F411527
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 333 | 223 | 273 | 300 |
Family's Representative Sequence
| Representative Sequence | 3300048919|Ga0496116_0002674|Ga0496116_0002674_16193_17239 |
| Length | 348 |
| Sequence | MSCVPPGRLMGPRTAKAAREEHSIRKRRAGLPPTDALGDGAPGQPRRYPLPMAYERFEAPEAAPPPRWRHYWKLMRADRPIGTLLLLWPTWWALWLASGGLPPLWTLFVFTAGVWLTRSAGCVINDYADRWLDPHVKRTKDRPLASGAVSGREALALFAGLMIVAFGLVLTLNWLTIGMSFIGVFLAASYPYLKRYTHLPQVYLGMAFGWGIPMAFAAVQGEVPVIGWLLYGANILWSTAYDTWYAMVDRDDDLKMGSHSTAILFGDLDLVIQGILYALFLGTMALVGLRAGLGFYYGVGXXVAAGLIAYEFWIARKRERDPCFKAFLHNNWVGAALFAGIAVALAVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 3 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 4 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 5 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 6 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 7 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 8 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 9 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 10 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 11 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 12 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 13 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 14 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 15 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 16 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 17 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 18 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 19 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 20 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 21 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 22 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 23 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 24 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 25 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 26 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 27 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 28 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 29 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 30 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 31 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 32 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 33 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 34 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 35 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 36 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 37 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 38 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 39 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 40 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 41 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 42 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 43 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 44 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 45 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 46 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 47 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 48 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 49 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 50 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 51 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 52 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 53 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 54 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 55 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 56 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 57 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 58 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 59 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 60 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 61 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 62 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 63 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 64 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 65 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 66 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 67 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 68 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 69 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 70 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 71 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 72 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 77 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 86 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 99 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 127 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 128 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 129 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 130 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 131 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 132 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 134 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 135 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 136 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 137 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 138 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 139 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 140 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 141 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 142 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 143 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 144 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 145 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 146 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 147 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 148 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 149 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 150 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 151 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 152 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 153 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 154 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 155 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 156 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 157 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 158 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 159 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 160 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 161 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 162 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 163 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 164 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 177 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 180 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 181 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 182 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 183 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 184 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 185 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 186 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 187 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 188 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 189 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 190 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 191 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 192 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 193 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 194 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 207 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 208 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 209 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 210 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 212 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 213 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 214 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 215 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 218 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 219 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 220 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 221 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 222 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 223 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.98 |
| Metatranscriptomes | 0 |
| Isolates | 18.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.3 |
| Bulb | 0 |
| Endosphere | 19.82 |
| Nodule | 0.3 |
| Rhizoplane | 4.5 |
| Rhizosphere | 53.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 21.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2189992 | 2162886007 | Bacteria | 3215 |
| 2 | JGI25152J39213_1000004 | 3300002773 | Bacteria | 191383 |
| 3 | JGI25151J46595_10000010 | 3300003187 | Bacteria | 277507 |
| 4 | JGI25151J46595_10000127 | 3300003187 | Bacteria | 102790 |
| 5 | JGI25153J46596_10000013 | 3300003215 | Bacteria | 303690 |
| 6 | rootH2_10008473 | 3300003320 | Bacteria | 47100 |
| 7 | rootH1_10177322 | 3300003323 | Bacteria | 2546 |
| 8 | Ga0055526_1000012 | 3300003771 | Bacteria | 234368 |
| 9 | Ga0055537_1000021 | 3300003773 | Bacteria | 116840 |
| 10 | Ga0055524_1000037 | 3300003775 | Bacteria | 167140 |
| 11 | Ga0055524_1004257 | 3300003775 | Bacteria | 6654 |
| 12 | Ga0055524_1011793 | 3300003775 | Bacteria | 3391 |
| 13 | Ga0055536_1000969 | 3300003781 | Bacteria | 18299 |
| 14 | Ga0055536_1003449 | 3300003781 | Bacteria | 8480 |
| 15 | Ga0055536_1003766 | 3300003781 | Bacteria | 8005 |
| 16 | Ga0055536_1024843 | 3300003781 | Bacteria | 1724 |
| 17 | Ga0055536_1030369 | 3300003781 | Bacteria | 1434 |
| 18 | Ga0055534_1000006 | 3300003784 | Bacteria | 234368 |
| 19 | Ga0055528_1000006 | 3300003790 | Bacteria | 234368 |
| 20 | Ga0055530_10001711 | 3300003791 | Bacteria | 15481 |
| 21 | Ga0055531_10011479 | 3300003794 | Bacteria | 4264 |
| 22 | Ga0055531_10012203 | 3300003794 | Bacteria | 4061 |
| 23 | Ga0055531_10012942 | 3300003794 | Bacteria | 3885 |
| 24 | Ga0058692_1000004 | 3300003856 | Bacteria | 431119 |
| 25 | Ga0058692_1000021 | 3300003856 | Bacteria | 240308 |
| 26 | Ga0065704_10001454 | 3300005289 | Bacteria | 9120 |
| 27 | Ga0070670_100003317 | 3300005331 | Bacteria | 13319 |
| 28 | Ga0070668_100003880 | 3300005347 | Bacteria | 11040 |
| 29 | Ga0070669_100002554 | 3300005353 | Bacteria | 13159 |
| 30 | Ga0070669_100172153 | 3300005353 | Bacteria | 1689 |
| 31 | Ga0070678_100008989 | 3300005456 | Bacteria | 6018 |
| 32 | Ga0068853_100162066 | 3300005539 | Bacteria | 2019 |
| 33 | Ga0070672_100016364 | 3300005543 | Bacteria | 5309 |
| 34 | Ga0070693_100007886 | 3300005547 | Bacteria | 5223 |
| 35 | Ga0068852_100006053 | 3300005616 | Bacteria | 8715 |
| 36 | Ga0068852_100336725 | 3300005616 | Bacteria | 1470 |
| 37 | Ga0075364_10000986 | 3300006051 | Bacteria | 15062 |
| 38 | Ga0075364_10086068 | 3300006051 | Bacteria | 2082 |
| 39 | Ga0075369_10018524 | 3300006186 | Bacteria | 2836 |
| 40 | Ga0105251_10000014 | 3300009011 | Bacteria | 150347 |
| 41 | Ga0105244_10059361 | 3300009036 | Bacteria | 1928 |
| 42 | Ga0105243_10000468 | 3300009148 | Bacteria | 41748 |
| 43 | Ga0105243_10281193 | 3300009148 | Bacteria | 1499 |
| 44 | Ga0157316_1002304 | 3300012510 | Bacteria | 1285 |
| 45 | Ga0157327_1002346 | 3300012512 | Bacteria | 1296 |
| 46 | Ga0157371_10028696 | 3300013102 | Bacteria | 4028 |
| 47 | Ga0157370_10150401 | 3300013104 | Bacteria | 2166 |
| 48 | Ga0157378_10175944 | 3300013297 | Bacteria | 2010 |
| 49 | Ga0157375_10179038 | 3300013308 | Bacteria | 2271 |
| 50 | Ga0182006_1013787 | 3300015261 | Bacteria | 3497 |
| 51 | Ga0182007_10000019 | 3300015262 | Bacteria | 194770 |
| 52 | Ga0182005_1001066 | 3300015265 | Bacteria | 11581 |
| 53 | Ga0183360_10002 | 3300015689 | Bacteria | 953821 |
| 54 | Ga0163161_10173781 | 3300017792 | Bacteria | 1648 |
| 55 | Ga0207425_1000015 | 3300025245 | Bacteria | 466368 |
| 56 | Ga0207425_1013786 | 3300025245 | Bacteria | 1854 |
| 57 | Ga0209129_1000074 | 3300025258 | Bacteria | 205648 |
| 58 | Ga0209565_1000002 | 3300025263 | Bacteria | 1423083 |
| 59 | Ga0209673_1000002 | 3300025273 | Bacteria | 1423083 |
| 60 | Ga0209673_1012392 | 3300025273 | Bacteria | 3436 |
| 61 | Ga0209130_1013623 | 3300025284 | Bacteria | 2075 |
| 62 | Ga0209675_1000002 | 3300025291 | Bacteria | 1423083 |
| 63 | Ga0209675_1027857 | 3300025291 | Bacteria | 1382 |
| 64 | Ga0209676_1000063 | 3300025292 | Bacteria | 322025 |
| 65 | Ga0209676_1000190 | 3300025292 | Bacteria | 140482 |
| 66 | Ga0209676_1001538 | 3300025292 | Bacteria | 20871 |
| 67 | Ga0209676_1001649 | 3300025292 | Bacteria | 19565 |
| 68 | Ga0209676_1005794 | 3300025292 | Bacteria | 6316 |
| 69 | Ga0209676_1010043 | 3300025292 | Bacteria | 3997 |
| 70 | Ga0209676_1010288 | 3300025292 | Bacteria | 3921 |
| 71 | Ga0209676_1012126 | 3300025292 | Bacteria | 3416 |
| 72 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 73 | Ga0209025_1000021 | 3300025294 | Bacteria | 593083 |
| 74 | Ga0209025_1001187 | 3300025294 | Bacteria | 36871 |
| 75 | Ga0209025_1003252 | 3300025294 | Bacteria | 15655 |
| 76 | Ga0209025_1029970 | 3300025294 | Bacteria | 2616 |
| 77 | Ga0209564_1000004 | 3300025295 | Bacteria | 1424639 |
| 78 | Ga0209564_1020123 | 3300025295 | Bacteria | 2461 |
| 79 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 80 | Ga0209758_1023639 | 3300025297 | Bacteria | 2771 |
| 81 | Ga0209050_1005163 | 3300025298 | Bacteria | 8363 |
| 82 | Ga0209050_1010346 | 3300025298 | Bacteria | 4608 |
| 83 | Ga0209256_1000004 | 3300025299 | Bacteria | 1424643 |
| 84 | Ga0209256_1004958 | 3300025299 | Bacteria | 7977 |
| 85 | Ga0209256_1007232 | 3300025299 | Bacteria | 5550 |
| 86 | Ga0209256_1007491 | 3300025299 | Bacteria | 5363 |
| 87 | Ga0209051_1007829 | 3300025303 | Bacteria | 5766 |
| 88 | Ga0209257_1000136 | 3300025304 | Bacteria | 204863 |
| 89 | Ga0209257_1000353 | 3300025304 | Bacteria | 94267 |
| 90 | Ga0209257_1007451 | 3300025304 | Bacteria | 6601 |
| 91 | Ga0209257_1010752 | 3300025304 | Bacteria | 4556 |
| 92 | Ga0209257_1012901 | 3300025304 | Bacteria | 3785 |
| 93 | Ga0209257_1013731 | 3300025304 | Bacteria | 3560 |
| 94 | Ga0209257_1060968 | 3300025304 | Bacteria | 1025 |
| 95 | Ga0207713_1000290 | 3300025735 | Bacteria | 58238 |
| 96 | Ga0207657_10007003 | 3300025919 | Bacteria | 11605 |
| 97 | Ga0207652_10224015 | 3300025921 | Bacteria | 1694 |
| 98 | Ga0207681_10003744 | 3300025923 | Bacteria | 9452 |
| 99 | Ga0207650_10013939 | 3300025925 | Bacteria | 5577 |
| 100 | Ga0207659_10442211 | 3300025926 | Bacteria | 1094 |
| 101 | Ga0207644_10130312 | 3300025931 | Bacteria | 1924 |
| 102 | Ga0207709_10004409 | 3300025935 | Bacteria | 8147 |
| 103 | Ga0207709_10008282 | 3300025935 | Bacteria | 5758 |
| 104 | Ga0207709_10202864 | 3300025935 | Bacteria | 1418 |
| 105 | Ga0207691_10000278 | 3300025940 | Bacteria | 50663 |
| 106 | Ga0207668_10003870 | 3300025972 | Bacteria | 8823 |
| 107 | Ga0207668_10009035 | 3300025972 | Bacteria | 5955 |
| 108 | Ga0207639_10195328 | 3300026041 | Bacteria | 1731 |
| 109 | Ga0207675_100144515 | 3300026118 | Bacteria | 2261 |
| 110 | Ga0207683_10031339 | 3300026121 | Bacteria | 4613 |
| 111 | Ga0207698_10000335 | 3300026142 | Bacteria | 27930 |
| 112 | Ga0209371_1000018 | 3300027312 | Bacteria | 614700 |
| 113 | Ga0209371_1000045 | 3300027312 | Bacteria | 316174 |
| 114 | Ga0209983_1002329 | 3300027665 | Bacteria | 4165 |
| 115 | Ga0307515_10158430 | 3300028794 | Bacteria | 2323 |
| 116 | Ga0268256_1000016 | 3300030500 | Bacteria | 614700 |
| 117 | Ga0268256_1000047 | 3300030500 | Bacteria | 316174 |
| 118 | Ga0316177_1077278 | 3300030731 | Bacteria | 2772 |
| 119 | Ga0316177_1192212 | 3300030731 | Bacteria | 1282 |
| 120 | Ga0316178_1104881 | 3300030735 | Bacteria | 2150 |
| 121 | Ga0265327_10002376 | 3300031251 | Bacteria | 20027 |
| 122 | Ga0265327_10007933 | 3300031251 | Bacteria | 8040 |
| 123 | Ga0307513_10000914 | 3300031456 | Bacteria | 42646 |
| 124 | Ga0307513_10068688 | 3300031456 | Bacteria | 3711 |
| 125 | Ga0307405_10135234 | 3300031731 | Bacteria | 1710 |
| 126 | Ga0307405_10154841 | 3300031731 | Bacteria | 1616 |
| 127 | Ga0307413_10000128 | 3300031824 | Bacteria | 19807 |
| 128 | Ga0307406_10001011 | 3300031901 | Bacteria | 15636 |
| 129 | Ga0307406_10007520 | 3300031901 | Bacteria | 6046 |
| 130 | Ga0307406_10114851 | 3300031901 | Bacteria | 1860 |
| 131 | Ga0307406_10165011 | 3300031901 | Bacteria | 1597 |
| 132 | Ga0307412_10063634 | 3300031911 | Bacteria | 2489 |
| 133 | Ga0307412_10211109 | 3300031911 | Bacteria | 1481 |
| 134 | Ga0307416_100149885 | 3300032002 | Bacteria | 2137 |
| 135 | Ga0307416_100259880 | 3300032002 | Bacteria | 1696 |
| 136 | Ga0307416_100531143 | 3300032002 | Bacteria | 1246 |
| 137 | Ga0307414_10008312 | 3300032004 | Bacteria | 5878 |
| 138 | Ga0307414_10062522 | 3300032004 | Bacteria | 2642 |
| 139 | Ga0307414_10064753 | 3300032004 | Bacteria | 2604 |
| 140 | Ga0307414_10095454 | 3300032004 | Bacteria | 2222 |
| 141 | Ga0307414_10129595 | 3300032004 | Bacteria | 1956 |
| 142 | Ga0307414_10140456 | 3300032004 | Bacteria | 1890 |
| 143 | Ga0307414_10307329 | 3300032004 | Bacteria | 1344 |
| 144 | Ga0307411_10170413 | 3300032005 | Bacteria | 1641 |
| 145 | Ga0307411_10314401 | 3300032005 | Bacteria | 1262 |
| 146 | Ga0316585_10037174 | 3300032137 | Bacteria | 1545 |
| 147 | Ga0316584_0016514 | 3300036712 | Bacteria | 5291 |
| 148 | Ga0395899_0159016 | 3300037312 | Bacteria | 1597 |
| 149 | Ga0395900_0010500 | 3300037418 | Bacteria | 9473 |
| 150 | Ga0395905_0005032 | 3300037471 | Bacteria | 13614 |
| 151 | Ga0395905_0005621 | 3300037471 | Bacteria | 12761 |
| 152 | Ga0395901_0019281 | 3300038443 | Bacteria | 6973 |
| 153 | Ga0439436_0005590 | 3300041404 | Bacteria | 3855 |
| 154 | Ga0439447_001202 | 3300041407 | Bacteria | 9433 |
| 155 | Ga0439465_0001148 | 3300041413 | Bacteria | 8491 |
| 156 | Ga0451791_0145432 | 3300041451 | Bacteria | 2614 |
| 157 | Ga0451800_0601609 | 3300041459 | Bacteria | 1306 |
| 158 | Ga0451806_513008 | 3300041462 | Bacteria | 1447 |
| 159 | Ga0451807_0231291 | 3300041486 | Bacteria | 3439 |
| 160 | Ga0451837_0924985 | 3300041494 | Bacteria | 3014 |
| 161 | Ga0451837_1344659 | 3300041494 | Bacteria | 1313 |
| 162 | Ga0451843_1375814 | 3300041509 | Bacteria | 2869 |
| 163 | Ga0439431_0028531 | 3300041997 | Bacteria | 1375 |
| 164 | Ga0439445_0010697 | 3300042004 | Bacteria | 2177 |
| 165 | Ga0439445_0020406 | 3300042004 | Bacteria | 1658 |
| 166 | Ga0439432_009801 | 3300042006 | Bacteria | 3332 |
| 167 | Ga0439449_0000107 | 3300042007 | Bacteria | 27003 |
| 168 | Ga0439449_0004994 | 3300042007 | Bacteria | 5102 |
| 169 | Ga0439449_0049825 | 3300042007 | Bacteria | 1549 |
| 170 | Ga0439449_0074786 | 3300042007 | Bacteria | 1248 |
| 171 | Ga0439462_0013278 | 3300042015 | Bacteria | 2110 |
| 172 | Ga0439435_0028899 | 3300042436 | Bacteria | 1494 |
| 173 | Ga0451577_0000071 | 3300042876 | Bacteria | 238560 |
| 174 | Ga0451577_0001460 | 3300042876 | Bacteria | 31395 |
| 175 | Ga0453684_0000583 | 3300044712 | Bacteria | 135940 |
| 176 | Ga0453684_0002216 | 3300044712 | Bacteria | 48307 |
| 177 | Ga0453684_0096678 | 3300044712 | Bacteria | 3627 |
| 178 | Ga0451576_0000137 | 3300045051 | Bacteria | 185212 |
| 179 | Ga0466967_0411097 | 3300045976 | Bacteria | 1318 |
| 180 | Ga0495627_020065 | 3300046453 | Bacteria | 2232 |
| 181 | Ga0495638_0000385 | 3300046460 | Bacteria | 54566 |
| 182 | Ga0495663_0000099 | 3300046525 | Bacteria | 35313 |
| 183 | Ga0495663_0002056 | 3300046525 | Bacteria | 6163 |
| 184 | Ga0495663_0008084 | 3300046525 | Bacteria | 2910 |
| 185 | Ga0495663_0032745 | 3300046525 | Bacteria | 1549 |
| 186 | Ga0495663_0049780 | 3300046525 | Bacteria | 1295 |
| 187 | Ga0495598_0009333 | 3300046537 | Bacteria | 2316 |
| 188 | Ga0495598_0011221 | 3300046537 | Bacteria | 2166 |
| 189 | Ga0495621_0017166 | 3300046539 | Bacteria | 2335 |
| 190 | Ga0495633_0021220 | 3300046558 | Bacteria | 3251 |
| 191 | Ga0495633_0045146 | 3300046558 | Bacteria | 2087 |
| 192 | Ga0495656_0000374 | 3300046615 | Bacteria | 14977 |
| 193 | Ga0495656_0011661 | 3300046615 | Bacteria | 3228 |
| 194 | Ga0495668_0037170 | 3300046616 | Bacteria | 2725 |
| 195 | Ga0495636_0000634 | 3300047318 | Bacteria | 12891 |
| 196 | Ga0495636_0018105 | 3300047318 | Bacteria | 2825 |
| 197 | Ga0495636_0040494 | 3300047318 | Bacteria | 1931 |
| 198 | Ga0495686_0024787 | 3300047472 | Bacteria | 3936 |
| 199 | Ga0495615_0015735 | 3300048090 | Bacteria | 1621 |
| 200 | Ga0496100_0117459 | 3300048903 | Bacteria | 1857 |
| 201 | Ga0496104_0155811 | 3300048907 | Bacteria | 2192 |
| 202 | Ga0496108_0065907 | 3300048911 | Bacteria | 3053 |
| 203 | Ga0496108_0080585 | 3300048911 | Bacteria | 2758 |
| 204 | Ga0496109_0012776 | 3300048912 | Bacteria | 7259 |
| 205 | Ga0496109_0026463 | 3300048912 | Bacteria | 5174 |
| 206 | Ga0496111_0213463 | 3300048914 | Bacteria | 1433 |
| 207 | Ga0496112_0098069 | 3300048915 | Bacteria | 2900 |
| 208 | Ga0496113_0137375 | 3300048916 | Bacteria | 1921 |
| 209 | Ga0496114_0005729 | 3300048917 | Bacteria | 9749 |
| 210 | Ga0496114_0206406 | 3300048917 | Bacteria | 1722 |
| 211 | Ga0496116_0001837 | 3300048919 | Bacteria | 22940 |
| 212 | Ga0496116_0002674 | 3300048919 | Bacteria | 18434 |
| 213 | Ga0496117_0001115 | 3300048920 | Bacteria | 40491 |
| 214 | Ga0496117_0001559 | 3300048920 | Bacteria | 32542 |
| 215 | Ga0496118_0000108 | 3300048921 | Bacteria | 153902 |
| 216 | Ga0496118_0137327 | 3300048921 | Bacteria | 1557 |
| 217 | Ga0496119_0000338 | 3300048922 | Bacteria | 65446 |
| 218 | Ga0496119_0001199 | 3300048922 | Bacteria | 32413 |
| 219 | Ga0496120_0000707 | 3300048923 | Bacteria | 48949 |
| 220 | Ga0496120_0000786 | 3300048923 | Bacteria | 45817 |
| 221 | Ga0496121_0001076 | 3300048924 | Bacteria | 48261 |
| 222 | Ga0496121_0006948 | 3300048924 | Bacteria | 13783 |
| 223 | Ga0496121_0073457 | 3300048924 | Bacteria | 2741 |
| 224 | Ga0496122_0000081 | 3300048925 | Bacteria | 211119 |
| 225 | Ga0496122_0003920 | 3300048925 | Bacteria | 19034 |
| 226 | Ga0496122_0040390 | 3300048925 | Bacteria | 3708 |
| 227 | Ga0496122_0081893 | 3300048925 | Bacteria | 2244 |
| 228 | Ga0496123_0000311 | 3300048926 | Bacteria | 93694 |
| 229 | Ga0496123_0000665 | 3300048926 | Bacteria | 56849 |
| 230 | Ga0496123_0001059 | 3300048926 | Bacteria | 41631 |
| 231 | Ga0496123_0047566 | 3300048926 | Bacteria | 2896 |
| 232 | Ga0496123_0084067 | 3300048926 | Bacteria | 1921 |
| 233 | Ga0496124_0000020 | 3300048927 | Bacteria | 434107 |
| 234 | Ga0496124_0001667 | 3300048927 | Bacteria | 31600 |
| 235 | Ga0496124_0002097 | 3300048927 | Bacteria | 26919 |
| 236 | Ga0496124_0015601 | 3300048927 | Bacteria | 7271 |
| 237 | Ga0496124_0021704 | 3300048927 | Bacteria | 5911 |
| 238 | Ga0496124_0150740 | 3300048927 | Bacteria | 1824 |
| 239 | Ga0496125_0003018 | 3300048928 | Bacteria | 21053 |
| 240 | Ga0496125_0104002 | 3300048928 | Bacteria | 2081 |
| 241 | Ga0496126_0000532 | 3300048929 | Bacteria | 73699 |
| 242 | Ga0501031_0003783 | 3300049568 | Bacteria | 9739 |
| 243 | Ga0501031_0017897 | 3300049568 | Bacteria | 4609 |
| 244 | Ga0501031_0036828 | 3300049568 | Bacteria | 3192 |
| 245 | Ga0501032_0063936 | 3300049569 | Bacteria | 2463 |
| 246 | Ga0501033_0000917 | 3300049570 | Bacteria | 26939 |
| 247 | Ga0501033_0164103 | 3300049570 | Bacteria | 1598 |
| 248 | Ga0501034_0000404 | 3300049571 | Bacteria | 72780 |
| 249 | Ga0501034_0000632 | 3300049571 | Bacteria | 54605 |
| 250 | Ga0501036_0033466 | 3300049572 | Bacteria | 4347 |
| 251 | Ga0501037_0017276 | 3300049573 | Bacteria | 5312 |
| 252 | Ga0501039_0119997 | 3300049575 | Bacteria | 2060 |
| 253 | Ga0501043_0000916 | 3300049579 | Bacteria | 26114 |
| 254 | Ga0501043_0015093 | 3300049579 | Bacteria | 6046 |
| 255 | Ga0501068_0057570 | 3300049584 | Bacteria | 2357 |
| 256 | Ga0501070_0091932 | 3300049586 | Bacteria | 2511 |
| 257 | Ga0501071_0287727 | 3300049587 | Bacteria | 1244 |
| 258 | Ga0501073_0020216 | 3300049589 | Bacteria | 4802 |
| 259 | Ga0501202_011706 | 3300049652 | Bacteria | 1647 |
| 260 | Ga0501250_012851 | 3300049680 | Bacteria | 996 |
| 261 | Ga0501252_002997 | 3300049682 | Bacteria | 1715 |
| 262 | Ga0501257_021778 | 3300049686 | Bacteria | 1514 |
| 263 | Ga0501080_0146413 | 3300049742 | Bacteria | 2183 |
| 264 | Ga0501265_000056 | 3300049762 | Bacteria | 8911 |
| 265 | Ga0501266_004220 | 3300049763 | Bacteria | 1779 |
| 266 | Ga0501275_000739 | 3300049772 | Bacteria | 3571 |
| 267 | Ga0501276_004166 | 3300049773 | Bacteria | 1077 |
| 268 | Ga0501035_0054264 | 3300049822 | Bacteria | 3581 |
| 269 | Ga0501044_0009987 | 3300049823 | Bacteria | 10312 |
| 270 | Ga0501044_0167882 | 3300049823 | Bacteria | 2167 |
| 271 | nmdc:mga00v17_184_c1 | 3300050491 | Bacteria | 37430 |
| 272 | nmdc:mga00v17_43030_c1 | 3300050491 | Bacteria | 2719 |
| 273 | Ga0500634_0000195 | 3300053161 | Bacteria | 19694 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300012510 | Ga0157316_1002304 | Ga0157316_10023041 | 273 |
| 2 | 3300009148 | Ga0105243_10281193 | Ga0105243_102811932 | 281 |
| 3 | 3300013308 | Ga0157375_10179038 | Ga0157375_101790383 | 281 |
| 4 | 3300044712 | Ga0453684_0000583 | Ga0453684_0000583_5656_6501 | 281 |
| 5 | 3300045051 | Ga0451576_0000137 | Ga0451576_0000137_129440_130285 | 281 |
| 6 | 3300046537 | Ga0495598_0009333 | Ga0495598_0009333_858_1703 | 281 |
| 7 | 3300046539 | Ga0495621_0017166 | Ga0495621_0017166_354_1199 | 281 |
| 8 | iso_pu_bacteria | 2989392574 | 2989392698 | 281 |
| 9 | iso_pu_bacteria | 2894510363 | 2894514237 | 283 |
| 10 | 3300013102 | Ga0157371_10028696 | Ga0157371_100286963 | 284 |
| 11 | 3300032004 | Ga0307414_10064753 | Ga0307414_100647532 | 284 |
| 12 | 3300041451 | Ga0451791_0145432 | Ga0451791_0145432_33_887 | 284 |
| 13 | 3300003781 | Ga0055536_1000969 | Ga0055536_10009695 | 285 |
| 14 | 3300003781 | Ga0055536_1003449 | Ga0055536_100344910 | 285 |
| 15 | 3300025292 | Ga0209676_1000063 | Ga0209676_10000636 | 285 |
| 16 | 3300028794 | Ga0307515_10158430 | Ga0307515_101584302 | 286 |
| 17 | 3300031456 | Ga0307513_10000914 | Ga0307513_1000091424 | 286 |
| 18 | 3300031456 | Ga0307513_10068688 | Ga0307513_100686885 | 286 |
| 19 | 3300042876 | Ga0451577_0000071 | Ga0451577_0000071_158684_159544 | 286 |
| 20 | 3300044712 | Ga0453684_0002216 | Ga0453684_0002216_2456_3316 | 286 |
| 21 | 3300044712 | Ga0453684_0096678 | Ga0453684_0096678_492_1352 | 286 |
| 22 | 3300046525 | Ga0495663_0002056 | Ga0495663_0002056_395_1294 | 286 |
| 23 | 3300049571 | Ga0501034_0000404 | Ga0501034_0000404_9366_10271 | 286 |
| 24 | 3300046525 | Ga0495663_0000099 | Ga0495663_0000099_26538_27431 | 287 |
| 25 | 3300047472 | Ga0495686_0024787 | Ga0495686_0024787_2180_3094 | 287 |
| 26 | 3300048917 | Ga0496114_0005729 | Ga0496114_0005729_3443_4402 | 287 |
| 27 | 3300048920 | Ga0496117_0001115 | Ga0496117_0001115_13642_14535 | 287 |
| 28 | 3300048921 | Ga0496118_0000108 | Ga0496118_0000108_128187_129080 | 287 |
| 29 | 3300048925 | Ga0496122_0003920 | Ga0496122_0003920_1208_2101 | 287 |
| 30 | 3300048926 | Ga0496123_0001059 | Ga0496123_0001059_36323_37216 | 287 |
| 31 | 3300048927 | Ga0496124_0002097 | Ga0496124_0002097_25688_26581 | 287 |
| 32 | 3300032137 | Ga0316585_10037174 | Ga0316585_100371742 | 288 |
| 33 | 3300036712 | Ga0316584_0016514 | Ga0316584_0016514_3567_4433 | 288 |
| 34 | 3300048090 | Ga0495615_0015735 | Ga0495615_0015735_17_883 | 288 |
| 35 | 3300003794 | Ga0055531_10011479 | Ga0055531_100114793 | 289 |
| 36 | 3300025304 | Ga0209257_1000136 | Ga0209257_1000136109 | 289 |
| 37 | 3300049762 | Ga0501265_000056 | Ga0501265_000056_3230_4129 | 289 |
| 38 | 3300049772 | Ga0501275_000739 | Ga0501275_000739_274_1173 | 289 |
| 39 | 3300049773 | Ga0501276_004166 | Ga0501276_004166_158_1057 | 289 |
| 40 | 3300042876 | Ga0451577_0001460 | Ga0451577_0001460_19707_20606 | 290 |
| 41 | 3300048927 | Ga0496124_0000020 | Ga0496124_0000020_361036_361962 | 290 |
| 42 | 3300049568 | Ga0501031_0003783 | Ga0501031_0003783_6773_7696 | 290 |
| 43 | 3300049568 | Ga0501031_0036828 | Ga0501031_0036828_1273_2199 | 290 |
| 44 | 3300049575 | Ga0501039_0119997 | Ga0501039_0119997_886_1812 | 290 |
| 45 | 3300049822 | Ga0501035_0054264 | Ga0501035_0054264_1579_2505 | 290 |
| 46 | 3300049823 | Ga0501044_0167882 | Ga0501044_0167882_1020_1946 | 290 |
| 47 | iso_pu_bacteria | 2547132130 | 2547500262 | 290 |
| 48 | iso_pu_bacteria | 2576861471 | 2578456568 | 290 |
| 49 | iso_pu_bacteria | 2747842428 | 2747947377 | 290 |
| 50 | iso_pu_bacteria | 2765235840 | 2765580932 | 290 |
| 51 | iso_pu_bacteria | 2816332141 | 2816518071 | 290 |
| 52 | iso_pu_bacteria | 2842391507 | 2842394543 | 290 |
| 53 | iso_pu_bacteria | 2852649853 | 2852651798 | 290 |
| 54 | iso_pu_bacteria | 2874220319 | 2874223594 | 290 |
| 55 | iso_pu_bacteria | 2919089067 | 2919089149 | 290 |
| 56 | iso_pu_bacteria | 2919134579 | 2919136612 | 290 |
| 57 | iso_pu_bacteria | 2928496128 | 2928497018 | 290 |
| 58 | iso_pu_bacteria | 2931380184 | 2931383000 | 290 |
| 59 | iso_pu_bacteria | 2937610967 | 2937613925 | 290 |
| 60 | iso_pu_bacteria | 2939589442 | 2939590188 | 290 |
| 61 | iso_pu_bacteria | 2939622612 | 2939623812 | 290 |
| 62 | iso_pu_bacteria | 2939626828 | 2939628638 | 290 |
| 63 | iso_pu_bacteria | 2941475908 | 2941479520 | 290 |
| 64 | iso_pu_bacteria | 2961047084 | 2961050358 | 290 |
| 65 | iso_pu_bacteria | 2961064222 | 2961064508 | 290 |
| 66 | iso_pu_bacteria | 2974307012 | 2974307207 | 290 |
| 67 | iso_pu_bacteria | 2977247770 | 2977247949 | 290 |
| 68 | iso_pu_bacteria | 2984514374 | 2984517592 | 290 |
| 69 | 3300025294 | Ga0209025_1029970 | Ga0209025_10299703 | 291 |
| 70 | 3300041486 | Ga0451807_0231291 | Ga0451807_0231291_1313_2236 | 291 |
| 71 | 3300042007 | Ga0439449_0074786 | Ga0439449_0074786_20_943 | 291 |
| 72 | 3300042436 | Ga0439435_0028899 | Ga0439435_0028899_353_1276 | 291 |
| 73 | iso_pu_bacteria | 2842780639 | 2842784194 | 291 |
| 74 | iso_pu_bacteria | 2987605356 | 2987605546 | 291 |
| 75 | 3300003781 | Ga0055536_1024843 | Ga0055536_10248432 | 292 |
| 76 | 3300003856 | Ga0058692_1000004 | Ga0058692_1000004220 | 292 |
| 77 | 3300005353 | Ga0070669_100172153 | Ga0070669_1001721533 | 292 |
| 78 | 3300005543 | Ga0070672_100016364 | Ga0070672_1000163642 | 292 |
| 79 | 3300006051 | Ga0075364_10000986 | Ga0075364_1000098610 | 292 |
| 80 | 3300025291 | Ga0209675_1027857 | Ga0209675_10278571 | 292 |
| 81 | 3300025292 | Ga0209676_1001649 | Ga0209676_10016498 | 292 |
| 82 | 3300025940 | Ga0207691_10000278 | Ga0207691_100002783 | 292 |
| 83 | 3300026118 | Ga0207675_100144515 | Ga0207675_1001445152 | 292 |
| 84 | 3300027312 | Ga0209371_1000018 | Ga0209371_1000018176 | 292 |
| 85 | 3300030500 | Ga0268256_1000016 | Ga0268256_1000016176 | 292 |
| 86 | 3300046525 | Ga0495663_0049780 | Ga0495663_0049780_17_928 | 292 |
| 87 | 3300046615 | Ga0495656_0000374 | Ga0495656_0000374_6341_7252 | 292 |
| 88 | 3300048917 | Ga0496114_0206406 | Ga0496114_0206406_286_1197 | 292 |
| 89 | 3300049570 | Ga0501033_0000917 | Ga0501033_0000917_10919_11842 | 292 |
| 90 | 3300050491 | nmdc:mga00v17_184_c1 | nmdc:mga00v17_184_c1_9838_10749 | 292 |
| 91 | 3300005547 | Ga0070693_100007886 | Ga0070693_1000078865 | 293 |
| 92 | 3300013297 | Ga0157378_10175944 | Ga0157378_101759442 | 293 |
| 93 | 3300031251 | Ga0265327_10007933 | Ga0265327_100079338 | 293 |
| 94 | 3300032005 | Ga0307411_10314401 | Ga0307411_103144011 | 293 |
| 95 | iso_pu_bacteria | 2643221579 | 2643909057 | 293 |
| 96 | iso_pu_bacteria | 2643221581 | 2643914400 | 293 |
| 97 | iso_pu_bacteria | 2747842501 | 2748017313 | 293 |
| 98 | 3300003320 | rootH2_10008473 | rootH2_100084739 | 294 |
| 99 | 3300003781 | Ga0055536_1003766 | Ga0055536_10037663 | 294 |
| 100 | 3300005456 | Ga0070678_100008989 | Ga0070678_10000898910 | 294 |
| 101 | 3300005539 | Ga0068853_100162066 | Ga0068853_1001620662 | 294 |
| 102 | 3300005616 | Ga0068852_100336725 | Ga0068852_1003367252 | 294 |
| 103 | 3300006186 | Ga0075369_10018524 | Ga0075369_100185243 | 294 |
| 104 | 3300009036 | Ga0105244_10059361 | Ga0105244_100593613 | 294 |
| 105 | 3300012512 | Ga0157327_1002346 | Ga0157327_10023462 | 294 |
| 106 | 3300013104 | Ga0157370_10150401 | Ga0157370_101504012 | 294 |
| 107 | 3300015262 | Ga0182007_10000019 | Ga0182007_10000019159 | 294 |
| 108 | 3300015265 | Ga0182005_1001066 | Ga0182005_10010663 | 294 |
| 109 | 3300017792 | Ga0163161_10173781 | Ga0163161_101737812 | 294 |
| 110 | 3300025292 | Ga0209676_1000190 | Ga0209676_10001903 | 294 |
| 111 | 3300025304 | Ga0209257_1060968 | Ga0209257_10609681 | 294 |
| 112 | 3300025935 | Ga0207709_10008282 | Ga0207709_100082822 | 294 |
| 113 | 3300025935 | Ga0207709_10202864 | Ga0207709_102028642 | 294 |
| 114 | 3300025972 | Ga0207668_10003870 | Ga0207668_100038702 | 294 |
| 115 | 3300026121 | Ga0207683_10031339 | Ga0207683_100313394 | 294 |
| 116 | 3300031731 | Ga0307405_10135234 | Ga0307405_101352342 | 294 |
| 117 | 3300031731 | Ga0307405_10154841 | Ga0307405_101548412 | 294 |
| 118 | 3300031911 | Ga0307412_10063634 | Ga0307412_100636342 | 294 |
| 119 | 3300032002 | Ga0307416_100149885 | Ga0307416_1001498852 | 294 |
| 120 | 3300032004 | Ga0307414_10095454 | Ga0307414_100954542 | 294 |
| 121 | 3300032004 | Ga0307414_10129595 | Ga0307414_101295951 | 294 |
| 122 | 3300042006 | Ga0439432_009801 | Ga0439432_009801_2380_3288 | 294 |
| 123 | 3300046453 | Ga0495627_020065 | Ga0495627_020065_135_1073 | 294 |
| 124 | 3300046460 | Ga0495638_0000385 | Ga0495638_0000385_27866_28759 | 294 |
| 125 | 3300046525 | Ga0495663_0008084 | Ga0495663_0008084_635_1528 | 294 |
| 126 | 3300046525 | Ga0495663_0032745 | Ga0495663_0032745_29_943 | 294 |
| 127 | 3300046558 | Ga0495633_0021220 | Ga0495633_0021220_1880_2773 | 294 |
| 128 | 3300046558 | Ga0495633_0045146 | Ga0495633_0045146_843_1781 | 294 |
| 129 | 3300047318 | Ga0495636_0000634 | Ga0495636_0000634_8520_9434 | 294 |
| 130 | 3300047318 | Ga0495636_0040494 | Ga0495636_0040494_283_1197 | 294 |
| 131 | 3300048907 | Ga0496104_0155811 | Ga0496104_0155811_623_1516 | 294 |
| 132 | 3300048911 | Ga0496108_0065907 | Ga0496108_0065907_1486_2397 | 294 |
| 133 | 3300048912 | Ga0496109_0012776 | Ga0496109_0012776_3474_4385 | 294 |
| 134 | 3300048919 | Ga0496116_0001837 | Ga0496116_0001837_8868_9761 | 294 |
| 135 | 3300048919 | Ga0496116_0002674 | Ga0496116_0002674_16193_17239 | 294 |
| 136 | 3300048922 | Ga0496119_0000338 | Ga0496119_0000338_62198_63091 | 294 |
| 137 | 3300048923 | Ga0496120_0000707 | Ga0496120_0000707_10019_10912 | 294 |
| 138 | 3300048924 | Ga0496121_0006948 | Ga0496121_0006948_229_1122 | 294 |
| 139 | 3300048924 | Ga0496121_0073457 | Ga0496121_0073457_633_1526 | 294 |
| 140 | 3300048925 | Ga0496122_0040390 | Ga0496122_0040390_1964_2857 | 294 |
| 141 | 3300048925 | Ga0496122_0081893 | Ga0496122_0081893_714_1607 | 294 |
| 142 | 3300048926 | Ga0496123_0047566 | Ga0496123_0047566_668_1561 | 294 |
| 143 | 3300048926 | Ga0496123_0084067 | Ga0496123_0084067_481_1374 | 294 |
| 144 | 3300048927 | Ga0496124_0015601 | Ga0496124_0015601_4627_5520 | 294 |
| 145 | 3300048927 | Ga0496124_0021704 | Ga0496124_0021704_3511_4404 | 294 |
| 146 | 3300048927 | Ga0496124_0150740 | Ga0496124_0150740_225_1118 | 294 |
| 147 | 3300048928 | Ga0496125_0003018 | Ga0496125_0003018_807_1700 | 294 |
| 148 | 3300048928 | Ga0496125_0104002 | Ga0496125_0104002_768_1661 | 294 |
| 149 | 3300048929 | Ga0496126_0000532 | Ga0496126_0000532_62762_63655 | 294 |
| 150 | 3300049652 | Ga0501202_011706 | Ga0501202_011706_590_1564 | 294 |
| 151 | 3300053161 | Ga0500634_0000195 | Ga0500634_0000195_6282_7220 | 294 |
| 152 | iso_pu_bacteria | 2852684882 | 2852689230 | 294 |
| 153 | iso_pu_bacteria | 2894414249 | 2894414877 | 294 |
| 154 | iso_pu_bacteria | 2929195423 | 2929195887 | 294 |
| 155 | iso_pu_bacteria | 8021622325 | 8021623189 | 294 |
| 156 | iso_pu_bacteria | 8021626552 | 8021629759 | 294 |
| 157 | iso_pu_bacteria | 8021648035 | 8021649013 | 294 |
| 158 | 3300025919 | Ga0207657_10007003 | Ga0207657_100070038 | 295 |
| 159 | 3300025921 | Ga0207652_10224015 | Ga0207652_102240153 | 295 |
| 160 | 3300026041 | Ga0207639_10195328 | Ga0207639_101953283 | 295 |
| 161 | 3300032004 | Ga0307414_10307329 | Ga0307414_103073292 | 295 |
| 162 | 3300048926 | Ga0496123_0000311 | Ga0496123_0000311_29971_30867 | 295 |
| 163 | iso_pu_bacteria | 2643221695 | 2644527896 | 295 |
| 164 | iso_pu_bacteria | 2895522137 | 2895523342 | 295 |
| 165 | iso_pu_bacteria | 8002869464 | 8002870550 | 295 |
| 166 | 3300005616 | Ga0068852_100006053 | Ga0068852_1000060537 | 296 |
| 167 | 3300015261 | Ga0182006_1013787 | Ga0182006_10137875 | 296 |
| 168 | 3300026142 | Ga0207698_10000335 | Ga0207698_100003357 | 296 |
| 169 | 3300041407 | Ga0439447_001202 | Ga0439447_001202_986_1876 | 296 |
| 170 | 3300046616 | Ga0495668_0037170 | Ga0495668_0037170_592_1482 | 296 |
| 171 | iso_pu_bacteria | 2848694841 | 2848699886 | 296 |
| 172 | 3300030731 | Ga0316177_1077278 | Ga0316177_10772782 | 297 |
| 173 | 3300030735 | Ga0316178_1104881 | Ga0316178_11048811 | 297 |
| 174 | 3300031251 | Ga0265327_10002376 | Ga0265327_1000237615 | 297 |
| 175 | 3300032004 | Ga0307414_10140456 | Ga0307414_101404562 | 297 |
| 176 | iso_pu_bacteria | 2524614729 | 2525557676 | 297 |
| 177 | iso_pu_bacteria | 2571042365 | 2572255514 | 297 |
| 178 | iso_pu_bacteria | 2627854209 | 2630649267 | 297 |
| 179 | iso_pu_bacteria | 2643221559 | 2643817874 | 297 |
| 180 | iso_pu_bacteria | 2643221586 | 2643937532 | 297 |
| 181 | iso_pu_bacteria | 2643221612 | 2644078446 | 297 |
| 182 | iso_pu_bacteria | 2643221727 | 2644693223 | 297 |
| 183 | 3300003856 | Ga0058692_1000021 | Ga0058692_1000021202 | 298 |
| 184 | 3300005331 | Ga0070670_100003317 | Ga0070670_1000033179 | 298 |
| 185 | 3300009011 | Ga0105251_10000014 | Ga0105251_1000001499 | 298 |
| 186 | 3300009148 | Ga0105243_10000468 | Ga0105243_1000046836 | 298 |
| 187 | 3300025294 | Ga0209025_1003252 | Ga0209025_100325213 | 298 |
| 188 | 3300025735 | Ga0207713_1000290 | Ga0207713_100029035 | 298 |
| 189 | 3300025925 | Ga0207650_10013939 | Ga0207650_100139393 | 298 |
| 190 | 3300025935 | Ga0207709_10004409 | Ga0207709_100044099 | 298 |
| 191 | 3300027312 | Ga0209371_1000045 | Ga0209371_100004532 | 298 |
| 192 | 3300030500 | Ga0268256_1000047 | Ga0268256_100004732 | 298 |
| 193 | 3300031824 | Ga0307413_10000128 | Ga0307413_1000012818 | 298 |
| 194 | 3300031911 | Ga0307412_10211109 | Ga0307412_102111092 | 298 |
| 195 | 3300032004 | Ga0307414_10008312 | Ga0307414_100083122 | 298 |
| 196 | 3300041404 | Ga0439436_0005590 | Ga0439436_0005590_2222_3118 | 298 |
| 197 | 3300041413 | Ga0439465_0001148 | Ga0439465_0001148_4128_5024 | 298 |
| 198 | 3300041459 | Ga0451800_0601609 | Ga0451800_0601609_154_1056 | 298 |
| 199 | 3300041462 | Ga0451806_513008 | Ga0451806_513008_310_1212 | 298 |
| 200 | 3300042004 | Ga0439445_0010697 | Ga0439445_0010697_1226_2122 | 298 |
| 201 | 3300042004 | Ga0439445_0020406 | Ga0439445_0020406_687_1583 | 298 |
| 202 | 3300042007 | Ga0439449_0000107 | Ga0439449_0000107_15773_16669 | 298 |
| 203 | 3300048920 | Ga0496117_0001559 | Ga0496117_0001559_120_1022 | 298 |
| 204 | 3300048921 | Ga0496118_0137327 | Ga0496118_0137327_532_1434 | 298 |
| 205 | 3300048922 | Ga0496119_0001199 | Ga0496119_0001199_120_1022 | 298 |
| 206 | 3300048923 | Ga0496120_0000786 | Ga0496120_0000786_44796_45698 | 298 |
| 207 | 3300048925 | Ga0496122_0000081 | Ga0496122_0000081_200500_201402 | 298 |
| 208 | 3300048926 | Ga0496123_0000665 | Ga0496123_0000665_29330_30232 | 298 |
| 209 | 3300048927 | Ga0496124_0001667 | Ga0496124_0001667_20930_21832 | 298 |
| 210 | iso_pu_bacteria | 2643221593 | 2643975142 | 298 |
| 211 | iso_pu_bacteria | 2818991457 | 2819663237 | 298 |
| 212 | iso_pu_bacteria | 2895498888 | 2895503408 | 298 |
| 213 | iso_pu_bacteria | 2895511927 | 2895518439 | 298 |
| 214 | iso_pu_bacteria | 2895525241 | 2895527141 | 298 |
| 215 | iso_pu_bacteria | 2941489479 | 2941494211 | 298 |
| 216 | iso_pu_bacteria | 2995948881 | 2995953996 | 298 |
| 217 | iso_pu_bacteria | 8003014200 | 8003017113 | 298 |
| 218 | 3300003323 | rootH1_10177322 | rootH1_101773223 | 299 |
| 219 | 3300025931 | Ga0207644_10130312 | Ga0207644_101303123 | 299 |
| 220 | 3300030731 | Ga0316177_1192212 | Ga0316177_11922121 | 299 |
| 221 | 3300031901 | Ga0307406_10165011 | Ga0307406_101650112 | 299 |
| 222 | 3300032002 | Ga0307416_100531143 | Ga0307416_1005311432 | 299 |
| 223 | 3300032004 | Ga0307414_10062522 | Ga0307414_100625222 | 299 |
| 224 | 3300032005 | Ga0307411_10170413 | Ga0307411_101704132 | 299 |
| 225 | 3300037312 | Ga0395899_0159016 | Ga0395899_0159016_609_1517 | 299 |
| 226 | 3300037418 | Ga0395900_0010500 | Ga0395900_0010500_7616_8524 | 299 |
| 227 | 3300037471 | Ga0395905_0005032 | Ga0395905_0005032_1123_2031 | 299 |
| 228 | 3300037471 | Ga0395905_0005621 | Ga0395905_0005621_7707_8615 | 299 |
| 229 | 3300038443 | Ga0395901_0019281 | Ga0395901_0019281_190_1098 | 299 |
| 230 | 3300042007 | Ga0439449_0049825 | Ga0439449_0049825_115_1014 | 299 |
| 231 | 3300045976 | Ga0466967_0411097 | Ga0466967_0411097_189_1097 | 299 |
| 232 | 3300048903 | Ga0496100_0117459 | Ga0496100_0117459_689_1600 | 299 |
| 233 | 3300048911 | Ga0496108_0080585 | Ga0496108_0080585_1013_1924 | 299 |
| 234 | 3300048912 | Ga0496109_0026463 | Ga0496109_0026463_3421_4332 | 299 |
| 235 | 3300048915 | Ga0496112_0098069 | Ga0496112_0098069_597_1508 | 299 |
| 236 | 3300048916 | Ga0496113_0137375 | Ga0496113_0137375_814_1725 | 299 |
| 237 | iso_pu_bacteria | 2923516293 | 2923516825 | 299 |
| 238 | 3300002773 | JGI25152J39213_1000004 | JGI25152J39213_1000004167 | 300 |
| 239 | 3300003187 | JGI25151J46595_10000010 | JGI25151J46595_10000010167 | 300 |
| 240 | 3300003215 | JGI25153J46596_10000013 | JGI25153J46596_10000013167 | 300 |
| 241 | 3300025245 | Ga0207425_1000015 | Ga0207425_1000015125 | 300 |
| 242 | 3300025258 | Ga0209129_1000074 | Ga0209129_10000746 | 300 |
| 243 | 3300025294 | Ga0209025_1000002 | Ga0209025_10000021023 | 300 |
| 244 | 3300025297 | Ga0209758_1000003 | Ga0209758_10000031030 | 300 |
| 245 | 3300025926 | Ga0207659_10442211 | Ga0207659_104422112 | 300 |
| 246 | 3300027665 | Ga0209983_1002329 | Ga0209983_10023295 | 300 |
| 247 | 3300042007 | Ga0439449_0004994 | Ga0439449_0004994_3894_4796 | 300 |
| 248 | 3300046537 | Ga0495598_0011221 | Ga0495598_0011221_530_1441 | 300 |
| 249 | 3300048914 | Ga0496111_0213463 | Ga0496111_0213463_164_1075 | 300 |
| 250 | iso_pu_bacteria | 2643221573 | 2643880039 | 300 |
| 251 | iso_pu_bacteria | 2643221720 | 2644662409 | 300 |
| 252 | iso_pu_bacteria | 2643221728 | 2644698699 | 300 |
| 253 | 3300005347 | Ga0070668_100003880 | Ga0070668_1000038807 | 301 |
| 254 | 3300025972 | Ga0207668_10009035 | Ga0207668_100090351 | 301 |
| 255 | 3300031901 | Ga0307406_10007520 | Ga0307406_100075206 | 301 |
| 256 | 3300031901 | Ga0307406_10114851 | Ga0307406_101148513 | 301 |
| 257 | 3300032002 | Ga0307416_100259880 | Ga0307416_1002598802 | 301 |
| 258 | 3300041494 | Ga0451837_0924985 | Ga0451837_0924985_1909_2829 | 301 |
| 259 | 3300041509 | Ga0451843_1375814 | Ga0451843_1375814_1592_2512 | 301 |
| 260 | 3300046615 | Ga0495656_0011661 | Ga0495656_0011661_1859_2764 | 301 |
| 261 | 3300047318 | Ga0495636_0018105 | Ga0495636_0018105_465_1370 | 301 |
| 262 | 3300049680 | Ga0501250_012851 | Ga0501250_012851_59_973 | 301 |
| 263 | 3300049682 | Ga0501252_002997 | Ga0501252_002997_496_1410 | 301 |
| 264 | 3300049686 | Ga0501257_021778 | Ga0501257_021778_557_1471 | 301 |
| 265 | 3300049763 | Ga0501266_004220 | Ga0501266_004220_73_987 | 301 |
| 266 | iso_pu_bacteria | 2919513703 | 2919513762 | 301 |
| 267 | iso_pu_bacteria | 2919675420 | 2919678099 | 301 |
| 268 | 3300003187 | JGI25151J46595_10000127 | JGI25151J46595_1000012779 | 302 |
| 269 | 3300003771 | Ga0055526_1000012 | Ga0055526_1000012126 | 302 |
| 270 | 3300003773 | Ga0055537_1000021 | Ga0055537_100002193 | 302 |
| 271 | 3300003775 | Ga0055524_1000037 | Ga0055524_100003770 | 302 |
| 272 | 3300003775 | Ga0055524_1011793 | Ga0055524_10117932 | 302 |
| 273 | 3300003781 | Ga0055536_1030369 | Ga0055536_10303692 | 302 |
| 274 | 3300003784 | Ga0055534_1000006 | Ga0055534_1000006126 | 302 |
| 275 | 3300003790 | Ga0055528_1000006 | Ga0055528_1000006126 | 302 |
| 276 | 3300003791 | Ga0055530_10001711 | Ga0055530_100017119 | 302 |
| 277 | 3300003794 | Ga0055531_10012942 | Ga0055531_100129422 | 302 |
| 278 | 3300005353 | Ga0070669_100002554 | Ga0070669_1000025545 | 302 |
| 279 | 3300015689 | Ga0183360_10002 | Ga0183360_10002269 | 302 |
| 280 | 3300025245 | Ga0207425_1013786 | Ga0207425_10137862 | 302 |
| 281 | 3300025263 | Ga0209565_1000002 | Ga0209565_1000002736 | 302 |
| 282 | 3300025273 | Ga0209673_1000002 | Ga0209673_1000002736 | 302 |
| 283 | 3300025284 | Ga0209130_1013623 | Ga0209130_10136233 | 302 |
| 284 | 3300025291 | Ga0209675_1000002 | Ga0209675_1000002736 | 302 |
| 285 | 3300025292 | Ga0209676_1001538 | Ga0209676_10015383 | 302 |
| 286 | 3300025292 | Ga0209676_1010043 | Ga0209676_10100435 | 302 |
| 287 | 3300025292 | Ga0209676_1010288 | Ga0209676_10102882 | 302 |
| 288 | 3300025292 | Ga0209676_1012126 | Ga0209676_10121262 | 302 |
| 289 | 3300025294 | Ga0209025_1000021 | Ga0209025_1000021449 | 302 |
| 290 | 3300025295 | Ga0209564_1000004 | Ga0209564_1000004737 | 302 |
| 291 | 3300025295 | Ga0209564_1020123 | Ga0209564_10201231 | 302 |
| 292 | 3300025297 | Ga0209758_1023639 | Ga0209758_10236395 | 302 |
| 293 | 3300025298 | Ga0209050_1005163 | Ga0209050_10051633 | 302 |
| 294 | 3300025298 | Ga0209050_1010346 | Ga0209050_10103465 | 302 |
| 295 | 3300025299 | Ga0209256_1000004 | Ga0209256_1000004737 | 302 |
| 296 | 3300025299 | Ga0209256_1004958 | Ga0209256_10049582 | 302 |
| 297 | 3300025299 | Ga0209256_1007232 | Ga0209256_10072323 | 302 |
| 298 | 3300025303 | Ga0209051_1007829 | Ga0209051_10078292 | 302 |
| 299 | 3300025304 | Ga0209257_1000353 | Ga0209257_100035320 | 302 |
| 300 | 3300025304 | Ga0209257_1010752 | Ga0209257_10107523 | 302 |
| 301 | 3300025304 | Ga0209257_1012901 | Ga0209257_10129012 | 302 |
| 302 | 3300025304 | Ga0209257_1013731 | Ga0209257_10137312 | 302 |
| 303 | 3300025923 | Ga0207681_10003744 | Ga0207681_100037449 | 302 |
| 304 | 3300031901 | Ga0307406_10001011 | Ga0307406_100010115 | 302 |
| 305 | 3300048924 | Ga0496121_0001076 | Ga0496121_0001076_2990_3901 | 302 |
| 306 | 3300049579 | Ga0501043_0000916 | Ga0501043_0000916_15659_16567 | 302 |
| 307 | 3300049571 | Ga0501034_0000632 | Ga0501034_0000632_2039_2953 | 303 |
| 308 | 2162886007 | SwRhRL2b_contig_2189992 | SwRhRL2b_0762.00000110 | 304 |
| 309 | 3300003775 | Ga0055524_1004257 | Ga0055524_10042575 | 304 |
| 310 | 3300003794 | Ga0055531_10012203 | Ga0055531_100122035 | 304 |
| 311 | 3300005289 | Ga0065704_10001454 | Ga0065704_100014545 | 304 |
| 312 | 3300006051 | Ga0075364_10086068 | Ga0075364_100860682 | 304 |
| 313 | 3300025273 | Ga0209673_1012392 | Ga0209673_10123922 | 304 |
| 314 | 3300025292 | Ga0209676_1005794 | Ga0209676_10057945 | 304 |
| 315 | 3300025294 | Ga0209025_1001187 | Ga0209025_100118725 | 304 |
| 316 | 3300025299 | Ga0209256_1007491 | Ga0209256_10074913 | 304 |
| 317 | 3300025304 | Ga0209257_1007451 | Ga0209257_10074513 | 304 |
| 318 | 3300041494 | Ga0451837_1344659 | Ga0451837_1344659_71_991 | 304 |
| 319 | 3300041997 | Ga0439431_0028531 | Ga0439431_0028531_270_1193 | 304 |
| 320 | 3300042015 | Ga0439462_0013278 | Ga0439462_0013278_555_1478 | 304 |
| 321 | 3300049568 | Ga0501031_0017897 | Ga0501031_0017897_3574_4497 | 304 |
| 322 | 3300049569 | Ga0501032_0063936 | Ga0501032_0063936_749_1672 | 304 |
| 323 | 3300049570 | Ga0501033_0164103 | Ga0501033_0164103_529_1452 | 304 |
| 324 | 3300049572 | Ga0501036_0033466 | Ga0501036_0033466_1284_2207 | 304 |
| 325 | 3300049573 | Ga0501037_0017276 | Ga0501037_0017276_1087_2010 | 304 |
| 326 | 3300049579 | Ga0501043_0015093 | Ga0501043_0015093_1000_1923 | 304 |
| 327 | 3300049584 | Ga0501068_0057570 | Ga0501068_0057570_1352_2275 | 304 |
| 328 | 3300049586 | Ga0501070_0091932 | Ga0501070_0091932_515_1438 | 304 |
| 329 | 3300049587 | Ga0501071_0287727 | Ga0501071_0287727_171_1094 | 304 |
| 330 | 3300049589 | Ga0501073_0020216 | Ga0501073_0020216_614_1537 | 304 |
| 331 | 3300049742 | Ga0501080_0146413 | Ga0501080_0146413_546_1469 | 304 |
| 332 | 3300049823 | Ga0501044_0009987 | Ga0501044_0009987_6473_7396 | 304 |
| 333 | 3300050491 | nmdc:mga00v17_43030_c1 | nmdc:mga00v17_43030_c1_1630_2550 | 304 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4od4-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8604 | 34 | 295 |
| 4od4-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8203 | 34 | 295 |
| 4tq3-assembly1.cif.gz_A | structure of a ubia homolog from archaeoglobus fulgidus bound to gpp and mg2+ | 0.7612 | 20 | 297 |
| 7bpu-assembly1.cif.gz_A | structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes | 0.749 | 16 | 295 |
| 4tq3-assembly1.cif.gz_A | structure of a ubia homolog from archaeoglobus fulgidus bound to gpp and mg2+ | 0.747 | 20 | 297 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AGK1_170_289_1.20.120.1780 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase | 0.9954 | 178 | 294 | 1.20.120.1780 |
| af_P0AGK1_170_289_1.20.120.1780 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase | 0.9626 | 178 | 294 | 1.20.120.1780 |
| af_P0AGK1_23_169_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.9623 | 31 | 175 | 1.10.357.140 |
| af_Q8I7J4_224_349_1.20.120.1780 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase | 0.9566 | 178 | 294 | 1.20.120.1780 |
| af_Q54U71_333_454_1.20.120.1780 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase | 0.9524 | 181 | 294 | 1.20.120.1780 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N8XIL8-F1-model_v4 | 4-hydroxybenzoate octaprenyltransferase | 0.9776 | 150 | 296 |
GO:0005886
GO:0006744 GO:0008412 |
| AF-A0A2E2HG50-F1-model_v4 | 4-hydroxybenzoate octaprenyltransferase (EC 2.5.1.39) (4-HB polyprenyltransferase) | 0.9772 | 12 | 300 |
GO:0005886
GO:0006744 GO:0008412 |
| AF-A0A2N2SFV7-F1-model_v4 | 4-hydroxybenzoate octaprenyltransferase | 0.9749 | 139 | 294 |
GO:0005886
GO:0006744 GO:0008412 |
| AF-A0A3S0B802-F1-model_v4 | 4-hydroxybenzoate octaprenyltransferase (EC 2.5.1.39) (4-HB polyprenyltransferase) | 0.9741 | 14 | 299 |
GO:0005886
GO:0006744 GO:0008412 |
| AF-A0A1I4Z5W7-F1-model_v4 | 4-hydroxybenzoate octaprenyltransferase (EC 2.5.1.39) (4-HB polyprenyltransferase) | 0.974 | 14 | 296 |
GO:0005886
GO:0006744 GO:0008412 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar