F411504

General Info

Members Datasets Scaffolds Average Seq Length
333 249 316 251

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0017192|Ga0495668_0017192_1964_2860
Length 298
Sequence MAVIWSIAGLLVIRKQTNPARRLGPRGGRAQTCFHRQRCIAATTKEETMTLKLDDKIALVTGGTSGIGLATAQRFVAEGAHVFITGRRKAELDAAVKAIGRNVTGVLGDVSKLEDLDRLYATIKQEKGRLDVLFANAGGGSLLPLGQITEEHFDKIFGTNVRGLLFTVQKALPLMPKGSSIVLNASITSIKGNPAFSVYSATKAAVRSFARSWTVDLKDAGIRVNAVSPGVVPTPAYDLLGLTAEQVQGFVEGQTQNIPLGRVGTPDEIAKAVVFLASDDSSFVNGVELFVDGGMAQI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2738541277 Variovorax sp. GV051 Isolate Unclassified
7 2738541307 Variovorax sp. GV008 Isolate Unclassified
8 2738543019 Variovorax sp. GV040 Isolate Unclassified
9 2831426010 Nostoc sp. 106C Isolate Unclassified
10 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
11 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
12 2904456579 Variovorax sp. 2002 Isolate Unclassified
13 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
14 2928070936 Variovorax gossypii 1167 Isolate Unclassified
15 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
16 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
17 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
18 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
19 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
20 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
21 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
22 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
29 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
30 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
31 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
36 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
37 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
40 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
43 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
44 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
49 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
98 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
125 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
130 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
132 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
133 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
134 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
192 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
197 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
200 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
201 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
204 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
207 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
208 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
209 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
210 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
211 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
212 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
213 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
214 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
215 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
216 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
221 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
222 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
223 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
224 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
225 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
226 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
227 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
234 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
247 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
248 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
249 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.89
Metatranscriptomes 0
Isolates 5.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.71
Nodule 0
Rhizoplane 1.8
Rhizosphere 77.18
Stem 0
Stem Tuber 0
Unclassified 6.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3060615 2162886007 Archaea 1018
2 JGI25158J39367_1017161 3300002739 Bacteria 909
3 JGI25152J39213_1008010 3300002773 Bacteria 2668
4 JGI25150J39212_1000972 3300002774 Bacteria 9028
5 JGI25150J39212_1001224 3300002774 Bacteria 7547
6 JGI25159J45721_1001830 3300002987 Bacteria 8519
7 JGI25151J46595_10017565 3300003187 Bacteria 3097
8 JGI25165J46597_1007519 3300003214 Bacteria 1799
9 JGI25153J46596_10003354 3300003215 Bacteria 8992
10 rootH2_10037976 3300003320 Bacteria 6915
11 rootL2_10179222 3300003322 Bacteria 4229
12 JGI25160J50197_1002645 3300003354 Bacteria 8248
13 JGI25161J50226_1004134 3300003374 Bacteria 3109
14 Ga0055535_1000375 3300003761 Bacteria 42689
15 Ga0055542_1000215 3300003762 Bacteria 70610
16 Ga0055526_1015238 3300003771 Bacteria 3097
17 Ga0055537_1001670 3300003773 Bacteria 8248
18 Ga0055524_1013358 3300003775 Bacteria 3097
19 Ga0055534_1001175 3300003784 Bacteria 11030
20 Ga0055528_1002101 3300003790 Bacteria 11030
21 Ga0055540_1024453 3300003792 Bacteria 1498
22 Ga0055531_10011906 3300003794 Bacteria 4142
23 Ga0055541_1014322 3300003841 Bacteria 1081
24 Ga0055541_1018149 3300003841 Bacteria 875
25 Ga0055543_1002150 3300004625 Bacteria 6812
26 Ga0065165_1004103 3300005262 Bacteria 9390
27 Ga0065712_10004223 3300005290 Archaea 3701
28 Ga0065715_10022490 3300005293 Archaea 1350
29 Ga0065707_10000638 3300005295 Archaea 27995
30 Ga0070676_10023185 3300005328 Bacteria 3487
31 Ga0070676_10053070 3300005328 Archaea 2386
32 Ga0070670_100052969 3300005331 Archaea 3485
33 Ga0068869_100022231 3300005334 Bacteria 4368
34 Ga0070680_100009280 3300005336 Archaea 7550
35 Ga0068868_100069097 3300005338 Bacteria 2814
36 Ga0068868_100467426 3300005338 Bacteria 1100
37 Ga0070660_100141413 3300005339 Bacteria 1931
38 Ga0070660_100384432 3300005339 Bacteria 1159
39 Ga0070668_100032854 3300005347 Bacteria 3949
40 Ga0070669_100120599 3300005353 Bacteria 2000
41 Ga0070671_100002693 3300005355 Bacteria 13774
42 Ga0070674_100098182 3300005356 Bacteria 2129
43 Ga0070709_10155442 3300005434 Unclassified 1585
44 Ga0070701_10199203 3300005438 Unclassified 1183
45 Ga0070711_100340814 3300005439 Bacteria 1203
46 Ga0070700_100130285 3300005441 Unclassified 1696
47 Ga0070694_100033381 3300005444 Unclassified 3386
48 Ga0070708_100030966 3300005445 Bacteria 4628
49 Ga0070708_100103027 3300005445 Bacteria 2616
50 Ga0070708_100300753 3300005445 Archaea 1511
51 Ga0070678_100010958 3300005456 Bacteria 5565
52 Ga0070662_100161587 3300005457 Archaea 1752
53 Ga0070681_10095954 3300005458 Archaea 2913
54 Ga0068867_100016246 3300005459 Archaea 5286
55 Ga0068867_100018700 3300005459 Bacteria 4926
56 Ga0070706_100000721 3300005467 Bacteria 37231
57 Ga0070707_100023843 3300005468 Bacteria 5789
58 Ga0070707_100056994 3300005468 Bacteria 3748
59 Ga0070707_100271294 3300005468 Bacteria 1649
60 Ga0070707_100449737 3300005468 Bacteria 1249
61 Ga0070698_100029284 3300005471 Archaea 5714
62 Ga0070699_100233749 3300005518 Archaea 1639
63 Ga0070679_100310858 3300005530 Unclassified 1526
64 Ga0070672_100003972 3300005543 Archaea 9643
65 Ga0070696_100382081 3300005546 Bacteria 1098
66 Ga0070665_100001922 3300005548 Bacteria 23458
67 Ga0070665_100027521 3300005548 Bacteria 5727
68 Ga0070665_100085149 3300005548 Bacteria 3166
69 Ga0068855_100126250 3300005563 Bacteria 2925
70 Ga0070664_100013269 3300005564 Archaea 6711
71 Ga0068857_100044156 3300005577 Archaea 3952
72 Ga0068857_100257782 3300005577 Bacteria 1600
73 Ga0068854_100299172 3300005578 Archaea 1301
74 Ga0068864_100179508 3300005618 Unclassified 1935
75 Ga0068866_10004232 3300005718 Bacteria 5892
76 Ga0068866_10103902 3300005718 Archaea 1573
77 Ga0068861_100227741 3300005719 Bacteria 1579
78 Ga0068851_10097186 3300005834 Bacteria 1558
79 Ga0068870_10059667 3300005840 Archaea 2045
80 Ga0068870_10323755 3300005840 Unclassified 980
81 Ga0068860_100006111 3300005843 Bacteria 12111
82 Ga0068860_100625891 3300005843 Bacteria 1083
83 Ga0068862_100096399 3300005844 Bacteria 2582
84 Ga0081455_10003439 3300005937 Bacteria 18196
85 Ga0070717_10278782 3300006028 Bacteria 1482
86 Ga0070717_10620737 3300006028 Bacteria 981
87 Ga0097621_100124218 3300006237 Bacteria 2191
88 Ga0097621_100175763 3300006237 Bacteria 1848
89 Ga0075370_10200583 3300006353 Bacteria 1177
90 Ga0068871_100007368 3300006358 Bacteria 7852
91 Ga0075428_100034134 3300006844 Archaea 5613
92 Ga0075428_100082838 3300006844 Unclassified 3500
93 Ga0075428_100099586 3300006844 Unclassified 3169
94 Ga0075428_100389788 3300006844 Bacteria 1493
95 Ga0075430_100005797 3300006846 Archaea 10419
96 Ga0075430_100074261 3300006846 Archaea 2851
97 Ga0075431_100047320 3300006847 Archaea 4434
98 Ga0075431_100101386 3300006847 Archaea 2970
99 Ga0075431_100108739 3300006847 Bacteria 2861
100 Ga0075433_10005205 3300006852 Archaea 10193
101 Ga0075434_100040060 3300006871 Bacteria 4640
102 Ga0075434_100585446 3300006871 Bacteria 1135
103 Ga0075429_100017910 3300006880 Bacteria 6124
104 Ga0075429_100028851 3300006880 Archaea 4819
105 Ga0075429_100056257 3300006880 Plasmid 3423
106 Ga0075429_100122527 3300006880 Bacteria 2273
107 Ga0075429_100265352 3300006880 Bacteria 1503
108 Ga0075436_100283417 3300006914 Bacteria 1185
109 Ga0075435_100091240 3300007076 Bacteria 2514
110 Ga0075435_100281853 3300007076 Bacteria 1419
111 Ga0099794_10000593 3300007265 Bacteria 12139
112 Ga0099795_10118323 3300007788 Bacteria 1057
113 Ga0105240_10010197 3300009093 Bacteria 13224
114 Ga0105240_10020531 3300009093 Bacteria 8806
115 Ga0111539_10279037 3300009094 Archaea 1944
116 Ga0111539_10409624 3300009094 Bacteria 1579
117 Ga0105245_10100119 3300009098 Unclassified 2681
118 Ga0105247_10016888 3300009101 Bacteria 4376
119 Ga0114129_10115658 3300009147 Bacteria 3697
120 Ga0114129_10153466 3300009147 Bacteria 3151
121 Ga0114129_10190382 3300009147 Unclassified 2786
122 Ga0114129_10212871 3300009147 Bacteria 2612
123 Ga0114129_10255259 3300009147 Archaea 2352
124 Ga0114129_10677204 3300009147 Archaea 1328
125 Ga0105241_10141478 3300009174 Bacteria 1959
126 Ga0105242_10049484 3300009176 Unclassified 3421
127 Ga0105248_10028615 3300009177 Bacteria 6210
128 Ga0105248_10070642 3300009177 Bacteria 3921
129 Ga0105237_10001340 3300009545 Bacteria 32656
130 Ga0105237_10041534 3300009545 Bacteria 4638
131 Ga0105238_10006834 3300009551 Bacteria 11388
132 Ga0105238_10261692 3300009551 Bacteria 1709
133 Ga0105249_10009536 3300009553 Archaea 8506
134 Ga0105249_10470689 3300009553 Bacteria 1298
135 Ga0099796_10050284 3300010159 Bacteria 1444
136 Ga0105239_10002972 3300010375 Bacteria 21142
137 Ga0105239_10044436 3300010375 Bacteria 4870
138 Ga0105246_10015742 3300011119 Archaea 4781
139 Ga0157371_10141570 3300013102 Bacteria 1713
140 Ga0157370_10010652 3300013104 Bacteria 9679
141 Ga0157370_10496418 3300013104 Unclassified 1121
142 Ga0157374_10036217 3300013296 Bacteria 4518
143 Ga0157378_10023125 3300013297 Bacteria 5470
144 Ga0157378_10179673 3300013297 Archaea 1990
145 Ga0163162_10062090 3300013306 Bacteria 3776
146 Ga0163162_10066070 3300013306 Bacteria 3665
147 Ga0163162_10716886 3300013306 Bacteria 1121
148 Ga0157372_10068570 3300013307 Bacteria 3988
149 Ga0157375_10339488 3300013308 Bacteria 1668
150 Ga0163163_10663936 3300014325 Bacteria 1106
151 Ga0157380_10253906 3300014326 Unclassified 1593
152 Ga0182008_10005644 3300014497 Bacteria 7088
153 Ga0163161_10029912 3300017792 Bacteria 3873
154 Ga0163161_10242890 3300017792 Bacteria 1401
155 Ga0209436_110083 3300025208 Bacteria 1751
156 Ga0209566_101935 3300025225 Bacteria 4506
157 Ga0209672_101798 3300025228 Bacteria 6585
158 Ga0207427_101881 3300025231 Bacteria 6613
159 Ga0209258_100290 3300025242 Bacteria 82647
160 Ga0207425_1000630 3300025245 Bacteria 20024
161 Ga0209148_1000262 3300025254 Bacteria 82647
162 Ga0209759_1001788 3300025256 Bacteria 10899
163 Ga0209129_1000111 3300025258 Bacteria 148853
164 Ga0209233_1000456 3300025261 Bacteria 26708
165 Ga0209565_1000146 3300025263 Bacteria 97720
166 Ga0209673_1000664 3300025273 Bacteria 49941
167 Ga0209130_1000546 3300025284 Bacteria 37680
168 Ga0209675_1001438 3300025291 Bacteria 13756
169 Ga0209025_1000116 3300025294 Bacteria 218293
170 Ga0209564_1000155 3300025295 Bacteria 165859
171 Ga0209758_1000107 3300025297 Bacteria 218293
172 Ga0209256_1000087 3300025299 Bacteria 218290
173 Ga0207426_1000123 3300025302 Bacteria 218290
174 Ga0209051_1038226 3300025303 Bacteria 1749
175 Ga0209257_1011687 3300025304 Bacteria 4186
176 Ga0207713_1042995 3300025735 Bacteria 1870
177 Ga0207642_10020725 3300025899 Archaea 2573
178 Ga0207642_10187048 3300025899 Unclassified 1133
179 Ga0207647_10005932 3300025904 Bacteria 8904
180 Ga0207647_10020441 3300025904 Archaea 4440
181 Ga0207699_10279394 3300025906 Bacteria 1160
182 Ga0207645_10003461 3300025907 Archaea 11979
183 Ga0207645_10005489 3300025907 Bacteria 9180
184 Ga0207643_10001601 3300025908 Archaea 12795
185 Ga0207684_10000729 3300025910 Bacteria 38558
186 Ga0207684_10533687 3300025910 Bacteria 1004
187 Ga0207695_10009068 3300025913 Bacteria 12362
188 Ga0207695_10009921 3300025913 Bacteria 11701
189 Ga0207671_10000500 3300025914 Bacteria 53262
190 Ga0207660_10025116 3300025917 Archaea 4042
191 Ga0207646_10017222 3300025922 Bacteria 6769
192 Ga0207646_10132108 3300025922 Bacteria 2247
193 Ga0207681_10086311 3300025923 Archaea 2229
194 Ga0207644_10016597 3300025931 Bacteria 4956
195 Ga0207644_10364089 3300025931 Bacteria 1177
196 Ga0207706_10003019 3300025933 Bacteria 16227
197 Ga0207706_10044708 3300025933 Archaea 3924
198 Ga0207686_10376773 3300025934 Unclassified 1075
199 Ga0207686_10573835 3300025934 Bacteria 885
200 Ga0207669_10333574 3300025937 Unclassified 1165
201 Ga0207691_10011999 3300025940 Archaea 8311
202 Ga0207711_10017586 3300025941 Bacteria 5939
203 Ga0207689_10054330 3300025942 Bacteria 3299
204 Ga0207689_10114884 3300025942 Bacteria 2213
205 Ga0207667_10254563 3300025949 Bacteria 1796
206 Ga0207712_10040880 3300025961 Unclassified 3185
207 Ga0207668_10332037 3300025972 Bacteria 1265
208 Ga0207677_10043762 3300026023 Bacteria 2979
209 Ga0207677_10372044 3300026023 Bacteria 1203
210 Ga0207708_10019744 3300026075 Archaea 5081
211 Ga0207702_10591228 3300026078 Bacteria 1088
212 Ga0207648_10011042 3300026089 Archaea 8524
213 Ga0207648_10039686 3300026089 Bacteria 4138
214 Ga0207676_10226665 3300026095 Archaea 1668
215 Ga0207674_10011880 3300026116 Archaea 9762
216 Ga0207675_100352160 3300026118 Unclassified 1443
217 Ga0207675_100394011 3300026118 Unclassified 1364
218 Ga0207683_10021826 3300026121 Bacteria 5489
219 Ga0207698_10636271 3300026142 Unclassified 1055
220 Ga0209967_1003752 3300027364 Archaea 2004
221 Ga0209984_1007135 3300027424 Archaea 1383
222 Ga0209999_1002624 3300027543 Archaea 3184
223 Ga0210002_1000365 3300027617 Archaea 6146
224 Ga0209983_1003309 3300027665 Archaea 3454
225 Ga0209998_10003641 3300027717 Archaea 3345
226 Ga0209974_10010640 3300027876 Archaea 3104
227 Ga0207428_10015273 3300027907 Archaea 6646
228 Ga0265356_1005795 3300028017 Bacteria 1462
229 Ga0268266_10004752 3300028379 Bacteria 12912
230 Ga0268266_10037245 3300028379 Bacteria 4144
231 Ga0268265_10051798 3300028380 Bacteria 3100
232 Ga0268264_10902045 3300028381 Bacteria 887
233 Ga0265339_10008188 3300031249 Bacteria 6670
234 Ga0307509_10228682 3300031507 Bacteria 1665
235 Ga0307416_100031603 3300032002 Bacteria 3988
236 Ga0307416_100791139 3300032002 Bacteria 1044
237 Ga0316212_1010886 3300033547 Bacteria 1301
238 Ga0373961_0000939 3300035241 Archaea 9714
239 Ga0395898_0445981 3300037466 Bacteria 1233
240 Ga0436364_0730779 3300037853 Bacteria 964
241 Ga0436363_1522340 3300039450 Bacteria 1371
242 Ga0466969_0009968 3300044656 Bacteria 5038
243 Ga0453683_0000007 3300044673 Bacteria 581341
244 Ga0466966_0040162 3300044684 Bacteria 3012
245 Ga0453684_0016330 3300044712 Bacteria 11622
246 Ga0495591_010397 3300046458 Bacteria 3611
247 Ga0495650_0002228 3300046471 Bacteria 16242
248 Ga0495580_0128010 3300046472 Bacteria 1762
249 Ga0495605_0000036 3300046474 Bacteria 203902
250 Ga0495583_0000028 3300046506 Bacteria 255787
251 Ga0495606_0086504 3300046507 Bacteria 1937
252 Ga0495610_0022815 3300046512 Bacteria 3414
253 Ga0495610_0078842 3300046512 Bacteria 1517
254 Ga0495616_0004613 3300046513 Bacteria 8654
255 Ga0495620_0000028 3300046515 Bacteria 123172
256 Ga0495631_0010134 3300046518 Bacteria 4678
257 Ga0495637_0019399 3300046520 Bacteria 3144
258 Ga0495637_0061503 3300046520 Bacteria 1539
259 Ga0495648_0000597 3300046524 Bacteria 38655
260 Ga0495663_0105984 3300046525 Bacteria 930
261 Ga0495654_0001114 3300046530 Bacteria 19384
262 Ga0495609_0000081 3300046538 Bacteria 116100
263 Ga0495597_0005643 3300046542 Bacteria 6593
264 Ga0495633_0000028 3300046558 Bacteria 203214
265 Ga0495668_0017192 3300046616 Bacteria 4200
266 Ga0495611_0000648 3300046648 Bacteria 19911
267 Ga0495625_0000547 3300046660 Bacteria 55124
268 Ga0495625_0094133 3300046660 Bacteria 2067
269 Ga0495625_0215599 3300046660 Bacteria 1260
270 Ga0495661_0000217 3300046665 Bacteria 66241
271 Ga0495671_0023374 3300046692 Bacteria 3229
272 Ga0495589_0001669 3300046794 Bacteria 12728
273 Ga0495660_0001181 3300046810 Bacteria 18415
274 Ga0495683_0000060 3300047323 Bacteria 115881
275 Ga0495679_001949 3300047446 Bacteria 11019
276 Ga0495673_0001796 3300047469 Bacteria 16266
277 Ga0495673_0017855 3300047469 Bacteria 3590
278 Ga0495681_0002397 3300047470 Bacteria 13416
279 Ga0495686_0021029 3300047472 Bacteria 4343
280 Ga0495686_0095434 3300047472 Bacteria 1801
281 Ga0496102_0206897 3300048905 Archaea 1850
282 Ga0496104_0000027 3300048907 Bacteria 203475
283 Ga0496109_0302262 3300048912 Archaea 1509
284 Ga0496118_0174308 3300048921 Bacteria 1309
285 Ga0496122_0001649 3300048925 Bacteria 34644
286 Ga0496122_0073353 3300048925 Bacteria 2427
287 Ga0496123_0007210 3300048926 Bacteria 10549
288 Ga0496125_0075241 3300048928 Bacteria 2614
289 Ga0495678_000020 3300049459 Bacteria 253654
290 Ga0495678_073386 3300049459 Bacteria 1248
291 Ga0501083_0065019 3300049744 Bacteria 2430
292 nmdc:mga05p37_133931_c1 3300050507 Bacteria 3040
293 nmdc:mga05p37_141300_c1 3300050507 Bacteria 2950
294 nmdc:mga05p37_299656_c1 3300050507 Bacteria 1911
295 nmdc:mga05p37_5567_c1 3300050507 Archaea 12717
296 nmdc:mga09592_10090_c1 3300050508 Bacteria 7681
297 nmdc:mga09592_117878_c1 3300050508 Unclassified 2279
298 nmdc:mga09592_185734_c1 3300050508 Bacteria 1799
299 nmdc:mga09592_8145_c1 3300050508 Archaea 8522
300 nmdc:mga0qj67_228018_c1 3300050509 Unclassified 1512
301 nmdc:mga0qj67_60674_c1 3300050509 Archaea 3002
302 nmdc:mga06r32_11176_c1 3300050510 Bacteria 8087
303 nmdc:mga06r32_236370_c1 3300050510 Bacteria 1815
304 nmdc:mga06r32_30190_c1 3300050510 Archaea 5086
305 nmdc:mga06r32_593098_c1 3300050510 Archaea 1079
306 nmdc:mga08y16_466159_c1 3300050511 Unclassified 1287
307 nmdc:mga08y16_79686_c1 3300050511 Unclassified 3414
308 nmdc:mga0n895_452998_c1 3300050512 Bacteria 1295
309 nmdc:mga0n895_48278_c1 3300050512 Bacteria 4166
310 nmdc:mga0rr50_120323_c1 3300050513 Bacteria 2089
311 nmdc:mga0a205_325183_c1 3300050515 Bacteria 1408
312 nmdc:mga0a205_94254_c1 3300050515 Bacteria 2892
313 Ga0500578_0059235 3300053086 Bacteria 2447
314 Ga0500594_0002155 3300053118 Bacteria 4263
315 Ga0500568_0001051 3300053139 Bacteria 18831
316 Ga0500645_004446 3300053730 Bacteria 5380

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032002 Ga0307416_100031603 Ga0307416_1000316033 211
2 3300013104 Ga0157370_10010652 Ga0157370_100106523 222
3 3300014497 Ga0182008_10005644 Ga0182008_100056445 222
4 3300027665 Ga0209983_1003309 Ga0209983_10033091 235
5 3300003761 Ga0055535_1000375 Ga0055535_100037531 236
6 3300003762 Ga0055542_1000215 Ga0055542_100021531 236
7 3300025228 Ga0209672_101798 Ga0209672_1017989 236
8 3300025242 Ga0209258_100290 Ga0209258_10029042 236
9 3300025254 Ga0209148_1000262 Ga0209148_100026242 236
10 3300006028 Ga0070717_10278782 Ga0070717_102787822 241
11 3300025735 Ga0207713_1042995 Ga0207713_10429953 241
12 3300025922 Ga0207646_10132108 Ga0207646_101321082 241
13 3300037853 Ga0436364_0730779 Ga0436364_0730779_102_833 241
14 3300046458 Ga0495591_010397 Ga0495591_010397_126_854 241
15 3300046474 Ga0495605_0000036 Ga0495605_0000036_179044_179772 241
16 3300046506 Ga0495583_0000028 Ga0495583_0000028_194315_195043 241
17 3300046512 Ga0495610_0078842 Ga0495610_0078842_532_1260 241
18 3300046515 Ga0495620_0000028 Ga0495620_0000028_67535_68263 241
19 3300046518 Ga0495631_0010134 Ga0495631_0010134_3648_4376 241
20 3300046520 Ga0495637_0019399 Ga0495637_0019399_2316_3044 241
21 3300046524 Ga0495648_0000597 Ga0495648_0000597_10859_11587 241
22 3300046530 Ga0495654_0001114 Ga0495654_0001114_532_1260 241
23 3300046538 Ga0495609_0000081 Ga0495609_0000081_60889_61617 241
24 3300046542 Ga0495597_0005643 Ga0495597_0005643_5331_6059 241
25 3300046558 Ga0495633_0000028 Ga0495633_0000028_52887_53615 241
26 3300046648 Ga0495611_0000648 Ga0495611_0000648_373_1101 241
27 3300046665 Ga0495661_0000217 Ga0495661_0000217_12872_13600 241
28 3300046692 Ga0495671_0023374 Ga0495671_0023374_396_1124 241
29 3300046794 Ga0495589_0001669 Ga0495589_0001669_3621_4349 241
30 3300046810 Ga0495660_0001181 Ga0495660_0001181_568_1296 241
31 3300047323 Ga0495683_0000060 Ga0495683_0000060_59659_60387 241
32 3300047446 Ga0495679_001949 Ga0495679_001949_8330_9058 241
33 3300047469 Ga0495673_0017855 Ga0495673_0017855_2490_3218 241
34 3300047470 Ga0495681_0002397 Ga0495681_0002397_10253_10981 241
35 3300049459 Ga0495678_000020 Ga0495678_000020_192453_193181 241
36 3300044673 Ga0453683_0000007 Ga0453683_0000007_415981_416730 242
37 3300044712 Ga0453684_0016330 Ga0453684_0016330_5533_6282 242
38 3300005434 Ga0070709_10155442 Ga0070709_101554422 243
39 3300005439 Ga0070711_100340814 Ga0070711_1003408142 243
40 3300007076 Ga0075435_100281853 Ga0075435_1002818532 243
41 3300025906 Ga0207699_10279394 Ga0207699_102793942 243
42 iso_pu_bacteria 2837651117 2837651249 243
43 iso_pu_bacteria 2831426010 2831427419 244
44 iso_pu_bacteria 2599185214 2599625908 245
45 iso_pu_bacteria 2599185226 2599675010 245
46 iso_pu_bacteria 2599185227 2599683904 245
47 iso_pu_bacteria 2599185229 2599695493 245
48 iso_pu_bacteria 2738541277 2738722831 245
49 iso_pu_bacteria 2738541307 2738883927 245
50 iso_pu_bacteria 2738543019 2739283402 245
51 iso_pu_bacteria 2904449895 2904454690 245
52 iso_pu_bacteria 2904456579 2904460387 245
53 iso_pu_bacteria 2928070936 2928076321 245
54 iso_pu_bacteria 2928084124 2928088894 245
55 iso_pu_bacteria 2945909444 2945912855 245
56 3300009551 Ga0105238_10261692 Ga0105238_102616922 246
57 3300031507 Ga0307509_10228682 Ga0307509_102286822 246
58 iso_pu_bacteria 2945984333 2945984868 246
59 3300005445 Ga0070708_100103027 Ga0070708_1001030272 247
60 3300005577 Ga0068857_100257782 Ga0068857_1002577822 247
61 3300006353 Ga0075370_10200583 Ga0075370_102005831 247
62 3300032002 Ga0307416_100791139 Ga0307416_1007911391 247
63 3300003320 rootH2_10037976 rootH2_100379764 248
64 3300003322 rootL2_10179222 rootL2_101792224 248
65 3300003841 Ga0055541_1014322 Ga0055541_10143221 248
66 3300003841 Ga0055541_1018149 Ga0055541_10181491 248
67 3300005293 Ga0065715_10022490 Ga0065715_100224901 248
68 3300005328 Ga0070676_10023185 Ga0070676_100231854 248
69 3300005334 Ga0068869_100022231 Ga0068869_1000222317 248
70 3300005338 Ga0068868_100069097 Ga0068868_1000690972 248
71 3300005338 Ga0068868_100467426 Ga0068868_1004674262 248
72 3300005339 Ga0070660_100141413 Ga0070660_1001414132 248
73 3300005339 Ga0070660_100384432 Ga0070660_1003844321 248
74 3300005347 Ga0070668_100032854 Ga0070668_1000328541 248
75 3300005353 Ga0070669_100120599 Ga0070669_1001205994 248
76 3300005355 Ga0070671_100002693 Ga0070671_1000026938 248
77 3300005356 Ga0070674_100098182 Ga0070674_1000981823 248
78 3300005445 Ga0070708_100030966 Ga0070708_1000309662 248
79 3300005456 Ga0070678_100010958 Ga0070678_1000109587 248
80 3300005459 Ga0068867_100018700 Ga0068867_1000187001 248
81 3300005467 Ga0070706_100000721 Ga0070706_10000072128 248
82 3300005468 Ga0070707_100023843 Ga0070707_1000238433 248
83 3300005468 Ga0070707_100056994 Ga0070707_1000569942 248
84 3300005468 Ga0070707_100449737 Ga0070707_1004497372 248
85 3300005546 Ga0070696_100382081 Ga0070696_1003820812 248
86 3300005548 Ga0070665_100027521 Ga0070665_1000275214 248
87 3300005548 Ga0070665_100085149 Ga0070665_1000851494 248
88 3300005563 Ga0068855_100126250 Ga0068855_1001262506 248
89 3300005718 Ga0068866_10004232 Ga0068866_100042325 248
90 3300005719 Ga0068861_100227741 Ga0068861_1002277413 248
91 3300005834 Ga0068851_10097186 Ga0068851_100971862 248
92 3300005840 Ga0068870_10323755 Ga0068870_103237551 248
93 3300005843 Ga0068860_100006111 Ga0068860_1000061112 248
94 3300005843 Ga0068860_100625891 Ga0068860_1006258911 248
95 3300005844 Ga0068862_100096399 Ga0068862_1000963993 248
96 3300005937 Ga0081455_10003439 Ga0081455_100034395 248
97 3300006028 Ga0070717_10620737 Ga0070717_106207372 248
98 3300006237 Ga0097621_100124218 Ga0097621_1001242181 248
99 3300006358 Ga0068871_100007368 Ga0068871_1000073684 248
100 3300006844 Ga0075428_100082838 Ga0075428_1000828384 248
101 3300006846 Ga0075430_100074261 Ga0075430_1000742612 248
102 3300006847 Ga0075431_100101386 Ga0075431_1001013863 248
103 3300006852 Ga0075433_10005205 Ga0075433_1000520514 248
104 3300006871 Ga0075434_100040060 Ga0075434_1000400603 248
105 3300006871 Ga0075434_100585446 Ga0075434_1005854461 248
106 3300006880 Ga0075429_100122527 Ga0075429_1001225272 248
107 3300006914 Ga0075436_100283417 Ga0075436_1002834172 248
108 3300007076 Ga0075435_100091240 Ga0075435_1000912402 248
109 3300009094 Ga0111539_10279037 Ga0111539_102790373 248
110 3300009098 Ga0105245_10100119 Ga0105245_101001193 248
111 3300009147 Ga0114129_10255259 Ga0114129_102552593 248
112 3300009174 Ga0105241_10141478 Ga0105241_101414783 248
113 3300009177 Ga0105248_10028615 Ga0105248_100286156 248
114 3300009177 Ga0105248_10070642 Ga0105248_100706423 248
115 3300009553 Ga0105249_10470689 Ga0105249_104706892 248
116 3300013102 Ga0157371_10141570 Ga0157371_101415703 248
117 3300013296 Ga0157374_10036217 Ga0157374_100362177 248
118 3300013297 Ga0157378_10023125 Ga0157378_100231254 248
119 3300013297 Ga0157378_10179673 Ga0157378_101796732 248
120 3300013306 Ga0163162_10062090 Ga0163162_100620902 248
121 3300013306 Ga0163162_10066070 Ga0163162_100660702 248
122 3300013306 Ga0163162_10716886 Ga0163162_107168861 248
123 3300013307 Ga0157372_10068570 Ga0157372_100685706 248
124 3300013308 Ga0157375_10339488 Ga0157375_103394882 248
125 3300014325 Ga0163163_10663936 Ga0163163_106639361 248
126 3300017792 Ga0163161_10242890 Ga0163161_102428902 248
127 3300025225 Ga0209566_101935 Ga0209566_1019352 248
128 3300025256 Ga0209759_1001788 Ga0209759_10017883 248
129 3300025899 Ga0207642_10187048 Ga0207642_101870482 248
130 3300025904 Ga0207647_10005932 Ga0207647_100059323 248
131 3300025907 Ga0207645_10005489 Ga0207645_1000548911 248
132 3300025910 Ga0207684_10000729 Ga0207684_1000072921 248
133 3300025913 Ga0207695_10009068 Ga0207695_100090689 248
134 3300025914 Ga0207671_10000500 Ga0207671_1000050021 248
135 3300025922 Ga0207646_10017222 Ga0207646_100172223 248
136 3300025931 Ga0207644_10016597 Ga0207644_100165974 248
137 3300025931 Ga0207644_10364089 Ga0207644_103640892 248
138 3300025933 Ga0207706_10003019 Ga0207706_1000301920 248
139 3300025934 Ga0207686_10573835 Ga0207686_105738351 248
140 3300025941 Ga0207711_10017586 Ga0207711_100175866 248
141 3300025942 Ga0207689_10054330 Ga0207689_100543302 248
142 3300025942 Ga0207689_10114884 Ga0207689_101148843 248
143 3300025949 Ga0207667_10254563 Ga0207667_102545632 248
144 3300025972 Ga0207668_10332037 Ga0207668_103320372 248
145 3300026023 Ga0207677_10043762 Ga0207677_100437623 248
146 3300026023 Ga0207677_10372044 Ga0207677_103720442 248
147 3300026078 Ga0207702_10591228 Ga0207702_105912282 248
148 3300026089 Ga0207648_10039686 Ga0207648_100396864 248
149 3300026118 Ga0207675_100394011 Ga0207675_1003940111 248
150 3300026121 Ga0207683_10021826 Ga0207683_100218263 248
151 3300026142 Ga0207698_10636271 Ga0207698_106362711 248
152 3300028379 Ga0268266_10004752 Ga0268266_100047526 248
153 3300028379 Ga0268266_10037245 Ga0268266_100372453 248
154 3300028380 Ga0268265_10051798 Ga0268265_100517981 248
155 3300028381 Ga0268264_10902045 Ga0268264_109020451 248
156 3300044656 Ga0466969_0009968 Ga0466969_0009968_1687_2436 248
157 3300044684 Ga0466966_0040162 Ga0466966_0040162_2135_2884 248
158 3300046471 Ga0495650_0002228 Ga0495650_0002228_3813_4565 248
159 3300046472 Ga0495580_0128010 Ga0495580_0128010_765_1517 248
160 3300046660 Ga0495625_0215599 Ga0495625_0215599_489_1238 248
161 3300048907 Ga0496104_0000027 Ga0496104_0000027_144906_145658 248
162 3300049744 Ga0501083_0065019 Ga0501083_0065019_1078_1830 248
163 3300050507 nmdc:mga05p37_141300_c1 nmdc:mga05p37_141300_c1_489_1238 248
164 3300050510 nmdc:mga06r32_11176_c1 nmdc:mga06r32_11176_c1_2700_3446 248
165 3300050512 nmdc:mga0n895_452998_c1 nmdc:mga0n895_452998_c1_47_796 248
166 3300050512 nmdc:mga0n895_48278_c1 nmdc:mga0n895_48278_c1_1278_2027 248
167 3300050513 nmdc:mga0rr50_120323_c1 nmdc:mga0rr50_120323_c1_1227_1976 248
168 3300050515 nmdc:mga0a205_94254_c1 nmdc:mga0a205_94254_c1_818_1567 248
169 iso_pu_bacteria 2904541872 2904546284 248
170 iso_pu_bacteria 2929160207 2929164099 248
171 3300002739 JGI25158J39367_1017161 JGI25158J39367_10171611 249
172 3300002773 JGI25152J39213_1008010 JGI25152J39213_10080102 249
173 3300002774 JGI25150J39212_1000972 JGI25150J39212_10009725 249
174 3300002774 JGI25150J39212_1001224 JGI25150J39212_10012244 249
175 3300002987 JGI25159J45721_1001830 JGI25159J45721_10018303 249
176 3300003187 JGI25151J46595_10017565 JGI25151J46595_100175652 249
177 3300003214 JGI25165J46597_1007519 JGI25165J46597_10075191 249
178 3300003215 JGI25153J46596_10003354 JGI25153J46596_100033545 249
179 3300003354 JGI25160J50197_1002645 JGI25160J50197_10026453 249
180 3300003374 JGI25161J50226_1004134 JGI25161J50226_10041342 249
181 3300003771 Ga0055526_1015238 Ga0055526_10152383 249
182 3300003773 Ga0055537_1001670 Ga0055537_10016703 249
183 3300003775 Ga0055524_1013358 Ga0055524_10133583 249
184 3300003784 Ga0055534_1001175 Ga0055534_10011758 249
185 3300003790 Ga0055528_1002101 Ga0055528_10021018 249
186 3300003792 Ga0055540_1024453 Ga0055540_10244532 249
187 3300003794 Ga0055531_10011906 Ga0055531_100119062 249
188 3300004625 Ga0055543_1002150 Ga0055543_10021505 249
189 3300005262 Ga0065165_1004103 Ga0065165_10041034 249
190 3300005438 Ga0070701_10199203 Ga0070701_101992032 249
191 3300005457 Ga0070662_100161587 Ga0070662_1001615873 249
192 3300005530 Ga0070679_100310858 Ga0070679_1003108581 249
193 3300005548 Ga0070665_100001922 Ga0070665_10000192220 249
194 3300005577 Ga0068857_100044156 Ga0068857_1000441564 249
195 3300005618 Ga0068864_100179508 Ga0068864_1001795083 249
196 3300005840 Ga0068870_10059667 Ga0068870_100596675 249
197 3300006237 Ga0097621_100175763 Ga0097621_1001757632 249
198 3300006844 Ga0075428_100389788 Ga0075428_1003897881 249
199 3300006847 Ga0075431_100108739 Ga0075431_1001087393 249
200 3300006880 Ga0075429_100265352 Ga0075429_1002653522 249
201 3300007788 Ga0099795_10118323 Ga0099795_101183232 249
202 3300009093 Ga0105240_10020531 Ga0105240_100205313 249
203 3300009094 Ga0111539_10409624 Ga0111539_104096241 249
204 3300009147 Ga0114129_10212871 Ga0114129_102128712 249
205 3300009545 Ga0105237_10041534 Ga0105237_100415346 249
206 3300010159 Ga0099796_10050284 Ga0099796_100502842 249
207 3300010375 Ga0105239_10044436 Ga0105239_100444366 249
208 3300013104 Ga0157370_10496418 Ga0157370_104964181 249
209 3300017792 Ga0163161_10029912 Ga0163161_100299124 249
210 3300025208 Ga0209436_110083 Ga0209436_1100832 249
211 3300025231 Ga0207427_101881 Ga0207427_1018816 249
212 3300025245 Ga0207425_1000630 Ga0207425_10006305 249
213 3300025258 Ga0209129_1000111 Ga0209129_100011176 249
214 3300025261 Ga0209233_1000456 Ga0209233_10004563 249
215 3300025263 Ga0209565_1000146 Ga0209565_100014684 249
216 3300025273 Ga0209673_1000664 Ga0209673_100066428 249
217 3300025284 Ga0209130_1000546 Ga0209130_100054614 249
218 3300025291 Ga0209675_1001438 Ga0209675_10014388 249
219 3300025294 Ga0209025_1000116 Ga0209025_100011684 249
220 3300025295 Ga0209564_1000155 Ga0209564_100015584 249
221 3300025297 Ga0209758_1000107 Ga0209758_100010784 249
222 3300025299 Ga0209256_1000087 Ga0209256_100008784 249
223 3300025302 Ga0207426_1000123 Ga0207426_100012384 249
224 3300025303 Ga0209051_1038226 Ga0209051_10382262 249
225 3300025304 Ga0209257_1011687 Ga0209257_10116874 249
226 3300025904 Ga0207647_10020441 Ga0207647_100204412 249
227 3300025913 Ga0207695_10009921 Ga0207695_1000992112 249
228 3300025917 Ga0207660_10025116 Ga0207660_100251163 249
229 3300025923 Ga0207681_10086311 Ga0207681_100863113 249
230 3300025933 Ga0207706_10044708 Ga0207706_100447084 249
231 3300025937 Ga0207669_10333574 Ga0207669_103335742 249
232 3300025961 Ga0207712_10040880 Ga0207712_100408804 249
233 3300026095 Ga0207676_10226665 Ga0207676_102266653 249
234 3300026118 Ga0207675_100352160 Ga0207675_1003521602 249
235 3300031249 Ga0265339_10008188 Ga0265339_100081885 249
236 3300033547 Ga0316212_1010886 Ga0316212_10108862 249
237 3300039450 Ga0436363_1522340 Ga0436363_1522340_482_1237 249
238 3300046512 Ga0495610_0022815 Ga0495610_0022815_2247_2999 249
239 3300046520 Ga0495637_0061503 Ga0495637_0061503_206_958 249
240 3300046525 Ga0495663_0105984 Ga0495663_0105984_152_904 249
241 3300046660 Ga0495625_0094133 Ga0495625_0094133_622_1374 249
242 3300047469 Ga0495673_0001796 Ga0495673_0001796_7089_7844 249
243 3300048925 Ga0496122_0073353 Ga0496122_0073353_771_1523 249
244 3300048926 Ga0496123_0007210 Ga0496123_0007210_827_1579 249
245 3300048928 Ga0496125_0075241 Ga0496125_0075241_1435_2187 249
246 3300049459 Ga0495678_073386 Ga0495678_073386_85_837 249
247 3300050508 nmdc:mga09592_185734_c1 nmdc:mga09592_185734_c1_498_1250 249
248 3300050509 nmdc:mga0qj67_228018_c1 nmdc:mga0qj67_228018_c1_103_855 249
249 3300050510 nmdc:mga06r32_236370_c1 nmdc:mga06r32_236370_c1_785_1537 249
250 3300050511 nmdc:mga08y16_466159_c1 nmdc:mga08y16_466159_c1_177_929 249
251 3300053118 Ga0500594_0002155 Ga0500594_0002155_3188_3940 249
252 3300053139 Ga0500568_0001051 Ga0500568_0001051_6694_7446 249
253 3300007265 Ga0099794_10000593 Ga0099794_100005936 251
254 3300037466 Ga0395898_0445981 Ga0395898_0445981_131_892 251
255 3300047472 Ga0495686_0021029 Ga0495686_0021029_1824_2585 251
256 3300046507 Ga0495606_0086504 Ga0495606_0086504_416_1180 252
257 3300047472 Ga0495686_0095434 Ga0495686_0095434_418_1182 252
258 3300053086 Ga0500578_0059235 Ga0500578_0059235_1299_2063 252
259 3300053730 Ga0500645_004446 Ga0500645_004446_1369_2133 252
260 3300050507 nmdc:mga05p37_299656_c1 nmdc:mga05p37_299656_c1_718_1482 253
261 3300005468 Ga0070707_100271294 Ga0070707_1002712941 255
262 3300009147 Ga0114129_10153466 Ga0114129_101534661 255
263 3300025910 Ga0207684_10533687 Ga0207684_105336871 255
264 3300028017 Ga0265356_1005795 Ga0265356_10057952 255
265 3300050507 nmdc:mga05p37_133931_c1 nmdc:mga05p37_133931_c1_2233_3009 255
266 3300050515 nmdc:mga0a205_325183_c1 nmdc:mga0a205_325183_c1_577_1353 255
267 3300048925 Ga0496122_0001649 Ga0496122_0001649_26754_27539 257
268 3300009093 Ga0105240_10010197 Ga0105240_100101974 259
269 3300009101 Ga0105247_10016888 Ga0105247_100168886 259
270 3300009545 Ga0105237_10001340 Ga0105237_100013406 259
271 3300009551 Ga0105238_10006834 Ga0105238_100068342 259
272 3300010375 Ga0105239_10002972 Ga0105239_1000297211 259
273 3300006844 Ga0075428_100034134 Ga0075428_1000341344 260
274 3300006846 Ga0075430_100005797 Ga0075430_1000057974 260
275 3300006847 Ga0075431_100047320 Ga0075431_1000473203 260
276 3300006880 Ga0075429_100028851 Ga0075429_1000288513 260
277 3300050508 nmdc:mga09592_8145_c1 nmdc:mga09592_8145_c1_2614_3411 260
278 3300050509 nmdc:mga0qj67_60674_c1 nmdc:mga0qj67_60674_c1_884_1681 260
279 3300050510 nmdc:mga06r32_30190_c1 nmdc:mga06r32_30190_c1_1292_2089 260
280 2162886007 SwRhRL2b_contig_3060615 SwRhRL2b_0979.00005600 261
281 3300005290 Ga0065712_10004223 Ga0065712_100042233 261
282 3300005295 Ga0065707_10000638 Ga0065707_1000063826 261
283 3300005328 Ga0070676_10053070 Ga0070676_100530702 261
284 3300005331 Ga0070670_100052969 Ga0070670_1000529694 261
285 3300005336 Ga0070680_100009280 Ga0070680_1000092806 261
286 3300005441 Ga0070700_100130285 Ga0070700_1001302852 261
287 3300005444 Ga0070694_100033381 Ga0070694_1000333812 261
288 3300005445 Ga0070708_100300753 Ga0070708_1003007532 261
289 3300005458 Ga0070681_10095954 Ga0070681_100959543 261
290 3300005459 Ga0068867_100016246 Ga0068867_1000162465 261
291 3300005471 Ga0070698_100029284 Ga0070698_1000292845 261
292 3300005518 Ga0070699_100233749 Ga0070699_1002337492 261
293 3300005543 Ga0070672_100003972 Ga0070672_10000397210 261
294 3300005564 Ga0070664_100013269 Ga0070664_1000132695 261
295 3300005578 Ga0068854_100299172 Ga0068854_1002991721 261
296 3300005718 Ga0068866_10103902 Ga0068866_101039022 261
297 3300006844 Ga0075428_100099586 Ga0075428_1000995863 261
298 3300006880 Ga0075429_100017910 Ga0075429_1000179106 261
299 3300006880 Ga0075429_100056257 Ga0075429_1000562574 261
300 3300009147 Ga0114129_10115658 Ga0114129_101156582 261
301 3300009147 Ga0114129_10190382 Ga0114129_101903823 261
302 3300009147 Ga0114129_10677204 Ga0114129_106772042 261
303 3300009176 Ga0105242_10049484 Ga0105242_100494842 261
304 3300009553 Ga0105249_10009536 Ga0105249_100095362 261
305 3300011119 Ga0105246_10015742 Ga0105246_100157423 261
306 3300014326 Ga0157380_10253906 Ga0157380_102539062 261
307 3300025899 Ga0207642_10020725 Ga0207642_100207252 261
308 3300025907 Ga0207645_10003461 Ga0207645_100034612 261
309 3300025908 Ga0207643_10001601 Ga0207643_100016018 261
310 3300025934 Ga0207686_10376773 Ga0207686_103767731 261
311 3300025940 Ga0207691_10011999 Ga0207691_100119993 261
312 3300026075 Ga0207708_10019744 Ga0207708_100197445 261
313 3300026089 Ga0207648_10011042 Ga0207648_100110428 261
314 3300026116 Ga0207674_10011880 Ga0207674_100118809 261
315 3300027364 Ga0209967_1003752 Ga0209967_10037522 261
316 3300027424 Ga0209984_1007135 Ga0209984_10071352 261
317 3300027543 Ga0209999_1002624 Ga0209999_10026242 261
318 3300027617 Ga0210002_1000365 Ga0210002_10003653 261
319 3300027717 Ga0209998_10003641 Ga0209998_100036412 261
320 3300027876 Ga0209974_10010640 Ga0209974_100106402 261
321 3300027907 Ga0207428_10015273 Ga0207428_100152733 261
322 3300035241 Ga0373961_0000939 Ga0373961_0000939_8025_8810 261
323 3300046513 Ga0495616_0004613 Ga0495616_0004613_7660_8556 261
324 3300046616 Ga0495668_0017192 Ga0495668_0017192_1964_2860 261
325 3300046660 Ga0495625_0000547 Ga0495625_0000547_52385_53188 261
326 3300048905 Ga0496102_0206897 Ga0496102_0206897_36_821 261
327 3300048912 Ga0496109_0302262 Ga0496109_0302262_341_1126 261
328 3300048921 Ga0496118_0174308 Ga0496118_0174308_13_978 261
329 3300050507 nmdc:mga05p37_5567_c1 nmdc:mga05p37_5567_c1_6601_7386 261
330 3300050508 nmdc:mga09592_10090_c1 nmdc:mga09592_10090_c1_1658_2443 261
331 3300050508 nmdc:mga09592_117878_c1 nmdc:mga09592_117878_c1_739_1524 261
332 3300050510 nmdc:mga06r32_593098_c1 nmdc:mga06r32_593098_c1_270_1055 261
333 3300050511 nmdc:mga08y16_79686_c1 nmdc:mga08y16_79686_c1_555_1340 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

56

242

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

62

296

0.94

PF08659

KR

KR domain

57

228

0.91

PF23441

49

298

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.991 15 261
4i5f-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s 0.9889 15 261
4fgs-assembly1.cif.gz_D crystal structure of a probable dehydrogenase protein 0.9885 15 261
4i5g-assembly1.cif.gz_C crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s, a86n, s88a 0.9882 15 261
4fgs-assembly1.cif.gz_B crystal structure of a probable dehydrogenase protein 0.9877 15 261
ID Description Score Start End Superfamily
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.976 14 261 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9648 13 194 3.40.50.720
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9593 14 261 3.40.50.720
1ulsC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9574 17 258 3.40.50.720
5thqC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9544 15 257 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V6STH1-F1-model_v4 Oxidoreductase 0.9948 14 194 GO:0016491
AF-A0A1Q7JAS9-F1-model_v4 Oxidoreductase 0.991 14 188 GO:0016491
AF-X8B3F9-F1-model_v4 deleted 0.9893 14 175
AF-A0A2R7KXK9-F1-model_v4 deleted 0.9888 14 181
AF-Q0RX75-F1-model_v4 Probable glucose dehydrogenase (EC 1.1.1.-) 0.988 14 194 GO:0016491

Feature Viewer

pLDDT pTM Quality
93.13 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map