F411527

General Info

Members Datasets Scaffolds Average Seq Length
333 223 273 300

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0002674|Ga0496116_0002674_16193_17239
Length 348
Sequence MSCVPPGRLMGPRTAKAAREEHSIRKRRAGLPPTDALGDGAPGQPRRYPLPMAYERFEAPEAAPPPRWRHYWKLMRADRPIGTLLLLWPTWWALWLASGGLPPLWTLFVFTAGVWLTRSAGCVINDYADRWLDPHVKRTKDRPLASGAVSGREALALFAGLMIVAFGLVLTLNWLTIGMSFIGVFLAASYPYLKRYTHLPQVYLGMAFGWGIPMAFAAVQGEVPVIGWLLYGANILWSTAYDTWYAMVDRDDDLKMGSHSTAILFGDLDLVIQGILYALFLGTMALVGLRAGLGFYYGVGXXVAAGLIAYEFWIARKRERDPCFKAFLHNNWVGAALFAGIAVALAVR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
4 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
5 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
6 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
7 2643221559 Lysobacter sp. Root559 Isolate Unclassified
8 2643221573 Lysobacter sp. Root604 Isolate Unclassified
9 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
10 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
11 2643221586 Lysobacter sp. Root667 Isolate Unclassified
12 2643221593 Lysobacter sp. Root690 Isolate Unclassified
13 2643221612 Lysobacter sp. Root76 Isolate Unclassified
14 2643221695 Lysobacter sp. Root494 Isolate Unclassified
15 2643221720 Lysobacter sp. Root916 Isolate Unclassified
16 2643221727 Lysobacter sp. Root96 Isolate Unclassified
17 2643221728 Lysobacter sp. Root983 Isolate Unclassified
18 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
19 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
20 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
21 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
22 2818991457 Xanthomonas translucens 569 Isolate Unclassified
23 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
24 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
25 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
26 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
27 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
28 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
29 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
30 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
31 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
32 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
33 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
34 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
35 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
36 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
37 2919513703 Luteimonas sp. 3794 Isolate Unclassified
38 2919675420 Luteimonas terrae 4099 Isolate Unclassified
39 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
40 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
41 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
42 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
43 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
44 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
45 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
46 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
47 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
48 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
49 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
50 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
51 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
52 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
53 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
54 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
55 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
56 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
57 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
58 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
59 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
60 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
61 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
62 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
63 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
64 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
65 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
66 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
67 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
68 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
69 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
70 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
71 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
72 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
73 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
74 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
86 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
94 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
128 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
129 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
140 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
146 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
147 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
148 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
149 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
150 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
153 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
154 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
155 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
156 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
157 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
158 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
159 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
170 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
207 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
208 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
209 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
212 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
213 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
214 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
219 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
220 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
221 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
222 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
223 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.98
Metatranscriptomes 0
Isolates 18.02

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0
Endosphere 19.82
Nodule 0.3
Rhizoplane 4.5
Rhizosphere 53.15
Stem 0
Stem Tuber 0
Unclassified 21.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2189992 2162886007 Bacteria 3215
2 JGI25152J39213_1000004 3300002773 Bacteria 191383
3 JGI25151J46595_10000010 3300003187 Bacteria 277507
4 JGI25151J46595_10000127 3300003187 Bacteria 102790
5 JGI25153J46596_10000013 3300003215 Bacteria 303690
6 rootH2_10008473 3300003320 Bacteria 47100
7 rootH1_10177322 3300003323 Bacteria 2546
8 Ga0055526_1000012 3300003771 Bacteria 234368
9 Ga0055537_1000021 3300003773 Bacteria 116840
10 Ga0055524_1000037 3300003775 Bacteria 167140
11 Ga0055524_1004257 3300003775 Bacteria 6654
12 Ga0055524_1011793 3300003775 Bacteria 3391
13 Ga0055536_1000969 3300003781 Bacteria 18299
14 Ga0055536_1003449 3300003781 Bacteria 8480
15 Ga0055536_1003766 3300003781 Bacteria 8005
16 Ga0055536_1024843 3300003781 Bacteria 1724
17 Ga0055536_1030369 3300003781 Bacteria 1434
18 Ga0055534_1000006 3300003784 Bacteria 234368
19 Ga0055528_1000006 3300003790 Bacteria 234368
20 Ga0055530_10001711 3300003791 Bacteria 15481
21 Ga0055531_10011479 3300003794 Bacteria 4264
22 Ga0055531_10012203 3300003794 Bacteria 4061
23 Ga0055531_10012942 3300003794 Bacteria 3885
24 Ga0058692_1000004 3300003856 Bacteria 431119
25 Ga0058692_1000021 3300003856 Bacteria 240308
26 Ga0065704_10001454 3300005289 Bacteria 9120
27 Ga0070670_100003317 3300005331 Bacteria 13319
28 Ga0070668_100003880 3300005347 Bacteria 11040
29 Ga0070669_100002554 3300005353 Bacteria 13159
30 Ga0070669_100172153 3300005353 Bacteria 1689
31 Ga0070678_100008989 3300005456 Bacteria 6018
32 Ga0068853_100162066 3300005539 Bacteria 2019
33 Ga0070672_100016364 3300005543 Bacteria 5309
34 Ga0070693_100007886 3300005547 Bacteria 5223
35 Ga0068852_100006053 3300005616 Bacteria 8715
36 Ga0068852_100336725 3300005616 Bacteria 1470
37 Ga0075364_10000986 3300006051 Bacteria 15062
38 Ga0075364_10086068 3300006051 Bacteria 2082
39 Ga0075369_10018524 3300006186 Bacteria 2836
40 Ga0105251_10000014 3300009011 Bacteria 150347
41 Ga0105244_10059361 3300009036 Bacteria 1928
42 Ga0105243_10000468 3300009148 Bacteria 41748
43 Ga0105243_10281193 3300009148 Bacteria 1499
44 Ga0157316_1002304 3300012510 Bacteria 1285
45 Ga0157327_1002346 3300012512 Bacteria 1296
46 Ga0157371_10028696 3300013102 Bacteria 4028
47 Ga0157370_10150401 3300013104 Bacteria 2166
48 Ga0157378_10175944 3300013297 Bacteria 2010
49 Ga0157375_10179038 3300013308 Bacteria 2271
50 Ga0182006_1013787 3300015261 Bacteria 3497
51 Ga0182007_10000019 3300015262 Bacteria 194770
52 Ga0182005_1001066 3300015265 Bacteria 11581
53 Ga0183360_10002 3300015689 Bacteria 953821
54 Ga0163161_10173781 3300017792 Bacteria 1648
55 Ga0207425_1000015 3300025245 Bacteria 466368
56 Ga0207425_1013786 3300025245 Bacteria 1854
57 Ga0209129_1000074 3300025258 Bacteria 205648
58 Ga0209565_1000002 3300025263 Bacteria 1423083
59 Ga0209673_1000002 3300025273 Bacteria 1423083
60 Ga0209673_1012392 3300025273 Bacteria 3436
61 Ga0209130_1013623 3300025284 Bacteria 2075
62 Ga0209675_1000002 3300025291 Bacteria 1423083
63 Ga0209675_1027857 3300025291 Bacteria 1382
64 Ga0209676_1000063 3300025292 Bacteria 322025
65 Ga0209676_1000190 3300025292 Bacteria 140482
66 Ga0209676_1001538 3300025292 Bacteria 20871
67 Ga0209676_1001649 3300025292 Bacteria 19565
68 Ga0209676_1005794 3300025292 Bacteria 6316
69 Ga0209676_1010043 3300025292 Bacteria 3997
70 Ga0209676_1010288 3300025292 Bacteria 3921
71 Ga0209676_1012126 3300025292 Bacteria 3416
72 Ga0209025_1000002 3300025294 Bacteria 1393142
73 Ga0209025_1000021 3300025294 Bacteria 593083
74 Ga0209025_1001187 3300025294 Bacteria 36871
75 Ga0209025_1003252 3300025294 Bacteria 15655
76 Ga0209025_1029970 3300025294 Bacteria 2616
77 Ga0209564_1000004 3300025295 Bacteria 1424639
78 Ga0209564_1020123 3300025295 Bacteria 2461
79 Ga0209758_1000003 3300025297 Bacteria 1398533
80 Ga0209758_1023639 3300025297 Bacteria 2771
81 Ga0209050_1005163 3300025298 Bacteria 8363
82 Ga0209050_1010346 3300025298 Bacteria 4608
83 Ga0209256_1000004 3300025299 Bacteria 1424643
84 Ga0209256_1004958 3300025299 Bacteria 7977
85 Ga0209256_1007232 3300025299 Bacteria 5550
86 Ga0209256_1007491 3300025299 Bacteria 5363
87 Ga0209051_1007829 3300025303 Bacteria 5766
88 Ga0209257_1000136 3300025304 Bacteria 204863
89 Ga0209257_1000353 3300025304 Bacteria 94267
90 Ga0209257_1007451 3300025304 Bacteria 6601
91 Ga0209257_1010752 3300025304 Bacteria 4556
92 Ga0209257_1012901 3300025304 Bacteria 3785
93 Ga0209257_1013731 3300025304 Bacteria 3560
94 Ga0209257_1060968 3300025304 Bacteria 1025
95 Ga0207713_1000290 3300025735 Bacteria 58238
96 Ga0207657_10007003 3300025919 Bacteria 11605
97 Ga0207652_10224015 3300025921 Bacteria 1694
98 Ga0207681_10003744 3300025923 Bacteria 9452
99 Ga0207650_10013939 3300025925 Bacteria 5577
100 Ga0207659_10442211 3300025926 Bacteria 1094
101 Ga0207644_10130312 3300025931 Bacteria 1924
102 Ga0207709_10004409 3300025935 Bacteria 8147
103 Ga0207709_10008282 3300025935 Bacteria 5758
104 Ga0207709_10202864 3300025935 Bacteria 1418
105 Ga0207691_10000278 3300025940 Bacteria 50663
106 Ga0207668_10003870 3300025972 Bacteria 8823
107 Ga0207668_10009035 3300025972 Bacteria 5955
108 Ga0207639_10195328 3300026041 Bacteria 1731
109 Ga0207675_100144515 3300026118 Bacteria 2261
110 Ga0207683_10031339 3300026121 Bacteria 4613
111 Ga0207698_10000335 3300026142 Bacteria 27930
112 Ga0209371_1000018 3300027312 Bacteria 614700
113 Ga0209371_1000045 3300027312 Bacteria 316174
114 Ga0209983_1002329 3300027665 Bacteria 4165
115 Ga0307515_10158430 3300028794 Bacteria 2323
116 Ga0268256_1000016 3300030500 Bacteria 614700
117 Ga0268256_1000047 3300030500 Bacteria 316174
118 Ga0316177_1077278 3300030731 Bacteria 2772
119 Ga0316177_1192212 3300030731 Bacteria 1282
120 Ga0316178_1104881 3300030735 Bacteria 2150
121 Ga0265327_10002376 3300031251 Bacteria 20027
122 Ga0265327_10007933 3300031251 Bacteria 8040
123 Ga0307513_10000914 3300031456 Bacteria 42646
124 Ga0307513_10068688 3300031456 Bacteria 3711
125 Ga0307405_10135234 3300031731 Bacteria 1710
126 Ga0307405_10154841 3300031731 Bacteria 1616
127 Ga0307413_10000128 3300031824 Bacteria 19807
128 Ga0307406_10001011 3300031901 Bacteria 15636
129 Ga0307406_10007520 3300031901 Bacteria 6046
130 Ga0307406_10114851 3300031901 Bacteria 1860
131 Ga0307406_10165011 3300031901 Bacteria 1597
132 Ga0307412_10063634 3300031911 Bacteria 2489
133 Ga0307412_10211109 3300031911 Bacteria 1481
134 Ga0307416_100149885 3300032002 Bacteria 2137
135 Ga0307416_100259880 3300032002 Bacteria 1696
136 Ga0307416_100531143 3300032002 Bacteria 1246
137 Ga0307414_10008312 3300032004 Bacteria 5878
138 Ga0307414_10062522 3300032004 Bacteria 2642
139 Ga0307414_10064753 3300032004 Bacteria 2604
140 Ga0307414_10095454 3300032004 Bacteria 2222
141 Ga0307414_10129595 3300032004 Bacteria 1956
142 Ga0307414_10140456 3300032004 Bacteria 1890
143 Ga0307414_10307329 3300032004 Bacteria 1344
144 Ga0307411_10170413 3300032005 Bacteria 1641
145 Ga0307411_10314401 3300032005 Bacteria 1262
146 Ga0316585_10037174 3300032137 Bacteria 1545
147 Ga0316584_0016514 3300036712 Bacteria 5291
148 Ga0395899_0159016 3300037312 Bacteria 1597
149 Ga0395900_0010500 3300037418 Bacteria 9473
150 Ga0395905_0005032 3300037471 Bacteria 13614
151 Ga0395905_0005621 3300037471 Bacteria 12761
152 Ga0395901_0019281 3300038443 Bacteria 6973
153 Ga0439436_0005590 3300041404 Bacteria 3855
154 Ga0439447_001202 3300041407 Bacteria 9433
155 Ga0439465_0001148 3300041413 Bacteria 8491
156 Ga0451791_0145432 3300041451 Bacteria 2614
157 Ga0451800_0601609 3300041459 Bacteria 1306
158 Ga0451806_513008 3300041462 Bacteria 1447
159 Ga0451807_0231291 3300041486 Bacteria 3439
160 Ga0451837_0924985 3300041494 Bacteria 3014
161 Ga0451837_1344659 3300041494 Bacteria 1313
162 Ga0451843_1375814 3300041509 Bacteria 2869
163 Ga0439431_0028531 3300041997 Bacteria 1375
164 Ga0439445_0010697 3300042004 Bacteria 2177
165 Ga0439445_0020406 3300042004 Bacteria 1658
166 Ga0439432_009801 3300042006 Bacteria 3332
167 Ga0439449_0000107 3300042007 Bacteria 27003
168 Ga0439449_0004994 3300042007 Bacteria 5102
169 Ga0439449_0049825 3300042007 Bacteria 1549
170 Ga0439449_0074786 3300042007 Bacteria 1248
171 Ga0439462_0013278 3300042015 Bacteria 2110
172 Ga0439435_0028899 3300042436 Bacteria 1494
173 Ga0451577_0000071 3300042876 Bacteria 238560
174 Ga0451577_0001460 3300042876 Bacteria 31395
175 Ga0453684_0000583 3300044712 Bacteria 135940
176 Ga0453684_0002216 3300044712 Bacteria 48307
177 Ga0453684_0096678 3300044712 Bacteria 3627
178 Ga0451576_0000137 3300045051 Bacteria 185212
179 Ga0466967_0411097 3300045976 Bacteria 1318
180 Ga0495627_020065 3300046453 Bacteria 2232
181 Ga0495638_0000385 3300046460 Bacteria 54566
182 Ga0495663_0000099 3300046525 Bacteria 35313
183 Ga0495663_0002056 3300046525 Bacteria 6163
184 Ga0495663_0008084 3300046525 Bacteria 2910
185 Ga0495663_0032745 3300046525 Bacteria 1549
186 Ga0495663_0049780 3300046525 Bacteria 1295
187 Ga0495598_0009333 3300046537 Bacteria 2316
188 Ga0495598_0011221 3300046537 Bacteria 2166
189 Ga0495621_0017166 3300046539 Bacteria 2335
190 Ga0495633_0021220 3300046558 Bacteria 3251
191 Ga0495633_0045146 3300046558 Bacteria 2087
192 Ga0495656_0000374 3300046615 Bacteria 14977
193 Ga0495656_0011661 3300046615 Bacteria 3228
194 Ga0495668_0037170 3300046616 Bacteria 2725
195 Ga0495636_0000634 3300047318 Bacteria 12891
196 Ga0495636_0018105 3300047318 Bacteria 2825
197 Ga0495636_0040494 3300047318 Bacteria 1931
198 Ga0495686_0024787 3300047472 Bacteria 3936
199 Ga0495615_0015735 3300048090 Bacteria 1621
200 Ga0496100_0117459 3300048903 Bacteria 1857
201 Ga0496104_0155811 3300048907 Bacteria 2192
202 Ga0496108_0065907 3300048911 Bacteria 3053
203 Ga0496108_0080585 3300048911 Bacteria 2758
204 Ga0496109_0012776 3300048912 Bacteria 7259
205 Ga0496109_0026463 3300048912 Bacteria 5174
206 Ga0496111_0213463 3300048914 Bacteria 1433
207 Ga0496112_0098069 3300048915 Bacteria 2900
208 Ga0496113_0137375 3300048916 Bacteria 1921
209 Ga0496114_0005729 3300048917 Bacteria 9749
210 Ga0496114_0206406 3300048917 Bacteria 1722
211 Ga0496116_0001837 3300048919 Bacteria 22940
212 Ga0496116_0002674 3300048919 Bacteria 18434
213 Ga0496117_0001115 3300048920 Bacteria 40491
214 Ga0496117_0001559 3300048920 Bacteria 32542
215 Ga0496118_0000108 3300048921 Bacteria 153902
216 Ga0496118_0137327 3300048921 Bacteria 1557
217 Ga0496119_0000338 3300048922 Bacteria 65446
218 Ga0496119_0001199 3300048922 Bacteria 32413
219 Ga0496120_0000707 3300048923 Bacteria 48949
220 Ga0496120_0000786 3300048923 Bacteria 45817
221 Ga0496121_0001076 3300048924 Bacteria 48261
222 Ga0496121_0006948 3300048924 Bacteria 13783
223 Ga0496121_0073457 3300048924 Bacteria 2741
224 Ga0496122_0000081 3300048925 Bacteria 211119
225 Ga0496122_0003920 3300048925 Bacteria 19034
226 Ga0496122_0040390 3300048925 Bacteria 3708
227 Ga0496122_0081893 3300048925 Bacteria 2244
228 Ga0496123_0000311 3300048926 Bacteria 93694
229 Ga0496123_0000665 3300048926 Bacteria 56849
230 Ga0496123_0001059 3300048926 Bacteria 41631
231 Ga0496123_0047566 3300048926 Bacteria 2896
232 Ga0496123_0084067 3300048926 Bacteria 1921
233 Ga0496124_0000020 3300048927 Bacteria 434107
234 Ga0496124_0001667 3300048927 Bacteria 31600
235 Ga0496124_0002097 3300048927 Bacteria 26919
236 Ga0496124_0015601 3300048927 Bacteria 7271
237 Ga0496124_0021704 3300048927 Bacteria 5911
238 Ga0496124_0150740 3300048927 Bacteria 1824
239 Ga0496125_0003018 3300048928 Bacteria 21053
240 Ga0496125_0104002 3300048928 Bacteria 2081
241 Ga0496126_0000532 3300048929 Bacteria 73699
242 Ga0501031_0003783 3300049568 Bacteria 9739
243 Ga0501031_0017897 3300049568 Bacteria 4609
244 Ga0501031_0036828 3300049568 Bacteria 3192
245 Ga0501032_0063936 3300049569 Bacteria 2463
246 Ga0501033_0000917 3300049570 Bacteria 26939
247 Ga0501033_0164103 3300049570 Bacteria 1598
248 Ga0501034_0000404 3300049571 Bacteria 72780
249 Ga0501034_0000632 3300049571 Bacteria 54605
250 Ga0501036_0033466 3300049572 Bacteria 4347
251 Ga0501037_0017276 3300049573 Bacteria 5312
252 Ga0501039_0119997 3300049575 Bacteria 2060
253 Ga0501043_0000916 3300049579 Bacteria 26114
254 Ga0501043_0015093 3300049579 Bacteria 6046
255 Ga0501068_0057570 3300049584 Bacteria 2357
256 Ga0501070_0091932 3300049586 Bacteria 2511
257 Ga0501071_0287727 3300049587 Bacteria 1244
258 Ga0501073_0020216 3300049589 Bacteria 4802
259 Ga0501202_011706 3300049652 Bacteria 1647
260 Ga0501250_012851 3300049680 Bacteria 996
261 Ga0501252_002997 3300049682 Bacteria 1715
262 Ga0501257_021778 3300049686 Bacteria 1514
263 Ga0501080_0146413 3300049742 Bacteria 2183
264 Ga0501265_000056 3300049762 Bacteria 8911
265 Ga0501266_004220 3300049763 Bacteria 1779
266 Ga0501275_000739 3300049772 Bacteria 3571
267 Ga0501276_004166 3300049773 Bacteria 1077
268 Ga0501035_0054264 3300049822 Bacteria 3581
269 Ga0501044_0009987 3300049823 Bacteria 10312
270 Ga0501044_0167882 3300049823 Bacteria 2167
271 nmdc:mga00v17_184_c1 3300050491 Bacteria 37430
272 nmdc:mga00v17_43030_c1 3300050491 Bacteria 2719
273 Ga0500634_0000195 3300053161 Bacteria 19694

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300012510 Ga0157316_1002304 Ga0157316_10023041 273
2 3300009148 Ga0105243_10281193 Ga0105243_102811932 281
3 3300013308 Ga0157375_10179038 Ga0157375_101790383 281
4 3300044712 Ga0453684_0000583 Ga0453684_0000583_5656_6501 281
5 3300045051 Ga0451576_0000137 Ga0451576_0000137_129440_130285 281
6 3300046537 Ga0495598_0009333 Ga0495598_0009333_858_1703 281
7 3300046539 Ga0495621_0017166 Ga0495621_0017166_354_1199 281
8 iso_pu_bacteria 2989392574 2989392698 281
9 iso_pu_bacteria 2894510363 2894514237 283
10 3300013102 Ga0157371_10028696 Ga0157371_100286963 284
11 3300032004 Ga0307414_10064753 Ga0307414_100647532 284
12 3300041451 Ga0451791_0145432 Ga0451791_0145432_33_887 284
13 3300003781 Ga0055536_1000969 Ga0055536_10009695 285
14 3300003781 Ga0055536_1003449 Ga0055536_100344910 285
15 3300025292 Ga0209676_1000063 Ga0209676_10000636 285
16 3300028794 Ga0307515_10158430 Ga0307515_101584302 286
17 3300031456 Ga0307513_10000914 Ga0307513_1000091424 286
18 3300031456 Ga0307513_10068688 Ga0307513_100686885 286
19 3300042876 Ga0451577_0000071 Ga0451577_0000071_158684_159544 286
20 3300044712 Ga0453684_0002216 Ga0453684_0002216_2456_3316 286
21 3300044712 Ga0453684_0096678 Ga0453684_0096678_492_1352 286
22 3300046525 Ga0495663_0002056 Ga0495663_0002056_395_1294 286
23 3300049571 Ga0501034_0000404 Ga0501034_0000404_9366_10271 286
24 3300046525 Ga0495663_0000099 Ga0495663_0000099_26538_27431 287
25 3300047472 Ga0495686_0024787 Ga0495686_0024787_2180_3094 287
26 3300048917 Ga0496114_0005729 Ga0496114_0005729_3443_4402 287
27 3300048920 Ga0496117_0001115 Ga0496117_0001115_13642_14535 287
28 3300048921 Ga0496118_0000108 Ga0496118_0000108_128187_129080 287
29 3300048925 Ga0496122_0003920 Ga0496122_0003920_1208_2101 287
30 3300048926 Ga0496123_0001059 Ga0496123_0001059_36323_37216 287
31 3300048927 Ga0496124_0002097 Ga0496124_0002097_25688_26581 287
32 3300032137 Ga0316585_10037174 Ga0316585_100371742 288
33 3300036712 Ga0316584_0016514 Ga0316584_0016514_3567_4433 288
34 3300048090 Ga0495615_0015735 Ga0495615_0015735_17_883 288
35 3300003794 Ga0055531_10011479 Ga0055531_100114793 289
36 3300025304 Ga0209257_1000136 Ga0209257_1000136109 289
37 3300049762 Ga0501265_000056 Ga0501265_000056_3230_4129 289
38 3300049772 Ga0501275_000739 Ga0501275_000739_274_1173 289
39 3300049773 Ga0501276_004166 Ga0501276_004166_158_1057 289
40 3300042876 Ga0451577_0001460 Ga0451577_0001460_19707_20606 290
41 3300048927 Ga0496124_0000020 Ga0496124_0000020_361036_361962 290
42 3300049568 Ga0501031_0003783 Ga0501031_0003783_6773_7696 290
43 3300049568 Ga0501031_0036828 Ga0501031_0036828_1273_2199 290
44 3300049575 Ga0501039_0119997 Ga0501039_0119997_886_1812 290
45 3300049822 Ga0501035_0054264 Ga0501035_0054264_1579_2505 290
46 3300049823 Ga0501044_0167882 Ga0501044_0167882_1020_1946 290
47 iso_pu_bacteria 2547132130 2547500262 290
48 iso_pu_bacteria 2576861471 2578456568 290
49 iso_pu_bacteria 2747842428 2747947377 290
50 iso_pu_bacteria 2765235840 2765580932 290
51 iso_pu_bacteria 2816332141 2816518071 290
52 iso_pu_bacteria 2842391507 2842394543 290
53 iso_pu_bacteria 2852649853 2852651798 290
54 iso_pu_bacteria 2874220319 2874223594 290
55 iso_pu_bacteria 2919089067 2919089149 290
56 iso_pu_bacteria 2919134579 2919136612 290
57 iso_pu_bacteria 2928496128 2928497018 290
58 iso_pu_bacteria 2931380184 2931383000 290
59 iso_pu_bacteria 2937610967 2937613925 290
60 iso_pu_bacteria 2939589442 2939590188 290
61 iso_pu_bacteria 2939622612 2939623812 290
62 iso_pu_bacteria 2939626828 2939628638 290
63 iso_pu_bacteria 2941475908 2941479520 290
64 iso_pu_bacteria 2961047084 2961050358 290
65 iso_pu_bacteria 2961064222 2961064508 290
66 iso_pu_bacteria 2974307012 2974307207 290
67 iso_pu_bacteria 2977247770 2977247949 290
68 iso_pu_bacteria 2984514374 2984517592 290
69 3300025294 Ga0209025_1029970 Ga0209025_10299703 291
70 3300041486 Ga0451807_0231291 Ga0451807_0231291_1313_2236 291
71 3300042007 Ga0439449_0074786 Ga0439449_0074786_20_943 291
72 3300042436 Ga0439435_0028899 Ga0439435_0028899_353_1276 291
73 iso_pu_bacteria 2842780639 2842784194 291
74 iso_pu_bacteria 2987605356 2987605546 291
75 3300003781 Ga0055536_1024843 Ga0055536_10248432 292
76 3300003856 Ga0058692_1000004 Ga0058692_1000004220 292
77 3300005353 Ga0070669_100172153 Ga0070669_1001721533 292
78 3300005543 Ga0070672_100016364 Ga0070672_1000163642 292
79 3300006051 Ga0075364_10000986 Ga0075364_1000098610 292
80 3300025291 Ga0209675_1027857 Ga0209675_10278571 292
81 3300025292 Ga0209676_1001649 Ga0209676_10016498 292
82 3300025940 Ga0207691_10000278 Ga0207691_100002783 292
83 3300026118 Ga0207675_100144515 Ga0207675_1001445152 292
84 3300027312 Ga0209371_1000018 Ga0209371_1000018176 292
85 3300030500 Ga0268256_1000016 Ga0268256_1000016176 292
86 3300046525 Ga0495663_0049780 Ga0495663_0049780_17_928 292
87 3300046615 Ga0495656_0000374 Ga0495656_0000374_6341_7252 292
88 3300048917 Ga0496114_0206406 Ga0496114_0206406_286_1197 292
89 3300049570 Ga0501033_0000917 Ga0501033_0000917_10919_11842 292
90 3300050491 nmdc:mga00v17_184_c1 nmdc:mga00v17_184_c1_9838_10749 292
91 3300005547 Ga0070693_100007886 Ga0070693_1000078865 293
92 3300013297 Ga0157378_10175944 Ga0157378_101759442 293
93 3300031251 Ga0265327_10007933 Ga0265327_100079338 293
94 3300032005 Ga0307411_10314401 Ga0307411_103144011 293
95 iso_pu_bacteria 2643221579 2643909057 293
96 iso_pu_bacteria 2643221581 2643914400 293
97 iso_pu_bacteria 2747842501 2748017313 293
98 3300003320 rootH2_10008473 rootH2_100084739 294
99 3300003781 Ga0055536_1003766 Ga0055536_10037663 294
100 3300005456 Ga0070678_100008989 Ga0070678_10000898910 294
101 3300005539 Ga0068853_100162066 Ga0068853_1001620662 294
102 3300005616 Ga0068852_100336725 Ga0068852_1003367252 294
103 3300006186 Ga0075369_10018524 Ga0075369_100185243 294
104 3300009036 Ga0105244_10059361 Ga0105244_100593613 294
105 3300012512 Ga0157327_1002346 Ga0157327_10023462 294
106 3300013104 Ga0157370_10150401 Ga0157370_101504012 294
107 3300015262 Ga0182007_10000019 Ga0182007_10000019159 294
108 3300015265 Ga0182005_1001066 Ga0182005_10010663 294
109 3300017792 Ga0163161_10173781 Ga0163161_101737812 294
110 3300025292 Ga0209676_1000190 Ga0209676_10001903 294
111 3300025304 Ga0209257_1060968 Ga0209257_10609681 294
112 3300025935 Ga0207709_10008282 Ga0207709_100082822 294
113 3300025935 Ga0207709_10202864 Ga0207709_102028642 294
114 3300025972 Ga0207668_10003870 Ga0207668_100038702 294
115 3300026121 Ga0207683_10031339 Ga0207683_100313394 294
116 3300031731 Ga0307405_10135234 Ga0307405_101352342 294
117 3300031731 Ga0307405_10154841 Ga0307405_101548412 294
118 3300031911 Ga0307412_10063634 Ga0307412_100636342 294
119 3300032002 Ga0307416_100149885 Ga0307416_1001498852 294
120 3300032004 Ga0307414_10095454 Ga0307414_100954542 294
121 3300032004 Ga0307414_10129595 Ga0307414_101295951 294
122 3300042006 Ga0439432_009801 Ga0439432_009801_2380_3288 294
123 3300046453 Ga0495627_020065 Ga0495627_020065_135_1073 294
124 3300046460 Ga0495638_0000385 Ga0495638_0000385_27866_28759 294
125 3300046525 Ga0495663_0008084 Ga0495663_0008084_635_1528 294
126 3300046525 Ga0495663_0032745 Ga0495663_0032745_29_943 294
127 3300046558 Ga0495633_0021220 Ga0495633_0021220_1880_2773 294
128 3300046558 Ga0495633_0045146 Ga0495633_0045146_843_1781 294
129 3300047318 Ga0495636_0000634 Ga0495636_0000634_8520_9434 294
130 3300047318 Ga0495636_0040494 Ga0495636_0040494_283_1197 294
131 3300048907 Ga0496104_0155811 Ga0496104_0155811_623_1516 294
132 3300048911 Ga0496108_0065907 Ga0496108_0065907_1486_2397 294
133 3300048912 Ga0496109_0012776 Ga0496109_0012776_3474_4385 294
134 3300048919 Ga0496116_0001837 Ga0496116_0001837_8868_9761 294
135 3300048919 Ga0496116_0002674 Ga0496116_0002674_16193_17239 294
136 3300048922 Ga0496119_0000338 Ga0496119_0000338_62198_63091 294
137 3300048923 Ga0496120_0000707 Ga0496120_0000707_10019_10912 294
138 3300048924 Ga0496121_0006948 Ga0496121_0006948_229_1122 294
139 3300048924 Ga0496121_0073457 Ga0496121_0073457_633_1526 294
140 3300048925 Ga0496122_0040390 Ga0496122_0040390_1964_2857 294
141 3300048925 Ga0496122_0081893 Ga0496122_0081893_714_1607 294
142 3300048926 Ga0496123_0047566 Ga0496123_0047566_668_1561 294
143 3300048926 Ga0496123_0084067 Ga0496123_0084067_481_1374 294
144 3300048927 Ga0496124_0015601 Ga0496124_0015601_4627_5520 294
145 3300048927 Ga0496124_0021704 Ga0496124_0021704_3511_4404 294
146 3300048927 Ga0496124_0150740 Ga0496124_0150740_225_1118 294
147 3300048928 Ga0496125_0003018 Ga0496125_0003018_807_1700 294
148 3300048928 Ga0496125_0104002 Ga0496125_0104002_768_1661 294
149 3300048929 Ga0496126_0000532 Ga0496126_0000532_62762_63655 294
150 3300049652 Ga0501202_011706 Ga0501202_011706_590_1564 294
151 3300053161 Ga0500634_0000195 Ga0500634_0000195_6282_7220 294
152 iso_pu_bacteria 2852684882 2852689230 294
153 iso_pu_bacteria 2894414249 2894414877 294
154 iso_pu_bacteria 2929195423 2929195887 294
155 iso_pu_bacteria 8021622325 8021623189 294
156 iso_pu_bacteria 8021626552 8021629759 294
157 iso_pu_bacteria 8021648035 8021649013 294
158 3300025919 Ga0207657_10007003 Ga0207657_100070038 295
159 3300025921 Ga0207652_10224015 Ga0207652_102240153 295
160 3300026041 Ga0207639_10195328 Ga0207639_101953283 295
161 3300032004 Ga0307414_10307329 Ga0307414_103073292 295
162 3300048926 Ga0496123_0000311 Ga0496123_0000311_29971_30867 295
163 iso_pu_bacteria 2643221695 2644527896 295
164 iso_pu_bacteria 2895522137 2895523342 295
165 iso_pu_bacteria 8002869464 8002870550 295
166 3300005616 Ga0068852_100006053 Ga0068852_1000060537 296
167 3300015261 Ga0182006_1013787 Ga0182006_10137875 296
168 3300026142 Ga0207698_10000335 Ga0207698_100003357 296
169 3300041407 Ga0439447_001202 Ga0439447_001202_986_1876 296
170 3300046616 Ga0495668_0037170 Ga0495668_0037170_592_1482 296
171 iso_pu_bacteria 2848694841 2848699886 296
172 3300030731 Ga0316177_1077278 Ga0316177_10772782 297
173 3300030735 Ga0316178_1104881 Ga0316178_11048811 297
174 3300031251 Ga0265327_10002376 Ga0265327_1000237615 297
175 3300032004 Ga0307414_10140456 Ga0307414_101404562 297
176 iso_pu_bacteria 2524614729 2525557676 297
177 iso_pu_bacteria 2571042365 2572255514 297
178 iso_pu_bacteria 2627854209 2630649267 297
179 iso_pu_bacteria 2643221559 2643817874 297
180 iso_pu_bacteria 2643221586 2643937532 297
181 iso_pu_bacteria 2643221612 2644078446 297
182 iso_pu_bacteria 2643221727 2644693223 297
183 3300003856 Ga0058692_1000021 Ga0058692_1000021202 298
184 3300005331 Ga0070670_100003317 Ga0070670_1000033179 298
185 3300009011 Ga0105251_10000014 Ga0105251_1000001499 298
186 3300009148 Ga0105243_10000468 Ga0105243_1000046836 298
187 3300025294 Ga0209025_1003252 Ga0209025_100325213 298
188 3300025735 Ga0207713_1000290 Ga0207713_100029035 298
189 3300025925 Ga0207650_10013939 Ga0207650_100139393 298
190 3300025935 Ga0207709_10004409 Ga0207709_100044099 298
191 3300027312 Ga0209371_1000045 Ga0209371_100004532 298
192 3300030500 Ga0268256_1000047 Ga0268256_100004732 298
193 3300031824 Ga0307413_10000128 Ga0307413_1000012818 298
194 3300031911 Ga0307412_10211109 Ga0307412_102111092 298
195 3300032004 Ga0307414_10008312 Ga0307414_100083122 298
196 3300041404 Ga0439436_0005590 Ga0439436_0005590_2222_3118 298
197 3300041413 Ga0439465_0001148 Ga0439465_0001148_4128_5024 298
198 3300041459 Ga0451800_0601609 Ga0451800_0601609_154_1056 298
199 3300041462 Ga0451806_513008 Ga0451806_513008_310_1212 298
200 3300042004 Ga0439445_0010697 Ga0439445_0010697_1226_2122 298
201 3300042004 Ga0439445_0020406 Ga0439445_0020406_687_1583 298
202 3300042007 Ga0439449_0000107 Ga0439449_0000107_15773_16669 298
203 3300048920 Ga0496117_0001559 Ga0496117_0001559_120_1022 298
204 3300048921 Ga0496118_0137327 Ga0496118_0137327_532_1434 298
205 3300048922 Ga0496119_0001199 Ga0496119_0001199_120_1022 298
206 3300048923 Ga0496120_0000786 Ga0496120_0000786_44796_45698 298
207 3300048925 Ga0496122_0000081 Ga0496122_0000081_200500_201402 298
208 3300048926 Ga0496123_0000665 Ga0496123_0000665_29330_30232 298
209 3300048927 Ga0496124_0001667 Ga0496124_0001667_20930_21832 298
210 iso_pu_bacteria 2643221593 2643975142 298
211 iso_pu_bacteria 2818991457 2819663237 298
212 iso_pu_bacteria 2895498888 2895503408 298
213 iso_pu_bacteria 2895511927 2895518439 298
214 iso_pu_bacteria 2895525241 2895527141 298
215 iso_pu_bacteria 2941489479 2941494211 298
216 iso_pu_bacteria 2995948881 2995953996 298
217 iso_pu_bacteria 8003014200 8003017113 298
218 3300003323 rootH1_10177322 rootH1_101773223 299
219 3300025931 Ga0207644_10130312 Ga0207644_101303123 299
220 3300030731 Ga0316177_1192212 Ga0316177_11922121 299
221 3300031901 Ga0307406_10165011 Ga0307406_101650112 299
222 3300032002 Ga0307416_100531143 Ga0307416_1005311432 299
223 3300032004 Ga0307414_10062522 Ga0307414_100625222 299
224 3300032005 Ga0307411_10170413 Ga0307411_101704132 299
225 3300037312 Ga0395899_0159016 Ga0395899_0159016_609_1517 299
226 3300037418 Ga0395900_0010500 Ga0395900_0010500_7616_8524 299
227 3300037471 Ga0395905_0005032 Ga0395905_0005032_1123_2031 299
228 3300037471 Ga0395905_0005621 Ga0395905_0005621_7707_8615 299
229 3300038443 Ga0395901_0019281 Ga0395901_0019281_190_1098 299
230 3300042007 Ga0439449_0049825 Ga0439449_0049825_115_1014 299
231 3300045976 Ga0466967_0411097 Ga0466967_0411097_189_1097 299
232 3300048903 Ga0496100_0117459 Ga0496100_0117459_689_1600 299
233 3300048911 Ga0496108_0080585 Ga0496108_0080585_1013_1924 299
234 3300048912 Ga0496109_0026463 Ga0496109_0026463_3421_4332 299
235 3300048915 Ga0496112_0098069 Ga0496112_0098069_597_1508 299
236 3300048916 Ga0496113_0137375 Ga0496113_0137375_814_1725 299
237 iso_pu_bacteria 2923516293 2923516825 299
238 3300002773 JGI25152J39213_1000004 JGI25152J39213_1000004167 300
239 3300003187 JGI25151J46595_10000010 JGI25151J46595_10000010167 300
240 3300003215 JGI25153J46596_10000013 JGI25153J46596_10000013167 300
241 3300025245 Ga0207425_1000015 Ga0207425_1000015125 300
242 3300025258 Ga0209129_1000074 Ga0209129_10000746 300
243 3300025294 Ga0209025_1000002 Ga0209025_10000021023 300
244 3300025297 Ga0209758_1000003 Ga0209758_10000031030 300
245 3300025926 Ga0207659_10442211 Ga0207659_104422112 300
246 3300027665 Ga0209983_1002329 Ga0209983_10023295 300
247 3300042007 Ga0439449_0004994 Ga0439449_0004994_3894_4796 300
248 3300046537 Ga0495598_0011221 Ga0495598_0011221_530_1441 300
249 3300048914 Ga0496111_0213463 Ga0496111_0213463_164_1075 300
250 iso_pu_bacteria 2643221573 2643880039 300
251 iso_pu_bacteria 2643221720 2644662409 300
252 iso_pu_bacteria 2643221728 2644698699 300
253 3300005347 Ga0070668_100003880 Ga0070668_1000038807 301
254 3300025972 Ga0207668_10009035 Ga0207668_100090351 301
255 3300031901 Ga0307406_10007520 Ga0307406_100075206 301
256 3300031901 Ga0307406_10114851 Ga0307406_101148513 301
257 3300032002 Ga0307416_100259880 Ga0307416_1002598802 301
258 3300041494 Ga0451837_0924985 Ga0451837_0924985_1909_2829 301
259 3300041509 Ga0451843_1375814 Ga0451843_1375814_1592_2512 301
260 3300046615 Ga0495656_0011661 Ga0495656_0011661_1859_2764 301
261 3300047318 Ga0495636_0018105 Ga0495636_0018105_465_1370 301
262 3300049680 Ga0501250_012851 Ga0501250_012851_59_973 301
263 3300049682 Ga0501252_002997 Ga0501252_002997_496_1410 301
264 3300049686 Ga0501257_021778 Ga0501257_021778_557_1471 301
265 3300049763 Ga0501266_004220 Ga0501266_004220_73_987 301
266 iso_pu_bacteria 2919513703 2919513762 301
267 iso_pu_bacteria 2919675420 2919678099 301
268 3300003187 JGI25151J46595_10000127 JGI25151J46595_1000012779 302
269 3300003771 Ga0055526_1000012 Ga0055526_1000012126 302
270 3300003773 Ga0055537_1000021 Ga0055537_100002193 302
271 3300003775 Ga0055524_1000037 Ga0055524_100003770 302
272 3300003775 Ga0055524_1011793 Ga0055524_10117932 302
273 3300003781 Ga0055536_1030369 Ga0055536_10303692 302
274 3300003784 Ga0055534_1000006 Ga0055534_1000006126 302
275 3300003790 Ga0055528_1000006 Ga0055528_1000006126 302
276 3300003791 Ga0055530_10001711 Ga0055530_100017119 302
277 3300003794 Ga0055531_10012942 Ga0055531_100129422 302
278 3300005353 Ga0070669_100002554 Ga0070669_1000025545 302
279 3300015689 Ga0183360_10002 Ga0183360_10002269 302
280 3300025245 Ga0207425_1013786 Ga0207425_10137862 302
281 3300025263 Ga0209565_1000002 Ga0209565_1000002736 302
282 3300025273 Ga0209673_1000002 Ga0209673_1000002736 302
283 3300025284 Ga0209130_1013623 Ga0209130_10136233 302
284 3300025291 Ga0209675_1000002 Ga0209675_1000002736 302
285 3300025292 Ga0209676_1001538 Ga0209676_10015383 302
286 3300025292 Ga0209676_1010043 Ga0209676_10100435 302
287 3300025292 Ga0209676_1010288 Ga0209676_10102882 302
288 3300025292 Ga0209676_1012126 Ga0209676_10121262 302
289 3300025294 Ga0209025_1000021 Ga0209025_1000021449 302
290 3300025295 Ga0209564_1000004 Ga0209564_1000004737 302
291 3300025295 Ga0209564_1020123 Ga0209564_10201231 302
292 3300025297 Ga0209758_1023639 Ga0209758_10236395 302
293 3300025298 Ga0209050_1005163 Ga0209050_10051633 302
294 3300025298 Ga0209050_1010346 Ga0209050_10103465 302
295 3300025299 Ga0209256_1000004 Ga0209256_1000004737 302
296 3300025299 Ga0209256_1004958 Ga0209256_10049582 302
297 3300025299 Ga0209256_1007232 Ga0209256_10072323 302
298 3300025303 Ga0209051_1007829 Ga0209051_10078292 302
299 3300025304 Ga0209257_1000353 Ga0209257_100035320 302
300 3300025304 Ga0209257_1010752 Ga0209257_10107523 302
301 3300025304 Ga0209257_1012901 Ga0209257_10129012 302
302 3300025304 Ga0209257_1013731 Ga0209257_10137312 302
303 3300025923 Ga0207681_10003744 Ga0207681_100037449 302
304 3300031901 Ga0307406_10001011 Ga0307406_100010115 302
305 3300048924 Ga0496121_0001076 Ga0496121_0001076_2990_3901 302
306 3300049579 Ga0501043_0000916 Ga0501043_0000916_15659_16567 302
307 3300049571 Ga0501034_0000632 Ga0501034_0000632_2039_2953 303
308 2162886007 SwRhRL2b_contig_2189992 SwRhRL2b_0762.00000110 304
309 3300003775 Ga0055524_1004257 Ga0055524_10042575 304
310 3300003794 Ga0055531_10012203 Ga0055531_100122035 304
311 3300005289 Ga0065704_10001454 Ga0065704_100014545 304
312 3300006051 Ga0075364_10086068 Ga0075364_100860682 304
313 3300025273 Ga0209673_1012392 Ga0209673_10123922 304
314 3300025292 Ga0209676_1005794 Ga0209676_10057945 304
315 3300025294 Ga0209025_1001187 Ga0209025_100118725 304
316 3300025299 Ga0209256_1007491 Ga0209256_10074913 304
317 3300025304 Ga0209257_1007451 Ga0209257_10074513 304
318 3300041494 Ga0451837_1344659 Ga0451837_1344659_71_991 304
319 3300041997 Ga0439431_0028531 Ga0439431_0028531_270_1193 304
320 3300042015 Ga0439462_0013278 Ga0439462_0013278_555_1478 304
321 3300049568 Ga0501031_0017897 Ga0501031_0017897_3574_4497 304
322 3300049569 Ga0501032_0063936 Ga0501032_0063936_749_1672 304
323 3300049570 Ga0501033_0164103 Ga0501033_0164103_529_1452 304
324 3300049572 Ga0501036_0033466 Ga0501036_0033466_1284_2207 304
325 3300049573 Ga0501037_0017276 Ga0501037_0017276_1087_2010 304
326 3300049579 Ga0501043_0015093 Ga0501043_0015093_1000_1923 304
327 3300049584 Ga0501068_0057570 Ga0501068_0057570_1352_2275 304
328 3300049586 Ga0501070_0091932 Ga0501070_0091932_515_1438 304
329 3300049587 Ga0501071_0287727 Ga0501071_0287727_171_1094 304
330 3300049589 Ga0501073_0020216 Ga0501073_0020216_614_1537 304
331 3300049742 Ga0501080_0146413 Ga0501080_0146413_546_1469 304
332 3300049823 Ga0501044_0009987 Ga0501044_0009987_6473_7396 304
333 3300050491 nmdc:mga00v17_43030_c1 nmdc:mga00v17_43030_c1_1630_2550 304

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01040

UbiA

UbiA prenyltransferase family

86

343

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8604 34 295
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8203 34 295
4tq3-assembly1.cif.gz_A structure of a ubia homolog from archaeoglobus fulgidus bound to gpp and mg2+ 0.7612 20 297
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.749 16 295
4tq3-assembly1.cif.gz_A structure of a ubia homolog from archaeoglobus fulgidus bound to gpp and mg2+ 0.747 20 297
ID Description Score Start End Superfamily
af_P0AGK1_170_289_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.9954 178 294 1.20.120.1780
af_P0AGK1_170_289_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.9626 178 294 1.20.120.1780
af_P0AGK1_23_169_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9623 31 175 1.10.357.140
af_Q8I7J4_224_349_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.9566 178 294 1.20.120.1780
af_Q54U71_333_454_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.9524 181 294 1.20.120.1780
ID Description Score Start End GO Terms
AF-A0A6N8XIL8-F1-model_v4 4-hydroxybenzoate octaprenyltransferase 0.9776 150 296 GO:0005886
GO:0006744
GO:0008412
AF-A0A2E2HG50-F1-model_v4 4-hydroxybenzoate octaprenyltransferase (EC 2.5.1.39) (4-HB polyprenyltransferase) 0.9772 12 300 GO:0005886
GO:0006744
GO:0008412
AF-A0A2N2SFV7-F1-model_v4 4-hydroxybenzoate octaprenyltransferase 0.9749 139 294 GO:0005886
GO:0006744
GO:0008412
AF-A0A3S0B802-F1-model_v4 4-hydroxybenzoate octaprenyltransferase (EC 2.5.1.39) (4-HB polyprenyltransferase) 0.9741 14 299 GO:0005886
GO:0006744
GO:0008412
AF-A0A1I4Z5W7-F1-model_v4 4-hydroxybenzoate octaprenyltransferase (EC 2.5.1.39) (4-HB polyprenyltransferase) 0.974 14 296 GO:0005886
GO:0006744
GO:0008412

Feature Viewer

pLDDT pTM Quality
91.15 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map