F411490

General Info

Members Datasets Scaffolds Average Seq Length
333 260 666 291

Family's Representative Sequence

Representative Sequence 3300046506|Ga0495583_0000234|Ga0495583_0000234_90418_91353
Length 311
Sequence MTPRDVRLPNFRLPKRTKGLMAWTWWDLIPVAAAVAHLAFVVWIVVGSANRPWWGQLLCGFGYALAISWNVNGVSHNFLHTPYFRSKALNRAFSLLESLAIGFSQTFYTWVHLRHHEGNSDRPGPDGETRDWLSIYRHGKDGQPENVWSYVFLGFFRDSGGSVYQALKARGRDADARWGRIEIAAVAAFAIGMAVIDWRAVLFLLPFYYLGECLSQLNGYYEHFNGDPETPIAWGVSSYDPVYNVTWFNNGHHAEHHFRPAVHWTQLPALRRALVEQQAAQGVHVIGPAHALGFLARANRRPRDAERAVRP

Samples

Sample ID Description Type Environment
1 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
57 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
67 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
71 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
72 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
73 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
75 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
102 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
103 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
111 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
112 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
113 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
114 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
122 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
123 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
126 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
127 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
128 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
129 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
130 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
131 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
136 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
145 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
146 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
147 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
151 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
152 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
153 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
176 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
179 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
180 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
181 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
182 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
183 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
184 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
185 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
186 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
187 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
188 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
189 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
192 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
193 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
194 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
195 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
196 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
197 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
198 2519899620 Rhizobium sp. Pop5 Isolate Nodule
199 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
200 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
201 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
202 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
203 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
204 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
205 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
206 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
207 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
208 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
209 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
210 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
211 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
212 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
213 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
214 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
215 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
216 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
217 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
218 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
219 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
220 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
221 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
222 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
223 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
224 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
225 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
226 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
227 2791355263 Rhizobium chutanense C5 Isolate Nodule
228 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
229 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
230 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
231 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
232 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
233 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
234 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
235 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
236 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
237 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
238 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
239 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
240 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
241 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
242 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
243 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
244 2936381700 Rhizobium chutanense C16 Isolate Unclassified
245 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
246 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
247 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
248 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
249 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
250 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
251 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
252 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
253 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
254 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
255 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
256 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
257 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
258 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
259 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
260 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.18
Metatranscriptomes 0
Isolates 19.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.23
Nodule 8.11
Rhizoplane 1.5
Rhizosphere 42.94
Stem 0
Stem Tuber 0
Unclassified 1.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495583_0000234 3300046506 Bacteria 92118
2 JGI24740J21852_10000004 3300001979 Bacteria 91019
3 JGI25155J39150_1000004 3300002704 Bacteria 269098
4 JGI25156J39149_1000014 3300002705 Bacteria 189257
5 JGI25162J39368_1000482 3300002737 Bacteria 30484
6 JGI25162J39368_1000526 3300002737 Bacteria 28526
7 JGI25154J39366_1000096 3300002738 Bacteria 79168
8 JGI25158J39367_1000081 3300002739 Bacteria 22110
9 JGI25157J39369_1000005 3300002741 Bacteria 269089
10 JGI25152J39213_1001056 3300002773 Bacteria 13075
11 JGI25159J45721_1001028 3300002987 Bacteria 11987
12 JGI25159J45721_1003346 3300002987 Bacteria 5718
13 JGI25151J46595_10062456 3300003187 Bacteria 1178
14 JGI25165J46597_1000190 3300003214 Bacteria 91363
15 JGI25165J46597_1000328 3300003214 Bacteria 56610
16 JGI25153J46596_10001863 3300003215 Bacteria 12494
17 rootH1_10070844 3300003316 Bacteria 4162
18 rootH2_10017677 3300003320 Bacteria 13034
19 rootL2_10002812 3300003322 Bacteria 40354
20 rootH1_10028475 3300003323 Bacteria 8871
21 rootH1_10031460 3300003323 Bacteria 7779
22 rootH1_10141540 3300003323 Bacteria 2722
23 JGI25160J50197_1000108 3300003354 Bacteria 77944
24 JGI25160J50197_1001507 3300003354 Bacteria 11576
25 JGI25161J50226_1000112 3300003374 Bacteria 63152
26 JGI25161J50226_1000304 3300003374 Bacteria 27435
27 Ga0055526_1002344 3300003771 Bacteria 12864
28 Ga0055526_1002963 3300003771 Bacteria 11126
29 Ga0055526_1021591 3300003771 Bacteria 2232
30 Ga0055524_1000769 3300003775 Bacteria 21606
31 Ga0055524_1006444 3300003775 Bacteria 5088
32 Ga0055536_1000029 3300003781 Bacteria 157375
33 Ga0055536_1000092 3300003781 Bacteria 77375
34 Ga0055528_1000054 3300003790 Bacteria 90334
35 Ga0055528_1000083 3300003790 Bacteria 74840
36 Ga0055528_1002097 3300003790 Bacteria 11052
37 Ga0055530_10000363 3300003791 Bacteria 41018
38 Ga0055540_1006164 3300003792 Bacteria 4822
39 Ga0055543_1000080 3300004625 Bacteria 84865
40 Ga0055543_1000096 3300004625 Bacteria 75972
41 Ga0065165_1000520 3300005262 Bacteria 58925
42 Ga0065165_1004702 3300005262 Bacteria 8208
43 Ga0065715_10099681 3300005293 Bacteria 3382
44 Ga0070667_100257123 3300005367 Bacteria 1563
45 Ga0070706_100341372 3300005467 Unclassified 1396
46 Ga0070707_100439277 3300005468 Unclassified 1265
47 Ga0070698_100032279 3300005471 Bacteria 5425
48 Ga0070698_100655771 3300005471 Bacteria 991
49 Ga0070699_100141295 3300005518 Unclassified 2126
50 Ga0070697_100014754 3300005536 Bacteria 6133
51 Ga0070665_100142828 3300005548 Bacteria 2397
52 Ga0070665_100304390 3300005548 Bacteria 1597
53 Ga0068854_100053568 3300005578 Bacteria 2898
54 Ga0068856_100011847 3300005614 Bacteria 8449
55 Ga0068856_100754938 3300005614 Bacteria 993
56 Ga0068859_100763709 3300005617 Bacteria 1055
57 Ga0068860_100000083 3300005843 Bacteria 168189
58 Ga0068862_100329128 3300005844 Bacteria 1412
59 Ga0075368_10009610 3300006042 Bacteria 3481
60 Ga0075367_10000873 3300006178 Bacteria 12073
61 Ga0075367_10067525 3300006178 Bacteria 2144
62 Ga0075369_10043729 3300006186 Bacteria 1923
63 Ga0075369_10067742 3300006186 Bacteria 1568
64 Ga0075427_10018532 3300006194 Bacteria 1093
65 Ga0075370_10022364 3300006353 Bacteria 3471
66 Ga0075370_10058719 3300006353 Bacteria 2188
67 Ga0075428_100413919 3300006844 Bacteria 1444
68 Ga0075430_100035181 3300006846 Bacteria 4250
69 Ga0075431_100279188 3300006847 Bacteria 1691
70 Ga0075433_10029299 3300006852 Bacteria 4688
71 Ga0075433_10032486 3300006852 Bacteria 4471
72 Ga0075429_100144867 3300006880 Bacteria 2079
73 Ga0097620_100763697 3300006931 Bacteria 1055
74 Ga0105250_10056800 3300009092 Bacteria 1570
75 Ga0105240_10000013 3300009093 Bacteria 483458
76 Ga0114129_10024390 3300009147 Bacteria 8570
77 Ga0114129_10046126 3300009147 Bacteria 6125
78 Ga0114129_10057257 3300009147 Bacteria 5456
79 Ga0105237_10040004 3300009545 Bacteria 4730
80 Ga0123341_1000781 3300009765 Bacteria 21631
81 Ga0123342_1018673 3300009766 Bacteria 5460
82 Ga0105239_10014173 3300010375 Bacteria 8845
83 Ga0105246_10414024 3300011119 Bacteria 1123
84 Ga0157370_10000548 3300013104 Bacteria 46830
85 Ga0157369_10144533 3300013105 Bacteria 2515
86 Ga0182008_10028114 3300014497 Bacteria 2844
87 Ga0157379_10167717 3300014968 Bacteria 1982
88 Ga0157376_10016971 3300014969 Bacteria 5543
89 Ga0182007_10000458 3300015262 Bacteria 24641
90 Ga0209435_100009 3300025206 Bacteria 476614
91 Ga0209436_100009 3300025208 Bacteria 143684
92 Ga0209672_103223 3300025228 Bacteria 3473
93 Ga0207427_103955 3300025231 Bacteria 2732
94 Ga0209437_100057 3300025233 Bacteria 362922
95 Ga0209437_100206 3300025233 Bacteria 115048
96 Ga0209646_1000018 3300025246 Bacteria 476716
97 Ga0209026_1000043 3300025250 Bacteria 269142
98 Ga0209677_101737 3300025253 Bacteria 9076
99 Ga0209759_1000007 3300025256 Bacteria 476614
100 Ga0209129_1006526 3300025258 Bacteria 3740
101 Ga0209233_1000130 3300025261 Bacteria 205687
102 Ga0209233_1000178 3300025261 Bacteria 140956
103 Ga0209233_1000256 3300025261 Bacteria 80855
104 Ga0209455_1009775 3300025272 Bacteria 2491
105 Ga0209673_1000067 3300025273 Bacteria 249077
106 Ga0209673_1000086 3300025273 Bacteria 210101
107 Ga0209673_1001363 3300025273 Bacteria 24193
108 Ga0209130_1000031 3300025284 Bacteria 322932
109 Ga0209130_1000108 3300025284 Bacteria 133733
110 Ga0209676_1000057 3300025292 Bacteria 361061
111 Ga0209025_1002308 3300025294 Bacteria 20678
112 Ga0209564_1000092 3300025295 Bacteria 249018
113 Ga0209564_1000952 3300025295 Bacteria 37023
114 Ga0209564_1021123 3300025295 Bacteria 2355
115 Ga0209758_1004432 3300025297 Bacteria 11696
116 Ga0209758_1004917 3300025297 Bacteria 10742
117 Ga0209758_1045244 3300025297 Bacteria 1600
118 Ga0209050_1000096 3300025298 Bacteria 240109
119 Ga0209256_1000788 3300025299 Bacteria 40932
120 Ga0209256_1004712 3300025299 Bacteria 8356
121 Ga0207426_1000042 3300025302 Bacteria 433289
122 Ga0207426_1000082 3300025302 Bacteria 298939
123 Ga0209051_1003708 3300025303 Bacteria 9855
124 Ga0207655_1002550 3300025728 Bacteria 14580
125 Ga0207684_10112349 3300025910 Unclassified 2332
126 Ga0207695_10000044 3300025913 Bacteria 440819
127 Ga0207671_10003650 3300025914 Bacteria 15204
128 Ga0207694_10006739 3300025924 Bacteria 8725
129 Ga0207640_10145918 3300025981 Bacteria 1731
130 Ga0207658_10209892 3300025986 Bacteria 1631
131 Ga0207702_10023861 3300026078 Bacteria 5074
132 Ga0209371_1002468 3300027312 Bacteria 10298
133 Ga0209813_10010267 3300027866 Bacteria 2417
134 Ga0268266_10018292 3300028379 Bacteria 5975
135 Ga0268266_10027899 3300028379 Bacteria 4801
136 Ga0268265_10315442 3300028380 Bacteria 1413
137 Ga0268264_10000055 3300028381 Bacteria 314947
138 Ga0265337_1006723 3300028556 Bacteria 4386
139 Ga0268256_1003511 3300030500 Bacteria 7038
140 Ga0307511_10016515 3300030521 Bacteria 7109
141 Ga0265327_10002596 3300031251 Bacteria 18697
142 Ga0307513_10038504 3300031456 Bacteria 5308
143 Ga0307513_10412771 3300031456 Bacteria 1082
144 Ga0307510_10008361 3300033180 Bacteria 12331
145 Ga0373935_0016295 3300035692 Bacteria 4498
146 Ga0373937_0015745 3300036401 Bacteria 6698
147 Ga0373925_0064962 3300037068 Bacteria 2748
148 Ga0451800_0516969 3300041459 Bacteria 1710
149 Ga0451839_0023546 3300041496 Bacteria 2966
150 Ga0451847_0519890 3300041503 Bacteria 5200
151 Ga0451851_0391774 3300041507 Bacteria 3019
152 Ga0451843_0727982 3300041509 Bacteria 4485
153 Ga0466970_0014846 3300044765 Bacteria 4003
154 Ga0495629_0011394 3300046459 Bacteria 6458
155 Ga0495638_0000079 3300046460 Bacteria 157488
156 Ga0495638_0000143 3300046460 Bacteria 113640
157 Ga0495638_0000380 3300046460 Bacteria 55127
158 Ga0495651_0149829 3300046462 Bacteria 1683
159 Ga0495650_0015488 3300046471 Bacteria 3907
160 Ga0495650_0033200 3300046471 Bacteria 2299
161 Ga0495605_0000016 3300046474 Bacteria 289508
162 Ga0495662_0016909 3300046476 Bacteria 3529
163 Ga0495594_0002983 3300046499 Bacteria 8776
164 Ga0495607_0123104 3300046501 Bacteria 1359
165 Ga0495583_0000037 3300046506 Bacteria 244437
166 Ga0495583_0000819 3300046506 Bacteria 38035
167 Ga0495606_0236756 3300046507 Bacteria 1020
168 Ga0495610_0048563 3300046512 Bacteria 2082
169 Ga0495616_0000117 3300046513 Bacteria 70162
170 Ga0495620_0002987 3300046515 Bacteria 9732
171 Ga0495631_0033674 3300046518 Bacteria 2300
172 Ga0495632_0001570 3300046519 Bacteria 18850
173 Ga0495637_0005840 3300046520 Bacteria 6228
174 Ga0495643_0001728 3300046522 Bacteria 18884
175 Ga0495643_0111878 3300046522 Unclassified 1388
176 Ga0495648_0014611 3300046524 Bacteria 5737
177 Ga0495654_0003411 3300046530 Bacteria 9754
178 Ga0495609_0002089 3300046538 Bacteria 12552
179 Ga0495597_0003441 3300046542 Bacteria 9235
180 Ga0495597_0061925 3300046542 Bacteria 1629
181 Ga0495622_0037948 3300046557 Bacteria 2243
182 Ga0495633_0003972 3300046558 Bacteria 9601
183 Ga0495633_0049553 3300046558 Bacteria 1982
184 Ga0495668_0054518 3300046616 Bacteria 2209
185 Ga0495668_0134267 3300046616 Bacteria 1354
186 Ga0495611_0011571 3300046648 Bacteria 3742
187 Ga0495635_0092343 3300046663 Bacteria 2070
188 Ga0495661_0001970 3300046665 Bacteria 16269
189 Ga0495657_0045898 3300046675 Bacteria 2962
190 Ga0495669_0000006 3300046684 Bacteria 190838
191 Ga0495669_0000577 3300046684 Bacteria 16281
192 Ga0495670_0004697 3300046691 Bacteria 6703
193 Ga0495671_0029901 3300046692 Bacteria 2793
194 Ga0495589_0002984 3300046794 Bacteria 9323
195 Ga0495660_0016840 3300046810 Bacteria 4211
196 Ga0495604_0157982 3300047317 Bacteria 1604
197 Ga0495672_0004601 3300047320 Bacteria 11208
198 Ga0495672_0026551 3300047320 Bacteria 3693
199 Ga0495683_0003209 3300047323 Bacteria 9557
200 Ga0495687_081322 3300047443 Bacteria 1268
201 Ga0495679_005198 3300047446 Bacteria 5817
202 Ga0495681_0010167 3300047470 Bacteria 5720
203 Ga0495681_0036995 3300047470 Bacteria 2409
204 Ga0495686_0005997 3300047472 Bacteria 9449
205 Ga0496106_0000109 3300048909 Bacteria 64454
206 Ga0496106_0016469 3300048909 Bacteria 5470
207 Ga0496107_0000086 3300048910 Bacteria 44285
208 Ga0496117_0001113 3300048920 Bacteria 40547
209 Ga0496117_0107487 3300048920 Bacteria 1747
210 Ga0496118_0001953 3300048921 Bacteria 29213
211 Ga0496118_0002207 3300048921 Bacteria 27019
212 Ga0496119_0017106 3300048922 Bacteria 5479
213 Ga0496119_0026229 3300048922 Bacteria 4044
214 Ga0496120_0008671 3300048923 Bacteria 7334
215 Ga0496121_0001285 3300048924 Bacteria 43232
216 Ga0496121_0003282 3300048924 Bacteria 23219
217 Ga0496121_0005792 3300048924 Bacteria 15683
218 Ga0496121_0051523 3300048924 Bacteria 3465
219 Ga0496121_0094913 3300048924 Bacteria 2319
220 Ga0496121_0135357 3300048924 Bacteria 1837
221 Ga0496122_0000137 3300048925 Bacteria 170016
222 Ga0496122_0009062 3300048925 Bacteria 10561
223 Ga0496122_0027700 3300048925 Bacteria 4834
224 Ga0496122_0235429 3300048925 Bacteria 1037
225 Ga0496123_0000022 3300048926 Bacteria 361832
226 Ga0496123_0001624 3300048926 Bacteria 30272
227 Ga0496123_0057103 3300048926 Bacteria 2544
228 Ga0496124_0000715 3300048927 Bacteria 54340
229 Ga0496124_0021779 3300048927 Bacteria 5896
230 Ga0496124_0028471 3300048927 Bacteria 4998
231 Ga0496126_0002676 3300048929 Bacteria 23569
232 Ga0495678_000508 3300049459 Bacteria 37991
233 Ga0501067_0016579 3300049583 Unclassified 4072
234 nmdc:mga0k408_54612_c1 3300050493 Bacteria 2315
235 nmdc:mga06z11_51713_c1 3300050494 Bacteria 2105
236 nmdc:mga04h51_11840_c1 3300050495 Bacteria 2433
237 nmdc:mga07m45_10107_c1 3300050496 Bacteria 4917
238 nmdc:mga05p37_104111_c1 3300050507 Bacteria 3492
239 nmdc:mga05p37_110772_c1 3300050507 Bacteria 3377
240 nmdc:mga05p37_185990_c1 3300050507 Bacteria 2526
241 nmdc:mga0qj67_330310_c1 3300050509 Bacteria 1234
242 nmdc:mga0a205_175898_c1 3300050515 Bacteria 2036
243 nmdc:mga0a205_97685_c1 3300050515 Bacteria 2836
244 nmdc:mga0sz30_13683_c1 3300050516 Bacteria 1994
245 Ga0500610_0082254 3300053079 Bacteria 1678
246 Ga0495619_0214182 3300053085 Bacteria 1334
247 Ga0500578_0015853 3300053086 Bacteria 4838
248 Ga0500643_026052 3300053087 Bacteria 1836
249 Ga0500646_0072777 3300053090 Bacteria 1034
250 Ga0500660_110103 3300053100 Bacteria 1177
251 Ga0500554_001979 3300053102 Bacteria 3976
252 Ga0500569_004599 3300053109 Bacteria 2911
253 Ga0500594_0001980 3300053118 Bacteria 4430
254 Ga0500618_000028 3300053125 Bacteria 140440
255 Ga0500618_000053 3300053125 Bacteria 101079
256 Ga0500618_000497 3300053125 Bacteria 25239
257 Ga0500559_0000005 3300053136 Bacteria 230231
258 Ga0500568_0000074 3300053139 Bacteria 94957
259 Ga0500568_0000307 3300053139 Bacteria 39094
260 Ga0500577_0000155 3300053142 Bacteria 17094
261 Ga0500604_0009098 3300053151 Bacteria 2643
262 Ga0500616_0001534 3300053153 Bacteria 21730
263 Ga0500622_0003453 3300053156 Bacteria 10540
264 Ga0500622_0013879 3300053156 Bacteria 4338
265 Ga0500634_0001650 3300053161 Bacteria 8842
266 Ga0500609_000428 3300053731 Bacteria 6237
267 Ga0466962_0076094 3300061719 Bacteria 1604
268 2511134240 2510917022 Bacteria 6504556
269 2511198071 2510917030 Bacteria 7460662
270 2513594953 2513237088 Bacteria 6927906
271 2520375389 2519899620 Bacteria 6499161
272 2524458517 2524023209 Bacteria 6679728
273 2585154214 2582581280 Bacteria 5994497
274 2585197833 2582581293 Bacteria 5907401
275 2585222205 2582581298 Bacteria 7315509
276 2585271729 2582581307 Bacteria 6597605
277 2585279888 2582581308 Bacteria 7413247
278 2585326565 2582581315 Bacteria 7318924
279 2585334089 2582581316 Bacteria 7774528
280 2585531708 2585427527 Bacteria 7273426
281 2585544842 2585427529 Bacteria 7395659
282 2585551345 2585427530 Bacteria 7383882
283 2585563031 2585427531 Bacteria 6992870
284 2585902895 2585427608 Bacteria 6544331
285 2585907246 2585427609 Bacteria 6667127
286 2587982760 2585428125 Bacteria 6662905
287 2616306681 2615840626 Bacteria 7921970
288 2616557537 2615840698 Bacteria 7319877
289 2617386009 2617270742 Bacteria 6808054
290 2643781040 2643221552 Bacteria 5708754
291 2644242177 2643221643 Bacteria 5749658
292 2671113434 2667528174 Bacteria 6435400
293 2720618062 2718218233 Bacteria 6662049
294 2720629052 2718218235 Bacteria 6630699
295 2720773126 2718218269 Bacteria 6906114
296 2724093155 2721755819 Bacteria 6906405
297 2725952796 2724679232 Bacteria 7646494
298 2778178670 2775507266 Bacteria 7392367
299 2793316755 2791355259 Bacteria 7254731
300 2793343273 2791355263 Bacteria 6872478
301 2819611280 2818991448 Bacteria 6772224
302 2819638775 2818991453 Bacteria 7181617
303 2838030977 2838029111 Bacteria 6603031
304 2838046611 2838042994 Bacteria 6046894
305 2842300224 2842298080 Bacteria 6123127
306 2842317113 2842311132 Bacteria 6616990
307 2842359135 2842357229 Bacteria 6485165
308 2842477709 2842475841 Bacteria 6603183
309 2842485014 2842482326 Bacteria 7212537
310 2842504419 2842502639 Bacteria 6604161
311 2842511662 2842509118 Bacteria 6850950
312 2852391745 2852387548 Bacteria 8025568
313 2904583646 2904578770 Bacteria 5302906
314 2919102750 2919100787 Bacteria 7710546
315 2919124787 2919119836 Bacteria 5208557
316 2919411109 2919408235 Bacteria 6149349
317 2936384222 2936381700 Bacteria 7006523
318 3002143831 3002141150 Bacteria 5254435
319 3005421579 3005416602 Bacteria 7064308
320 3005451643 3005445848 Bacteria 6906074
321 8005319718 8005314921 Bacteria 7072929
322 8005490341 8005484373 Bacteria 6297373
323 8005502330 8005497431 Bacteria 6477605
324 8005548708 8005542996 Bacteria 7077758
325 8005624664 8005619151 Bacteria 7030230
326 8005646991 8005645114 Bacteria 6950293
327 8005673757 8005668836 Bacteria 6953162
328 8005688145 8005682033 Bacteria 6726518
329 8018151222 8018150411 Bacteria 5549903
330 8024488947 8024486573 Bacteria 6540512
331 8046767271 8046767195 Bacteria 7547379
332 8054465113 8054460903 Bacteria 4872905
333 8057581661 8057575449 Bacteria 7367519
334 Ga0495583_0000234
335 JGI24740J21852_10000004
336 JGI25155J39150_1000004
337 JGI25156J39149_1000014
338 JGI25162J39368_1000482
339 JGI25162J39368_1000526
340 JGI25154J39366_1000096
341 JGI25158J39367_1000081
342 JGI25157J39369_1000005
343 JGI25152J39213_1001056
344 JGI25159J45721_1001028
345 JGI25159J45721_1003346
346 JGI25151J46595_10062456
347 JGI25165J46597_1000190
348 JGI25165J46597_1000328
349 JGI25153J46596_10001863
350 rootH1_10070844
351 rootH2_10017677
352 rootL2_10002812
353 rootH1_10028475
354 rootH1_10031460
355 rootH1_10141540
356 JGI25160J50197_1000108
357 JGI25160J50197_1001507
358 JGI25161J50226_1000112
359 JGI25161J50226_1000304
360 Ga0055526_1002344
361 Ga0055526_1002963
362 Ga0055526_1021591
363 Ga0055524_1000769
364 Ga0055524_1006444
365 Ga0055536_1000029
366 Ga0055536_1000092
367 Ga0055528_1000054
368 Ga0055528_1000083
369 Ga0055528_1002097
370 Ga0055530_10000363
371 Ga0055540_1006164
372 Ga0055543_1000080
373 Ga0055543_1000096
374 Ga0065165_1000520
375 Ga0065165_1004702
376 Ga0065715_10099681
377 Ga0070667_100257123
378 Ga0070706_100341372
379 Ga0070707_100439277
380 Ga0070698_100032279
381 Ga0070698_100655771
382 Ga0070699_100141295
383 Ga0070697_100014754
384 Ga0070665_100142828
385 Ga0070665_100304390
386 Ga0068854_100053568
387 Ga0068856_100011847
388 Ga0068856_100754938
389 Ga0068859_100763709
390 Ga0068860_100000083
391 Ga0068862_100329128
392 Ga0075368_10009610
393 Ga0075367_10000873
394 Ga0075367_10067525
395 Ga0075369_10043729
396 Ga0075369_10067742
397 Ga0075427_10018532
398 Ga0075370_10022364
399 Ga0075370_10058719
400 Ga0075428_100413919
401 Ga0075430_100035181
402 Ga0075431_100279188
403 Ga0075433_10029299
404 Ga0075433_10032486
405 Ga0075429_100144867
406 Ga0097620_100763697
407 Ga0105250_10056800
408 Ga0105240_10000013
409 Ga0114129_10024390
410 Ga0114129_10046126
411 Ga0114129_10057257
412 Ga0105237_10040004
413 Ga0123341_1000781
414 Ga0123342_1018673
415 Ga0105239_10014173
416 Ga0105246_10414024
417 Ga0157370_10000548
418 Ga0157369_10144533
419 Ga0182008_10028114
420 Ga0157379_10167717
421 Ga0157376_10016971
422 Ga0182007_10000458
423 Ga0209435_100009
424 Ga0209436_100009
425 Ga0209672_103223
426 Ga0207427_103955
427 Ga0209437_100057
428 Ga0209437_100206
429 Ga0209646_1000018
430 Ga0209026_1000043
431 Ga0209677_101737
432 Ga0209759_1000007
433 Ga0209129_1006526
434 Ga0209233_1000130
435 Ga0209233_1000178
436 Ga0209233_1000256
437 Ga0209455_1009775
438 Ga0209673_1000067
439 Ga0209673_1000086
440 Ga0209673_1001363
441 Ga0209130_1000031
442 Ga0209130_1000108
443 Ga0209676_1000057
444 Ga0209025_1002308
445 Ga0209564_1000092
446 Ga0209564_1000952
447 Ga0209564_1021123
448 Ga0209758_1004432
449 Ga0209758_1004917
450 Ga0209758_1045244
451 Ga0209050_1000096
452 Ga0209256_1000788
453 Ga0209256_1004712
454 Ga0207426_1000042
455 Ga0207426_1000082
456 Ga0209051_1003708
457 Ga0207655_1002550
458 Ga0207684_10112349
459 Ga0207695_10000044
460 Ga0207671_10003650
461 Ga0207694_10006739
462 Ga0207640_10145918
463 Ga0207658_10209892
464 Ga0207702_10023861
465 Ga0209371_1002468
466 Ga0209813_10010267
467 Ga0268266_10018292
468 Ga0268266_10027899
469 Ga0268265_10315442
470 Ga0268264_10000055
471 Ga0265337_1006723
472 Ga0268256_1003511
473 Ga0307511_10016515
474 Ga0265327_10002596
475 Ga0307513_10038504
476 Ga0307513_10412771
477 Ga0307510_10008361
478 Ga0373935_0016295
479 Ga0373937_0015745
480 Ga0373925_0064962
481 Ga0451800_0516969
482 Ga0451839_0023546
483 Ga0451847_0519890
484 Ga0451851_0391774
485 Ga0451843_0727982
486 Ga0466970_0014846
487 Ga0495629_0011394
488 Ga0495638_0000079
489 Ga0495638_0000143
490 Ga0495638_0000380
491 Ga0495651_0149829
492 Ga0495650_0015488
493 Ga0495650_0033200
494 Ga0495605_0000016
495 Ga0495662_0016909
496 Ga0495594_0002983
497 Ga0495607_0123104
498 Ga0495583_0000037
499 Ga0495583_0000819
500 Ga0495606_0236756
501 Ga0495610_0048563
502 Ga0495616_0000117
503 Ga0495620_0002987
504 Ga0495631_0033674
505 Ga0495632_0001570
506 Ga0495637_0005840
507 Ga0495643_0001728
508 Ga0495643_0111878
509 Ga0495648_0014611
510 Ga0495654_0003411
511 Ga0495609_0002089
512 Ga0495597_0003441
513 Ga0495597_0061925
514 Ga0495622_0037948
515 Ga0495633_0003972
516 Ga0495633_0049553
517 Ga0495668_0054518
518 Ga0495668_0134267
519 Ga0495611_0011571
520 Ga0495635_0092343
521 Ga0495661_0001970
522 Ga0495657_0045898
523 Ga0495669_0000006
524 Ga0495669_0000577
525 Ga0495670_0004697
526 Ga0495671_0029901
527 Ga0495589_0002984
528 Ga0495660_0016840
529 Ga0495604_0157982
530 Ga0495672_0004601
531 Ga0495672_0026551
532 Ga0495683_0003209
533 Ga0495687_081322
534 Ga0495679_005198
535 Ga0495681_0010167
536 Ga0495681_0036995
537 Ga0495686_0005997
538 Ga0496106_0000109
539 Ga0496106_0016469
540 Ga0496107_0000086
541 Ga0496117_0001113
542 Ga0496117_0107487
543 Ga0496118_0001953
544 Ga0496118_0002207
545 Ga0496119_0017106
546 Ga0496119_0026229
547 Ga0496120_0008671
548 Ga0496121_0001285
549 Ga0496121_0003282
550 Ga0496121_0005792
551 Ga0496121_0051523
552 Ga0496121_0094913
553 Ga0496121_0135357
554 Ga0496122_0000137
555 Ga0496122_0009062
556 Ga0496122_0027700
557 Ga0496122_0235429
558 Ga0496123_0000022
559 Ga0496123_0001624
560 Ga0496123_0057103
561 Ga0496124_0000715
562 Ga0496124_0021779
563 Ga0496124_0028471
564 Ga0496126_0002676
565 Ga0495678_000508
566 Ga0501067_0016579
567 nmdc:mga0k408_54612_c1
568 nmdc:mga06z11_51713_c1
569 nmdc:mga04h51_11840_c1
570 nmdc:mga07m45_10107_c1
571 nmdc:mga05p37_104111_c1
572 nmdc:mga05p37_110772_c1
573 nmdc:mga05p37_185990_c1
574 nmdc:mga0qj67_330310_c1
575 nmdc:mga0a205_175898_c1
576 nmdc:mga0a205_97685_c1
577 nmdc:mga0sz30_13683_c1
578 Ga0500610_0082254
579 Ga0495619_0214182
580 Ga0500578_0015853
581 Ga0500643_026052
582 Ga0500646_0072777
583 Ga0500660_110103
584 Ga0500554_001979
585 Ga0500569_004599
586 Ga0500594_0001980
587 Ga0500618_000028
588 Ga0500618_000053
589 Ga0500618_000497
590 Ga0500559_0000005
591 Ga0500568_0000074
592 Ga0500568_0000307
593 Ga0500577_0000155
594 Ga0500604_0009098
595 Ga0500616_0001534
596 Ga0500622_0003453
597 Ga0500622_0013879
598 Ga0500634_0001650
599 Ga0500609_000428
600 Ga0466962_0076094
601 2511134240
602 2511198071
603 2513594953
604 2520375389
605 2524458517
606 2585154214
607 2585197833
608 2585222205
609 2585271729
610 2585279888
611 2585326565
612 2585334089
613 2585531708
614 2585544842
615 2585551345
616 2585563031
617 2585902895
618 2585907246
619 2587982760
620 2616306681
621 2616557537
622 2617386009
623 2643781040
624 2644242177
625 2671113434
626 2720618062
627 2720629052
628 2720773126
629 2724093155
630 2725952796
631 2778178670
632 2793316755
633 2793343273
634 2819611280
635 2819638775
636 2838030977
637 2838046611
638 2842300224
639 2842317113
640 2842359135
641 2842477709
642 2842485014
643 2842504419
644 2842511662
645 2852391745
646 2904583646
647 2919102750
648 2919124787
649 2919411109
650 2936384222
651 3002143831
652 3005421579
653 3005451643
654 8005319718
655 8005490341
656 8005502330
657 8005548708
658 8005624664
659 8005646991
660 8005673757
661 8005688145
662 8018151222
663 8024488947
664 8046767271
665 8054465113
666 8057581661

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00487

FA_desaturase

Fatty acid desaturase

51

289

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f6t-assembly1.cif.gz_A cryo-em structure of alkane 1-monooxygenase alkb-alkg complex from fontimonas thermophila 0.6908 7 249
8sbb-assembly1.cif.gz_A cryo-em structure of ftalkb 0.6734 6 249
8f6t-assembly1.cif.gz_A cryo-em structure of alkane 1-monooxygenase alkb-alkg complex from fontimonas thermophila 0.5892 7 249
8sbb-assembly1.cif.gz_A cryo-em structure of ftalkb 0.5794 6 249
4zyo-assembly1.cif.gz_A crystal structure of human integral membrane stearoyl-coa desaturase with substrate 0.4111 4 278
ID Description Score Start End Superfamily
af_A0A0R4J2X1_81_350_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6132 19 270 3.30.40.10
af_A0A0R4J2X1_81_350_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.5758 19 270 3.30.40.10
af_D3ZGY5_32_207_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.3534 9 168 1.20.120.1760
af_P0ABE5_4_173_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.35 5 186 1.20.950.20
af_P0ABE5_4_173_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.3411 5 186 1.20.950.20
ID Description Score Start End GO Terms
AF-A0A2V7YL53-F1-model_v4 Fatty acid desaturase 0.9923 1 278 GO:0016020
GO:0042284
GO:0046513
AF-A0A2V5T3R0-F1-model_v4 Fatty acid desaturase 0.9922 1 279 GO:0016020
GO:0042284
GO:0046513
AF-A0A2R7QY42-F1-model_v4 deleted 0.9918 184 277
AF-A0A2W5YJD6-F1-model_v4 Fatty acid desaturase 0.9904 1 279 GO:0016020
GO:0042284
GO:0046513
AF-A0A5C1W8Y5-F1-model_v4 Fatty acid desaturase 0.9902 1 283 GO:0006629
GO:0016020

Map