F411459

General Info

Members Datasets Scaffolds Average Seq Length
333 201 666 167

Family's Representative Sequence

Representative Sequence 3300041511|Ga0451855_0797101|Ga0451855_0797101_37_555
Length 172
Sequence MSSLNLDAEALYADLLAGVRGLMQPDSVLVGVWSGGAWLAERLQRDLNRPGEHGVISSALHRDDFGSRGLTAGADHTKLPFEIEGRAIVLVDDVLYTGRTIRAVLNELFDFGRPSRVRLAVLVDRGGRELPVAADFSAAQLALPGSQSLALARDTAGALTFKVEGDEQNGSR

Samples

Sample ID Description Type Environment
1 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
44 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
94 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
104 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
105 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
116 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
119 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
120 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
128 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
129 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
130 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
131 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
132 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
133 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
134 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
135 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
136 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
137 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
157 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
158 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
187 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
188 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
189 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
190 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
191 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
192 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
193 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
194 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
195 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
196 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
197 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
198 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
200 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
201 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.12
Nodule 0.6
Rhizoplane 1.2
Rhizosphere 60.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451855_0797101 3300041511 Bacteria 598
2 rootH1_10019038 3300003316 Bacteria 16187
3 rootH2_10026101 3300003320 Bacteria 14166
4 rootL2_10001663 3300003322 Bacteria 58458
5 Ga0055525_1000031 3300003759 Bacteria 314909
6 Ga0055526_1005001 3300003771 Bacteria 7756
7 Ga0055524_1043109 3300003775 Bacteria 1114
8 Ga0055528_1060118 3300003790 Bacteria 721
9 Ga0055530_10047457 3300003791 Bacteria 1014
10 Ga0055531_10030368 3300003794 Bacteria 1816
11 Ga0065165_1000016 3300005262 Bacteria 286248
12 Ga0065165_1000295 3300005262 Bacteria 84323
13 Ga0070676_10047104 3300005328 Bacteria 2516
14 Ga0070670_100072880 3300005331 Bacteria 2949
15 Ga0070670_100463608 3300005331 Bacteria 1124
16 Ga0070677_10005381 3300005333 Bacteria 4216
17 Ga0068869_100165650 3300005334 Bacteria 1724
18 Ga0070666_10952583 3300005335 Bacteria 636
19 Ga0070668_100842043 3300005347 Bacteria 817
20 Ga0070675_100140544 3300005354 Bacteria 2064
21 Ga0070671_100063604 3300005355 Bacteria 3073
22 Ga0070673_100028998 3300005364 Bacteria 4123
23 Ga0070667_100092786 3300005367 Bacteria 2599
24 Ga0070667_100104514 3300005367 Bacteria 2450
25 Ga0070667_100270798 3300005367 Bacteria 1523
26 Ga0070667_100440525 3300005367 Bacteria 1190
27 Ga0070678_100135694 3300005456 Bacteria 1962
28 Ga0070678_100305769 3300005456 Bacteria 1353
29 Ga0070678_100501531 3300005456 Bacteria 1071
30 Ga0070662_100010654 3300005457 Bacteria 6046
31 Ga0070662_100024926 3300005457 Bacteria 4126
32 Ga0070662_100026753 3300005457 Bacteria 3998
33 Ga0068867_100027771 3300005459 Bacteria 4071
34 Ga0070706_100001989 3300005467 Bacteria 21077
35 Ga0070707_100106169 3300005468 Bacteria 2724
36 Ga0070707_100949465 3300005468 Bacteria 825
37 Ga0070698_100281424 3300005471 Bacteria 1595
38 Ga0070672_100019274 3300005543 Bacteria 4948
39 Ga0070672_100047105 3300005543 Bacteria 3344
40 Ga0070665_100009294 3300005548 Bacteria 9950
41 Ga0068857_100040466 3300005577 Bacteria 4132
42 Ga0068857_100075815 3300005577 Bacteria 2999
43 Ga0068857_100422121 3300005577 Bacteria 1244
44 Ga0068854_100036287 3300005578 Bacteria 3456
45 Ga0068854_100328206 3300005578 Bacteria 1246
46 Ga0068854_100900075 3300005578 Bacteria 778
47 Ga0068852_100349271 3300005616 Bacteria 1444
48 Ga0068852_101290923 3300005616 Bacteria 752
49 Ga0068860_100559237 3300005843 Bacteria 1147
50 Ga0075368_10104720 3300006042 Bacteria 1164
51 Ga0075363_100063844 3300006048 Bacteria 1989
52 Ga0075363_100264603 3300006048 Bacteria 992
53 Ga0075363_100285820 3300006048 Bacteria 955
54 Ga0075364_10048646 3300006051 Bacteria 2763
55 Ga0075362_10008014 3300006177 Bacteria 4024
56 Ga0075362_10062478 3300006177 Bacteria 1687
57 Ga0075367_10145321 3300006178 Bacteria 1470
58 Ga0075367_10221794 3300006178 Bacteria 1183
59 Ga0075369_10174936 3300006186 Bacteria 987
60 Ga0075366_10002132 3300006195 Bacteria 10062
61 Ga0075366_10003436 3300006195 Bacteria 8355
62 Ga0075366_10016499 3300006195 Bacteria 4247
63 Ga0075366_10019044 3300006195 Bacteria 3967
64 Ga0075366_10052710 3300006195 Bacteria 2417
65 Ga0075366_10082756 3300006195 Bacteria 1918
66 Ga0075366_10129351 3300006195 Bacteria 1523
67 Ga0075366_10472366 3300006195 Bacteria 774
68 Ga0075370_10001833 3300006353 Bacteria 9509
69 Ga0075370_10012067 3300006353 Bacteria 4557
70 Ga0075370_10172810 3300006353 Bacteria 1270
71 Ga0075370_10210603 3300006353 Bacteria 1148
72 Ga0068865_100219500 3300006881 Bacteria 1486
73 Ga0068865_101425911 3300006881 Bacteria 619
74 Ga0099823_1000599 3300006944 Bacteria 25182
75 Ga0105244_10272125 3300009036 Bacteria 787
76 Ga0105245_10361570 3300009098 Bacteria 1441
77 Ga0105245_10661749 3300009098 Bacteria 1075
78 Ga0105243_10116593 3300009148 Bacteria 2244
79 Ga0105243_10134132 3300009148 Bacteria 2104
80 Ga0105243_10621421 3300009148 Bacteria 1043
81 Ga0105242_12144920 3300009176 Bacteria 603
82 Ga0105238_10611319 3300009551 Bacteria 1098
83 Ga0105249_10149877 3300009553 Bacteria 2245
84 Ga0105239_10191778 3300010375 Bacteria 2287
85 Ga0157319_1000015 3300012497 Bacteria 130857
86 Ga0157374_10916377 3300013296 Bacteria 894
87 Ga0157375_10026655 3300013308 Bacteria 5391
88 Ga0157375_10617205 3300013308 Bacteria 1243
89 Ga0157379_10006085 3300014968 Bacteria 10389
90 Ga0157379_10268269 3300014968 Bacteria 1552
91 Ga0157379_10415118 3300014968 Bacteria 1239
92 Ga0157379_11052042 3300014968 Bacteria 778
93 Ga0157376_10233468 3300014969 Bacteria 1710
94 Ga0213872_10000068 3300021361 Bacteria 91693
95 Ga0213872_10000085 3300021361 Bacteria 85496
96 Ga0213872_10078434 3300021361 Bacteria 1484
97 Ga0209563_100044 3300025230 Bacteria 396812
98 Ga0209673_1007976 3300025273 Bacteria 4777
99 Ga0209673_1025618 3300025273 Bacteria 1957
100 Ga0209673_1066915 3300025273 Bacteria 871
101 Ga0209564_1000008 3300025295 Bacteria 953227
102 Ga0209050_1004240 3300025298 Bacteria 9849
103 Ga0209256_1000394 3300025299 Bacteria 69416
104 Ga0209256_1000665 3300025299 Bacteria 46496
105 Ga0209256_1026754 3300025299 Bacteria 1656
106 Ga0209051_1002242 3300025303 Bacteria 14225
107 Ga0209257_1002885 3300025304 Bacteria 15977
108 Ga0209257_1003453 3300025304 Bacteria 13539
109 Ga0209257_1078042 3300025304 Bacteria 856
110 Ga0207682_10029864 3300025893 Bacteria 2181
111 Ga0207645_10042344 3300025907 Bacteria 2914
112 Ga0207705_10651988 3300025909 Bacteria 819
113 Ga0207681_10967294 3300025923 Bacteria 714
114 Ga0207694_10911291 3300025924 Bacteria 743
115 Ga0207650_10699826 3300025925 Bacteria 856
116 Ga0207659_10156410 3300025926 Bacteria 1785
117 Ga0207687_10554827 3300025927 Bacteria 964
118 Ga0207644_10068193 3300025931 Bacteria 2595
119 Ga0207644_10170756 3300025931 Bacteria 1697
120 Ga0207690_10581555 3300025932 Bacteria 913
121 Ga0207706_10012036 3300025933 Bacteria 7882
122 Ga0207706_10035342 3300025933 Bacteria 4444
123 Ga0207706_10224762 3300025933 Bacteria 1643
124 Ga0207709_10577861 3300025935 Bacteria 887
125 Ga0207704_10373313 3300025938 Bacteria 1117
126 Ga0207704_10682763 3300025938 Bacteria 849
127 Ga0207691_10011834 3300025940 Bacteria 8375
128 Ga0207691_10067232 3300025940 Bacteria 3241
129 Ga0207711_10429789 3300025941 Bacteria 1229
130 Ga0207689_10245405 3300025942 Bacteria 1481
131 Ga0207651_10092142 3300025960 Bacteria 2221
132 Ga0207640_10056686 3300025981 Bacteria 2574
133 Ga0207640_10578614 3300025981 Bacteria 947
134 Ga0207658_10021136 3300025986 Bacteria 4513
135 Ga0207658_10062048 3300025986 Bacteria 2796
136 Ga0207658_10071103 3300025986 Bacteria 2634
137 Ga0207658_10262232 3300025986 Bacteria 1473
138 Ga0207677_10061290 3300026023 Bacteria 2604
139 Ga0207677_10096279 3300026023 Bacteria 2165
140 Ga0207703_10095184 3300026035 Bacteria 2512
141 Ga0207678_10136356 3300026067 Bacteria 2094
142 Ga0207641_10096374 3300026088 Bacteria 2598
143 Ga0207641_10905904 3300026088 Bacteria 876
144 Ga0207648_10006420 3300026089 Bacteria 11685
145 Ga0207648_10306685 3300026089 Bacteria 1425
146 Ga0207648_10949916 3300026089 Bacteria 804
147 Ga0207676_10059558 3300026095 Bacteria 3016
148 Ga0207674_10027268 3300026116 Bacteria 6047
149 Ga0207674_10074209 3300026116 Bacteria 3414
150 Ga0207674_10400927 3300026116 Bacteria 1326
151 Ga0207674_12039156 3300026116 Bacteria 538
152 Ga0207675_100924676 3300026118 Bacteria 889
153 Ga0207683_10072613 3300026121 Bacteria 3043
154 Ga0207683_10092840 3300026121 Bacteria 2690
155 Ga0207698_11672218 3300026142 Bacteria 652
156 Ga0209389_1000674 3300027296 Bacteria 21228
157 Ga0209371_1037874 3300027312 Bacteria 998
158 Ga0209981_1018484 3300027378 Bacteria 988
159 Ga0209968_1000327 3300027526 Bacteria 7968
160 Ga0209966_1000008 3300027695 Bacteria 88938
161 Ga0209813_10151077 3300027866 Bacteria 832
162 Ga0268266_10017822 3300028379 Bacteria 6051
163 Ga0268264_10235232 3300028381 Bacteria 1694
164 Ga0268264_10642192 3300028381 Bacteria 1050
165 Ga0307517_10000131 3300028786 Bacteria 113233
166 Ga0307517_10092854 3300028786 Bacteria 2452
167 Ga0307517_10168358 3300028786 Bacteria 1448
168 Ga0307517_10282119 3300028786 Bacteria 946
169 Ga0307515_10013344 3300028794 Bacteria 15367
170 Ga0307515_10054228 3300028794 Bacteria 5891
171 Ga0307515_10079998 3300028794 Bacteria 4270
172 Ga0307515_10358287 3300028794 Bacteria 1101
173 Ga0307515_10430840 3300028794 Bacteria 937
174 Ga0268256_1043081 3300030500 Bacteria 998
175 Ga0307512_10016812 3300030522 Bacteria 6737
176 Ga0307512_10223106 3300030522 Bacteria 981
177 Ga0265328_10022508 3300031239 Bacteria 2398
178 Ga0265331_10027151 3300031250 Bacteria 2872
179 Ga0265327_10000042 3300031251 Bacteria 287487
180 Ga0307513_10018531 3300031456 Bacteria 8314
181 Ga0307513_10022575 3300031456 Bacteria 7390
182 Ga0307513_10080196 3300031456 Bacteria 3368
183 Ga0307513_10211654 3300031456 Bacteria 1769
184 Ga0307513_10281775 3300031456 Bacteria 1439
185 Ga0307513_10311822 3300031456 Bacteria 1335
186 Ga0307509_10000871 3300031507 Bacteria 52060
187 Ga0307509_10005828 3300031507 Bacteria 16897
188 Ga0307509_10044981 3300031507 Bacteria 4766
189 Ga0307509_10062052 3300031507 Bacteria 3943
190 Ga0307509_10185538 3300031507 Bacteria 1939
191 Ga0307509_10272130 3300031507 Bacteria 1460
192 Ga0307408_100014960 3300031548 Bacteria 5163
193 Ga0307508_10004592 3300031616 Bacteria 13439
194 Ga0307508_10034229 3300031616 Bacteria 4581
195 Ga0307508_10101314 3300031616 Bacteria 2475
196 Ga0307508_10407561 3300031616 Bacteria 951
197 Ga0307514_10029986 3300031649 Bacteria 4368
198 Ga0307514_10129160 3300031649 Bacteria 1744
199 Ga0307514_10328137 3300031649 Bacteria 834
200 Ga0307516_10021959 3300031730 Bacteria 6557
201 Ga0307516_10074845 3300031730 Bacteria 3241
202 Ga0307516_10180868 3300031730 Bacteria 1842
203 Ga0307516_10278622 3300031730 Bacteria 1355
204 Ga0307516_10330205 3300031730 Bacteria 1194
205 Ga0307405_10199575 3300031731 Bacteria 1452
206 Ga0307518_10402089 3300031838 Bacteria 763
207 Ga0307507_10240118 3300033179 Bacteria 1187
208 Ga0307510_10011005 3300033180 Bacteria 10757
209 Ga0307510_10053936 3300033180 Bacteria 4218
210 Ga0307510_10199241 3300033180 Bacteria 1539
211 Ga0307510_10211413 3300033180 Bacteria 1461
212 Ga0373928_0064353 3300035084 Bacteria 894
213 Ga0373944_0205896 3300035089 Bacteria 714
214 Ga0373932_0008052 3300035112 Bacteria 2516
215 Ga0373937_0236167 3300036401 Bacteria 1722
216 Ga0373925_0242332 3300037068 Bacteria 1444
217 Ga0395900_0000058 3300037418 Bacteria 206785
218 Ga0395898_0016745 3300037466 Bacteria 7491
219 Ga0395905_0013060 3300037471 Bacteria 7976
220 Ga0395905_0028074 3300037471 Bacteria 5306
221 Ga0436361_0019641 3300039447 Bacteria 127735
222 Ga0436361_0882397 3300039447 Bacteria 35518
223 Ga0436361_0960381 3300039447 Bacteria 2708
224 Ga0451791_0876899 3300041451 Bacteria 704
225 Ga0451797_0367293 3300041453 Bacteria 1314
226 Ga0451847_0153758 3300041503 Bacteria 1271
227 Ga0451853_2673283 3300041512 Bacteria 1496
228 Ga0439450_014250 3300042008 Bacteria 1610
229 Ga0439455_0175083 3300042012 Bacteria 617
230 Ga0439457_032626 3300042014 Bacteria 1156
231 Ga0439462_0134547 3300042015 Bacteria 691
232 Ga0450898_006278 3300042134 Bacteria 1819
233 Ga0450899_008572 3300042135 Bacteria 1120
234 Ga0439458_0098469 3300042157 Bacteria 758
235 Ga0451577_0004058 3300042876 Bacteria 15735
236 Ga0466969_0000013 3300044656 Bacteria 111537
237 Ga0466972_0001525 3300044658 Bacteria 11286
238 Ga0466972_0009928 3300044658 Bacteria 4778
239 Ga0466972_0170614 3300044658 Bacteria 1021
240 Ga0466972_0435637 3300044658 Bacteria 615
241 Ga0466965_0550258 3300044683 Bacteria 651
242 Ga0466966_0031511 3300044684 Bacteria 3437
243 Ga0466966_0036978 3300044684 Bacteria 3150
244 Ga0466961_0006151 3300044693 Bacteria 7618
245 Ga0466961_0167275 3300044693 Bacteria 1368
246 Ga0466963_0047955 3300044694 Bacteria 2820
247 Ga0466963_0062175 3300044694 Bacteria 2498
248 Ga0466964_0025739 3300044706 Bacteria 2299
249 Ga0466964_0086321 3300044706 Bacteria 1357
250 Ga0453684_0043091 3300044712 Bacteria 6072
251 Ga0453684_0099514 3300044712 Bacteria 3562
252 Ga0453684_0256300 3300044712 Bacteria 2006
253 Ga0466971_0167058 3300044719 Bacteria 1031
254 Ga0466971_0378451 3300044719 Bacteria 688
255 Ga0466970_0168350 3300044765 Bacteria 1214
256 Ga0466960_0065769 3300044901 Bacteria 1791
257 Ga0466960_0456048 3300044901 Bacteria 744
258 Ga0466959_0000491 3300045049 Bacteria 23088
259 Ga0466959_0186145 3300045049 Bacteria 1450
260 Ga0451576_0120640 3300045051 Bacteria 2729
261 Ga0451576_0638243 3300045051 Bacteria 1119
262 Ga0451576_0935895 3300045051 Bacteria 909
263 Ga0466958_0045654 3300045836 Bacteria 2643
264 Ga0466967_0018595 3300045976 Bacteria 5559
265 Ga0495592_0000487 3300046454 Bacteria 28905
266 Ga0495592_0165323 3300046454 Bacteria 1519
267 Ga0495638_0044045 3300046460 Bacteria 2813
268 Ga0495638_0587853 3300046460 Bacteria 548
269 Ga0495632_0027078 3300046519 Bacteria 3007
270 Ga0495648_0166328 3300046524 Bacteria 1135
271 Ga0495648_0227367 3300046524 Bacteria 916
272 Ga0495666_0253843 3300046526 Bacteria 801
273 Ga0495621_0011117 3300046539 Bacteria 2775
274 Ga0495621_0262678 3300046539 Bacteria 707
275 Ga0495597_0010867 3300046542 Bacteria 4431
276 Ga0495656_0363420 3300046615 Bacteria 752
277 Ga0495668_0127987 3300046616 Bacteria 1390
278 Ga0495611_0248977 3300046648 Bacteria 824
279 Ga0495658_0275703 3300046683 Bacteria 1061
280 Ga0495613_0490851 3300046689 Bacteria 828
281 Ga0495613_0768497 3300046689 Bacteria 630
282 Ga0495671_0252700 3300046692 Bacteria 851
283 Ga0495581_0462759 3300047315 Bacteria 738
284 Ga0495676_0088584 3300047321 Bacteria 2321
285 Ga0495687_000582 3300047443 Bacteria 42863
286 Ga0495673_0133701 3300047469 Bacteria 973
287 Ga0495686_0005518 3300047472 Bacteria 9951
288 Ga0495602_0178092 3300048088 Bacteria 1643
289 Ga0495626_0073219 3300048091 Bacteria 1535
290 Ga0496109_0041196 3300048912 Bacteria 4185
291 Ga0496109_0440321 3300048912 Bacteria 1231
292 Ga0496124_0004638 3300048927 Bacteria 15918
293 Ga0496126_0543427 3300048929 Bacteria 923
294 Ga0495682_0178981 3300049460 Bacteria 754
295 Ga0501047_0373539 3300049581 Bacteria 1261
296 nmdc:mga03683_19978_c1 3300050489 Bacteria 2564
297 nmdc:mga03683_7705_c1 3300050489 Bacteria 3752
298 nmdc:mga03n38_237146_c1 3300050490 Bacteria 958
299 nmdc:mga00v17_48807_c1 3300050491 Bacteria 2566
300 nmdc:mga0k408_1085_c1 3300050493 Bacteria 14934
301 nmdc:mga0k408_119767_c1 3300050493 Bacteria 1559
302 nmdc:mga0k408_215240_c1 3300050493 Bacteria 1147
303 nmdc:mga0k408_2362_c1 3300050493 Bacteria 10038
304 nmdc:mga0k408_41769_c1 3300050493 Bacteria 2640
305 nmdc:mga0k408_461750_c1 3300050493 Bacteria 754
306 nmdc:mga0k408_49392_c1 3300050493 Bacteria 2435
307 nmdc:mga0k408_5670_c2 3300050493 Bacteria 6007
308 nmdc:mga0k408_66001_c1 3300050493 Bacteria 2107
309 nmdc:mga0k408_84755_c1 3300050493 Bacteria 1859
310 nmdc:mga0k408_93030_c1 3300050493 Bacteria 1773
311 nmdc:mga06z11_62313_c1 3300050494 Bacteria 1948
312 nmdc:mga04h51_75491_c1 3300050495 Bacteria 1186
313 nmdc:mga07m45_10965_c1 3300050496 Bacteria 4750
314 nmdc:mga07m45_11387_c1 3300050496 Bacteria 4671
315 nmdc:mga07m45_389686_c1 3300050496 Bacteria 809
316 nmdc:mga07m45_9497_c1 3300050496 Bacteria 5049
317 Ga0495655_0080129 3300053083 Bacteria 932
318 Ga0500578_0155331 3300053086 Bacteria 1423
319 Ga0500651_0070840 3300053093 Bacteria 2170
320 Ga0500594_0004519 3300053118 Bacteria 3067
321 Ga0500559_0000726 3300053136 Bacteria 21708
322 Ga0500568_0085490 3300053139 Bacteria 1194
323 Ga0500590_182972 3300053148 Bacteria 907
324 Ga0500620_186072 3300053155 Bacteria 714
325 Ga0500622_0033406 3300053156 Bacteria 2697
326 Ga0500636_0189471 3300053177 Bacteria 1097
327 Ga0500637_0520516 3300053178 Bacteria 584
328 Ga0500645_043008 3300053730 Bacteria 1331
329 Ga0500587_009154 3300053739 Bacteria 1268
330 Ga0466962_0056183 3300061719 Bacteria 1880
331 Ga0466962_0242743 3300061719 Bacteria 884
332 2644303014 2643221654 Bacteria 5273570
333 2886852788 2886848708 Bacteria 5632523
334 Ga0451855_0797101
335 rootH1_10019038
336 rootH2_10026101
337 rootL2_10001663
338 Ga0055525_1000031
339 Ga0055526_1005001
340 Ga0055524_1043109
341 Ga0055528_1060118
342 Ga0055530_10047457
343 Ga0055531_10030368
344 Ga0065165_1000016
345 Ga0065165_1000295
346 Ga0070676_10047104
347 Ga0070670_100072880
348 Ga0070670_100463608
349 Ga0070677_10005381
350 Ga0068869_100165650
351 Ga0070666_10952583
352 Ga0070668_100842043
353 Ga0070675_100140544
354 Ga0070671_100063604
355 Ga0070673_100028998
356 Ga0070667_100092786
357 Ga0070667_100104514
358 Ga0070667_100270798
359 Ga0070667_100440525
360 Ga0070678_100135694
361 Ga0070678_100305769
362 Ga0070678_100501531
363 Ga0070662_100010654
364 Ga0070662_100024926
365 Ga0070662_100026753
366 Ga0068867_100027771
367 Ga0070706_100001989
368 Ga0070707_100106169
369 Ga0070707_100949465
370 Ga0070698_100281424
371 Ga0070672_100019274
372 Ga0070672_100047105
373 Ga0070665_100009294
374 Ga0068857_100040466
375 Ga0068857_100075815
376 Ga0068857_100422121
377 Ga0068854_100036287
378 Ga0068854_100328206
379 Ga0068854_100900075
380 Ga0068852_100349271
381 Ga0068852_101290923
382 Ga0068860_100559237
383 Ga0075368_10104720
384 Ga0075363_100063844
385 Ga0075363_100264603
386 Ga0075363_100285820
387 Ga0075364_10048646
388 Ga0075362_10008014
389 Ga0075362_10062478
390 Ga0075367_10145321
391 Ga0075367_10221794
392 Ga0075369_10174936
393 Ga0075366_10002132
394 Ga0075366_10003436
395 Ga0075366_10016499
396 Ga0075366_10019044
397 Ga0075366_10052710
398 Ga0075366_10082756
399 Ga0075366_10129351
400 Ga0075366_10472366
401 Ga0075370_10001833
402 Ga0075370_10012067
403 Ga0075370_10172810
404 Ga0075370_10210603
405 Ga0068865_100219500
406 Ga0068865_101425911
407 Ga0099823_1000599
408 Ga0105244_10272125
409 Ga0105245_10361570
410 Ga0105245_10661749
411 Ga0105243_10116593
412 Ga0105243_10134132
413 Ga0105243_10621421
414 Ga0105242_12144920
415 Ga0105238_10611319
416 Ga0105249_10149877
417 Ga0105239_10191778
418 Ga0157319_1000015
419 Ga0157374_10916377
420 Ga0157375_10026655
421 Ga0157375_10617205
422 Ga0157379_10006085
423 Ga0157379_10268269
424 Ga0157379_10415118
425 Ga0157379_11052042
426 Ga0157376_10233468
427 Ga0213872_10000068
428 Ga0213872_10000085
429 Ga0213872_10078434
430 Ga0209563_100044
431 Ga0209673_1007976
432 Ga0209673_1025618
433 Ga0209673_1066915
434 Ga0209564_1000008
435 Ga0209050_1004240
436 Ga0209256_1000394
437 Ga0209256_1000665
438 Ga0209256_1026754
439 Ga0209051_1002242
440 Ga0209257_1002885
441 Ga0209257_1003453
442 Ga0209257_1078042
443 Ga0207682_10029864
444 Ga0207645_10042344
445 Ga0207705_10651988
446 Ga0207681_10967294
447 Ga0207694_10911291
448 Ga0207650_10699826
449 Ga0207659_10156410
450 Ga0207687_10554827
451 Ga0207644_10068193
452 Ga0207644_10170756
453 Ga0207690_10581555
454 Ga0207706_10012036
455 Ga0207706_10035342
456 Ga0207706_10224762
457 Ga0207709_10577861
458 Ga0207704_10373313
459 Ga0207704_10682763
460 Ga0207691_10011834
461 Ga0207691_10067232
462 Ga0207711_10429789
463 Ga0207689_10245405
464 Ga0207651_10092142
465 Ga0207640_10056686
466 Ga0207640_10578614
467 Ga0207658_10021136
468 Ga0207658_10062048
469 Ga0207658_10071103
470 Ga0207658_10262232
471 Ga0207677_10061290
472 Ga0207677_10096279
473 Ga0207703_10095184
474 Ga0207678_10136356
475 Ga0207641_10096374
476 Ga0207641_10905904
477 Ga0207648_10006420
478 Ga0207648_10306685
479 Ga0207648_10949916
480 Ga0207676_10059558
481 Ga0207674_10027268
482 Ga0207674_10074209
483 Ga0207674_10400927
484 Ga0207674_12039156
485 Ga0207675_100924676
486 Ga0207683_10072613
487 Ga0207683_10092840
488 Ga0207698_11672218
489 Ga0209389_1000674
490 Ga0209371_1037874
491 Ga0209981_1018484
492 Ga0209968_1000327
493 Ga0209966_1000008
494 Ga0209813_10151077
495 Ga0268266_10017822
496 Ga0268264_10235232
497 Ga0268264_10642192
498 Ga0307517_10000131
499 Ga0307517_10092854
500 Ga0307517_10168358
501 Ga0307517_10282119
502 Ga0307515_10013344
503 Ga0307515_10054228
504 Ga0307515_10079998
505 Ga0307515_10358287
506 Ga0307515_10430840
507 Ga0268256_1043081
508 Ga0307512_10016812
509 Ga0307512_10223106
510 Ga0265328_10022508
511 Ga0265331_10027151
512 Ga0265327_10000042
513 Ga0307513_10018531
514 Ga0307513_10022575
515 Ga0307513_10080196
516 Ga0307513_10211654
517 Ga0307513_10281775
518 Ga0307513_10311822
519 Ga0307509_10000871
520 Ga0307509_10005828
521 Ga0307509_10044981
522 Ga0307509_10062052
523 Ga0307509_10185538
524 Ga0307509_10272130
525 Ga0307408_100014960
526 Ga0307508_10004592
527 Ga0307508_10034229
528 Ga0307508_10101314
529 Ga0307508_10407561
530 Ga0307514_10029986
531 Ga0307514_10129160
532 Ga0307514_10328137
533 Ga0307516_10021959
534 Ga0307516_10074845
535 Ga0307516_10180868
536 Ga0307516_10278622
537 Ga0307516_10330205
538 Ga0307405_10199575
539 Ga0307518_10402089
540 Ga0307507_10240118
541 Ga0307510_10011005
542 Ga0307510_10053936
543 Ga0307510_10199241
544 Ga0307510_10211413
545 Ga0373928_0064353
546 Ga0373944_0205896
547 Ga0373932_0008052
548 Ga0373937_0236167
549 Ga0373925_0242332
550 Ga0395900_0000058
551 Ga0395898_0016745
552 Ga0395905_0013060
553 Ga0395905_0028074
554 Ga0436361_0019641
555 Ga0436361_0882397
556 Ga0436361_0960381
557 Ga0451791_0876899
558 Ga0451797_0367293
559 Ga0451847_0153758
560 Ga0451853_2673283
561 Ga0439450_014250
562 Ga0439455_0175083
563 Ga0439457_032626
564 Ga0439462_0134547
565 Ga0450898_006278
566 Ga0450899_008572
567 Ga0439458_0098469
568 Ga0451577_0004058
569 Ga0466969_0000013
570 Ga0466972_0001525
571 Ga0466972_0009928
572 Ga0466972_0170614
573 Ga0466972_0435637
574 Ga0466965_0550258
575 Ga0466966_0031511
576 Ga0466966_0036978
577 Ga0466961_0006151
578 Ga0466961_0167275
579 Ga0466963_0047955
580 Ga0466963_0062175
581 Ga0466964_0025739
582 Ga0466964_0086321
583 Ga0453684_0043091
584 Ga0453684_0099514
585 Ga0453684_0256300
586 Ga0466971_0167058
587 Ga0466971_0378451
588 Ga0466970_0168350
589 Ga0466960_0065769
590 Ga0466960_0456048
591 Ga0466959_0000491
592 Ga0466959_0186145
593 Ga0451576_0120640
594 Ga0451576_0638243
595 Ga0451576_0935895
596 Ga0466958_0045654
597 Ga0466967_0018595
598 Ga0495592_0000487
599 Ga0495592_0165323
600 Ga0495638_0044045
601 Ga0495638_0587853
602 Ga0495632_0027078
603 Ga0495648_0166328
604 Ga0495648_0227367
605 Ga0495666_0253843
606 Ga0495621_0011117
607 Ga0495621_0262678
608 Ga0495597_0010867
609 Ga0495656_0363420
610 Ga0495668_0127987
611 Ga0495611_0248977
612 Ga0495658_0275703
613 Ga0495613_0490851
614 Ga0495613_0768497
615 Ga0495671_0252700
616 Ga0495581_0462759
617 Ga0495676_0088584
618 Ga0495687_000582
619 Ga0495673_0133701
620 Ga0495686_0005518
621 Ga0495602_0178092
622 Ga0495626_0073219
623 Ga0496109_0041196
624 Ga0496109_0440321
625 Ga0496124_0004638
626 Ga0496126_0543427
627 Ga0495682_0178981
628 Ga0501047_0373539
629 nmdc:mga03683_19978_c1
630 nmdc:mga03683_7705_c1
631 nmdc:mga03n38_237146_c1
632 nmdc:mga00v17_48807_c1
633 nmdc:mga0k408_1085_c1
634 nmdc:mga0k408_119767_c1
635 nmdc:mga0k408_215240_c1
636 nmdc:mga0k408_2362_c1
637 nmdc:mga0k408_41769_c1
638 nmdc:mga0k408_461750_c1
639 nmdc:mga0k408_49392_c1
640 nmdc:mga0k408_5670_c2
641 nmdc:mga0k408_66001_c1
642 nmdc:mga0k408_84755_c1
643 nmdc:mga0k408_93030_c1
644 nmdc:mga06z11_62313_c1
645 nmdc:mga04h51_75491_c1
646 nmdc:mga07m45_10965_c1
647 nmdc:mga07m45_11387_c1
648 nmdc:mga07m45_389686_c1
649 nmdc:mga07m45_9497_c1
650 Ga0495655_0080129
651 Ga0500578_0155331
652 Ga0500651_0070840
653 Ga0500594_0004519
654 Ga0500559_0000726
655 Ga0500568_0085490
656 Ga0500590_182972
657 Ga0500620_186072
658 Ga0500622_0033406
659 Ga0500636_0189471
660 Ga0500637_0520516
661 Ga0500645_043008
662 Ga0500587_009154
663 Ga0466962_0056183
664 Ga0466962_0242743
665 2644303014
666 2886852788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

5

141

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v9s-assembly1.cif.gz_D crystal structure of tt0130 protein from thermus thermophilus hb8 0.8254 25 120
6asv-assembly1.cif.gz_A e. coli prpp synthetase 0.7895 12 123
1dkr-assembly1.cif.gz_A crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation. 0.783 12 118
1v9s-assembly1.cif.gz_A crystal structure of tt0130 protein from thermus thermophilus hb8 0.7639 25 126
2ji4-assembly1.cif.gz_A human phosphoribosylpyrophosphate synthetase - associated protein 41 (pap41) 0.756 15 118
ID Description Score Start End Superfamily
1wd5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7732 11 123 3.40.50.2020
af_Q86I95_32_170_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.7536 145 164 1.20.1280.290
af_A0A0R4IF36_130_236_2.60.40.60 Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins 0.7482 141 164 2.60.40.60
2c4kA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7458 12 123 3.40.50.2020
1dkuA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7449 12 118 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A2N2S439-F1-model_v4 Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR 0.8752 4 124 GO:0016757
AF-A0A1E3YRF1-F1-model_v4 Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase 0.8699 3 127 GO:0016757
AF-A0A2N2S439-F1-model_v4 Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR 0.8557 4 124 GO:0016757
AF-A0A519FI20-F1-model_v4 Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR 0.8388 1 90 GO:0016757
AF-A0A7V7WVV5-F1-model_v4 Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR (EC 2.4.2.9) 0.8324 1 119 GO:0004845

Map