037973
399 Ga0075367_10214765
400 Ga0075369_10033499
401 Ga0075366_10029548
402 Ga0075366_10031251
403 Ga0097621_100005591
404 Ga0075370_10066063
405 Ga0068871_100029884
406 Ga0075428_100007405
407 Ga0075428_100021183
408 Ga0075430_100103756
409 Ga0075430_100167025
410 Ga0075431_100000011
411 Ga0075431_100071016
412 Ga0075429_100005334
413 Ga0097620_100121468
414 Ga0097620_100599306
415 Ga0105240_10087784
416 Ga0111539_10003199
417 Ga0111539_11069777
418 Ga0105243_10049972
419 Ga0105243_10172539
420 Ga0105242_10777702
421 Ga0105237_10012264
422 Ga0157370_10087775
423 Ga0157370_10185772
424 Ga0163162_10205042
425 Ga0157372_10079362
426 Ga0157375_10027539
427 Ga0157375_10462760
428 Ga0163163_10008641
429 Ga0163163_10010812
430 Ga0157380_10001615
431 Ga0157380_10019159
432 Ga0157380_10030838
433 Ga0157380_10248455
434 Ga0157379_10020265
435 Ga0157379_10370862
436 Ga0157376_11020016
437 Ga0209025_1000003
438 Ga0209051_1000355
439 Ga0207688_10010941
440 Ga0207680_10284565
441 Ga0207707_10049023
442 Ga0207695_10221924
443 Ga0207671_10024511
444 Ga0207663_10091261
445 Ga0207649_10303894
446 Ga0207649_10455509
447 Ga0207650_10086490
448 Ga0207650_10398913
449 Ga0207700_10112096
450 Ga0207690_10049559
451 Ga0207706_10021921
452 Ga0207706_10063806
453 Ga0207706_10111765
454 Ga0207709_10028524
455 Ga0207669_10036203
456 Ga0207669_10247069
457 Ga0207691_10025164
458 Ga0207691_10041143
459 Ga0207689_10140094
460 Ga0207689_10170093
461 Ga0207689_10365322
462 Ga0207679_10130970
463 Ga0207651_10101092
464 Ga0207658_10010187
465 Ga0207658_10082664
466 Ga0207658_10303303
467 Ga0207677_10399460
468 Ga0207639_10063553
469 Ga0207639_10254828
470 Ga0207678_10175440
471 Ga0207641_10020142
472 Ga0207641_10242709
473 Ga0207648_10028033
474 Ga0207648_10040725
475 Ga0207648_10224167
476 Ga0207648_10391798
477 Ga0207648_10623495
478 Ga0207674_10067384
479 Ga0207675_100065365
480 Ga0207675_100074919
481 Ga0207675_100178576
482 Ga0207683_10111808
483 Ga0207683_10273707
484 Ga0207698_10029096
485 Ga0209998_10010003
486 Ga0207428_10001843
487 Ga0268265_10128517
488 Ga0268265_10134268
489 Ga0307515_10015833
490 Ga0307515_10021806
491 Ga0265338_10066009
492 Ga0307512_10148324
493 Ga0316183_1087709
494 Ga0265330_10025205
495 Ga0265332_10003009
496 Ga0307513_10031475
497 Ga0307513_10055370
498 Ga0307513_10282075
499 Ga0307509_10003989
500 Ga0307509_10510374
501 Ga0307408_100080596
502 Ga0265314_10008127
503 Ga0265314_10039466
504 Ga0265342_10044894
505 Ga0265342_10046263
506 Ga0307516_10000610
507 Ga0307405_10000546
508 Ga0307405_10081589
509 Ga0307405_10372222
510 Ga0307413_10021474
511 Ga0307410_10021858
512 Ga0307410_10048098
513 Ga0307410_10169438
514 Ga0307407_10007455
515 Ga0307412_10004957
516 Ga0307409_100087059
517 Ga0307409_100092124
518 Ga0307409_100361126
519 Ga0307416_100019723
520 Ga0307414_10011513
521 Ga0307510_10001144
522 Ga0307510_10246557
523 Ga0373923_0158662
524 Ga0373936_0141282
525 Ga0373945_0115942
526 Ga0373956_0053162
527 Ga0373955_0008292
528 Ga0373955_0233291
529 Ga0373927_0150819
530 Ga0373933_0065556
531 Ga0373937_0004955
532 Ga0373937_0059129
533 Ga0373937_0400700
534 Ga0373925_0459602
535 Ga0395900_0246212
536 Ga0395898_0758983
537 Ga0395905_0183988
538 Ga0439453_0018061
539 Ga0439461_0008378
540 Ga0450923_003369
541 Ga0450908_007105
542 Ga0439434_0012810
543 Ga0439435_0060541
544 Ga0439444_0003707
545 Ga0495592_0006307
546 Ga0495638_0007350
547 Ga0495606_0166895
548 Ga0495616_0000360
549 Ga0495616_0077708
550 Ga0495620_0093133
551 Ga0495597_0000746
552 Ga0495625_0053181
553 Ga0495646_0237587
554 Ga0495671_0003435
555 Ga0495589_0000641
556 Ga0495680_0293569
557 Ga0495687_000161
558 Ga0495673_0000121
559 Ga0496100_0096002
560 Ga0496101_0200355
561 Ga0496104_0030657
562 Ga0496104_0053299
563 Ga0496105_0015522
564 Ga0496105_0407262
565 Ga0496114_0004383
566 Ga0496115_0001081
567 Ga0496117_0120279
568 Ga0496118_0089416
569 Ga0496121_0007402
570 Ga0501031_0089240
571 Ga0501032_0003926
572 Ga0501033_0004984
573 Ga0501034_0000163
574 Ga0501034_0418946
575 Ga0501034_0460004
576 Ga0501036_0012997
577 Ga0501036_0598296
578 Ga0501037_0000124
579 Ga0501039_0047476
580 Ga0501039_0252044
581 Ga0501040_0217314
582 Ga0501041_0061681
583 Ga0501041_0325113
584 Ga0501043_0000003
585 Ga0501047_0009205
586 Ga0501047_0059028
587 Ga0501067_0006251
588 Ga0501067_0023177
589 Ga0501068_0000771
590 Ga0501068_0027347
591 Ga0501068_0054843
592 Ga0501069_0000003
593 Ga0501070_0001085
594 Ga0501070_0080719
595 Ga0501072_0107947
596 Ga0501072_0154334
597 Ga0501073_0002694
598 Ga0501073_0013427
599 Ga0501074_0000007
600 Ga0501074_0011200
601 Ga0501075_0034461
602 Ga0501075_0116263
603 Ga0501075_0380521
604 Ga0501076_0148512
605 Ga0501077_0038985
606 Ga0501077_0052603
607 Ga0501079_0000016
608 Ga0501079_0047072
609 Ga0501079_0061817
610 Ga0501079_0087194
611 Ga0501079_0124639
612 Ga0501079_0400129
613 Ga0501080_0000319
614 Ga0501080_0000365
615 Ga0501081_0099332
616 Ga0501081_0143470
617 Ga0501081_0299104
618 Ga0501083_0000024
619 Ga0501083_0015178
620 Ga0501035_0000941
621 Ga0501044_0000016
622 Ga0501044_0142247
623 Ga0501045_0032868
624 Ga0501045_0144564
625 nmdc:mga03683_13458_c1
626 nmdc:mga03683_24447_c1
627 nmdc:mga03n38_237260_c1
628 nmdc:mga00v17_68670_c1
629 nmdc:mga0k408_156430_c1
630 nmdc:mga0k408_300724_c1
631 nmdc:mga0k408_9214_c1
632 nmdc:mga06z11_48173_c1
633 nmdc:mga07m45_56601_c1
634 nmdc:mga09592_860_c1
635 nmdc:mga0qj67_140588_c1
636 nmdc:mga0qj67_96721_c1
637 nmdc:mga06r32_45463_c1
638 nmdc:mga06r32_842_c1
639 nmdc:mga08y16_1802_c1
640 nmdc:mga08y16_262925_c1
641 nmdc:mga08y16_78728_c1
642 nmdc:mga0sz30_36473_c1
643 Ga0495619_0209838
644 Ga0500651_0014652
645 Ga0500651_0080866
646 Ga0500559_0000020
647 Ga0500564_056022
648 Ga0500619_005185
649 Ga0500622_0003341
650 Ga0500587_001869
651 Ga0501084_0089264
652 Ga0501082_0024508
653 Ga0501082_0090412
654 Ga0530510_0143495
655 2512352740
656 2513953321
657 2739252369
658 2858697682
659 2881415665
660 2904453726
661 2904458970
662 2919707788
663 2945972633
664 644746992

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00285

Citrate_synt

Citrate synthase, C-terminal domain

60

277

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bol-assembly1.cif.gz_A crystal structure of mutant 2-methylcitrate synthase mcsag419a from aspergillus fumigatus. 0.8275 37 244
6hxp-assembly1.cif.gz_A structure of citryl-coa lyase from hydrogenobacter thermophilus 0.8191 8 265
2cts-assembly1.cif.gz_A-2 crystallographic refinement and atomic models of two different forms of citrate synthase at 2.7 and 1.7 angstroms resolution 0.8167 35 244
8gr9-assembly1.cif.gz_A crystal structure of peroxisomal citrate synthase (cit2) from saccharomyces cerevisiae in complex with oxaloacetate and coenzyme-a 0.8152 36 244
6hxm-assembly1.cif.gz_B structure of the citryl-coa lyase core module of human atp citrate lyase in complex with citrate and coash in space group c2221 0.8063 5 244
ID Description Score Start End Superfamily
af_Q8I6U7_394_509_1.10.580.10 Mainly Alpha;Orthogonal Bundle;Citrate Synthase; domain 1;Citrate Synthase, domain 1 0.8339 108 212 1.10.580.10
1aj8B02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 0.7692 107 210 1.10.230.10
2p2wA02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 0.7614 107 209 1.10.230.10
af_Q8I6U7_394_509_1.10.580.10 Mainly Alpha;Orthogonal Bundle;Citrate Synthase; domain 1;Citrate Synthase, domain 1 0.7583 108 212 1.10.580.10
1ixeD02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 0.7534 107 209 1.10.230.10
ID Description Score Start End GO Terms
AF-A0A1Q7FC13-F1-model_v4 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) 0.9365 31 242 GO:0004108
GO:0005829
GO:0005975
GO:0006099
GO:0016829
AF-A0A3S4RPE3-F1-model_v4 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) 0.934 9 242 GO:0004108
GO:0005829
GO:0005975
GO:0006099
AF-A0A4R7W3Z7-F1-model_v4 Citrate synthase 0.9336 5 96 GO:0046912
AF-A0A494WFX7-F1-model_v4 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) 0.9309 4 242 GO:0004108
GO:0005829
GO:0005975
GO:0006099
GO:0016829
AF-A0A848Q153-F1-model_v4 deleted 0.9277 7 239

Map