F411674
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 334 | 178 | 333 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300005455|Ga0070663_100308436|Ga0070663_1003084362 |
| Length | 183 |
| Sequence | MRSDIIPGGTFPDYALPDHTGIVRRLSELQGRDPLILMLSRGHYCPKEHQQHHDLAAFQSKVAVAYTQMVTISTDTFLSDPGRTVQQDLDIAEYTDPDHNPMIPHTLVLKPGLLIHSIYNGYWFWGRPSVDDLWRDLRAAAAEIRPDWDLDAPGLRQAWVAGDHSKFHGWDRHTGPPLATQGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 21 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 22 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 23 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 24 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 25 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 26 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 29 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 30 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 31 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 67 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 68 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 69 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 70 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 71 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 72 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 73 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 74 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 75 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 76 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 77 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 78 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 79 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 80 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 81 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 82 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 83 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 84 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 85 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 86 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 87 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 88 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 89 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 90 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 91 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 92 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 93 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 94 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 95 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 96 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 97 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 98 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 99 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 100 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 101 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 102 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 103 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 104 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 105 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 106 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 107 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 108 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 109 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 110 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 111 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 112 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 113 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 114 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 115 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 116 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 117 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 118 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 119 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 120 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 121 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 122 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 123 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 167 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 168 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 170 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 171 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 172 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.8 |
| Metatranscriptomes | 0.9 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.3 |
| Nodule | 0 |
| Rhizoplane | 5.39 |
| Rhizosphere | 90.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10070540 | 3300005328 | Bacteria | 2096 |
| 2 | Ga0068869_100570728 | 3300005334 | Bacteria | 953 |
| 3 | Ga0070682_100330419 | 3300005337 | Bacteria | 1129 |
| 4 | Ga0070688_100076051 | 3300005365 | Bacteria | 2160 |
| 5 | Ga0070709_10229941 | 3300005434 | Bacteria | 1326 |
| 6 | Ga0070714_100011043 | 3300005435 | Bacteria | 7155 |
| 7 | Ga0070714_100019153 | 3300005435 | Bacteria | 5571 |
| 8 | Ga0070713_100026545 | 3300005436 | Bacteria | 4549 |
| 9 | Ga0070710_10343085 | 3300005437 | Bacteria | 987 |
| 10 | Ga0070710_10519378 | 3300005437 | Bacteria | 818 |
| 11 | Ga0070711_100290935 | 3300005439 | Bacteria | 1296 |
| 12 | Ga0070700_100051987 | 3300005441 | Bacteria | 2553 |
| 13 | Ga0070663_100308436 | 3300005455 | Bacteria | 1269 |
| 14 | Ga0070678_100104338 | 3300005456 | Bacteria | 2204 |
| 15 | Ga0070685_10283043 | 3300005466 | Bacteria | 1111 |
| 16 | Ga0070706_100080615 | 3300005467 | Bacteria | 3014 |
| 17 | Ga0070706_100429326 | 3300005467 | Bacteria | 1230 |
| 18 | Ga0070698_100126267 | 3300005471 | Bacteria | 2515 |
| 19 | Ga0070698_100642808 | 3300005471 | Bacteria | 1002 |
| 20 | Ga0070684_100145658 | 3300005535 | Bacteria | 2144 |
| 21 | Ga0070672_100747232 | 3300005543 | Bacteria | 858 |
| 22 | Ga0070665_100434068 | 3300005548 | Bacteria | 1323 |
| 23 | Ga0068852_100005066 | 3300005616 | Bacteria | 9377 |
| 24 | Ga0068852_100092008 | 3300005616 | Bacteria | 2715 |
| 25 | Ga0068864_100329572 | 3300005618 | Bacteria | 1436 |
| 26 | Ga0068863_100056657 | 3300005841 | Bacteria | 3710 |
| 27 | Ga0068863_100677133 | 3300005841 | Bacteria | 1024 |
| 28 | Ga0068860_100063510 | 3300005843 | Bacteria | 3507 |
| 29 | Ga0068860_100212755 | 3300005843 | Bacteria | 1876 |
| 30 | Ga0081455_10297095 | 3300005937 | Bacteria | 1160 |
| 31 | Ga0081539_10049620 | 3300005985 | Bacteria | 2380 |
| 32 | Ga0070717_10100409 | 3300006028 | Bacteria | 2457 |
| 33 | Ga0070717_10714455 | 3300006028 | Bacteria | 911 |
| 34 | Ga0070712_100082593 | 3300006175 | Bacteria | 2331 |
| 35 | Ga0075428_100000355 | 3300006844 | Bacteria | 45446 |
| 36 | Ga0075428_100668110 | 3300006844 | Bacteria | 1107 |
| 37 | Ga0075430_100160258 | 3300006846 | Bacteria | 1873 |
| 38 | Ga0075431_100150026 | 3300006847 | Bacteria | 2401 |
| 39 | Ga0111539_10520053 | 3300009094 | Bacteria | 1386 |
| 40 | Ga0105245_10266856 | 3300009098 | Bacteria | 1668 |
| 41 | Ga0105245_10402183 | 3300009098 | Bacteria | 1369 |
| 42 | Ga0105247_10216555 | 3300009101 | Bacteria | 1294 |
| 43 | Ga0105243_10077619 | 3300009148 | Bacteria | 2702 |
| 44 | Ga0105248_10843247 | 3300009177 | Bacteria | 1034 |
| 45 | Ga0105237_11346116 | 3300009545 | Bacteria | 720 |
| 46 | Ga0105239_10194782 | 3300010375 | Bacteria | 2269 |
| 47 | Ga0105239_11779779 | 3300010375 | Bacteria | 714 |
| 48 | Ga0105246_10727076 | 3300011119 | Bacteria | 873 |
| 49 | Ga0157370_10480558 | 3300013104 | Bacteria | 1142 |
| 50 | Ga0157369_10231284 | 3300013105 | Bacteria | 1933 |
| 51 | Ga0163162_10360132 | 3300013306 | Bacteria | 1588 |
| 52 | Ga0157372_10000006 | 3300013307 | Bacteria | 354669 |
| 53 | Ga0157372_10381424 | 3300013307 | Bacteria | 1642 |
| 54 | Ga0157372_10892013 | 3300013307 | Bacteria | 1032 |
| 55 | Ga0157375_10568553 | 3300013308 | Bacteria | 1294 |
| 56 | Ga0157375_10803406 | 3300013308 | Bacteria | 1089 |
| 57 | Ga0157375_10813643 | 3300013308 | Bacteria | 1082 |
| 58 | Ga0163163_10865879 | 3300014325 | Bacteria | 967 |
| 59 | Ga0157376_10027903 | 3300014969 | Bacteria | 4481 |
| 60 | Ga0207684_10239921 | 3300025910 | Bacteria | 1564 |
| 61 | Ga0207695_10613289 | 3300025913 | Bacteria | 969 |
| 62 | Ga0207671_10192013 | 3300025914 | Bacteria | 1593 |
| 63 | Ga0207694_10751277 | 3300025924 | Bacteria | 823 |
| 64 | Ga0207687_10381699 | 3300025927 | Bacteria | 1155 |
| 65 | Ga0207687_10597808 | 3300025927 | Bacteria | 929 |
| 66 | Ga0207700_10026159 | 3300025928 | Bacteria | 4065 |
| 67 | Ga0207700_10034984 | 3300025928 | Bacteria | 3613 |
| 68 | Ga0207700_10094307 | 3300025928 | Bacteria | 2371 |
| 69 | Ga0207700_10942075 | 3300025928 | Bacteria | 773 |
| 70 | Ga0207686_10480066 | 3300025934 | Bacteria | 961 |
| 71 | Ga0207709_10043704 | 3300025935 | Bacteria | 2702 |
| 72 | Ga0207670_10430374 | 3300025936 | Bacteria | 1060 |
| 73 | Ga0207691_10387061 | 3300025940 | Unclassified | 1193 |
| 74 | Ga0207689_10415714 | 3300025942 | Bacteria | 1122 |
| 75 | Ga0207651_10358616 | 3300025960 | Bacteria | 1230 |
| 76 | Ga0207651_10490738 | 3300025960 | Bacteria | 1060 |
| 77 | Ga0207678_10053512 | 3300026067 | Bacteria | 3478 |
| 78 | Ga0207678_10772190 | 3300026067 | Bacteria | 848 |
| 79 | Ga0207708_10075087 | 3300026075 | Bacteria | 2592 |
| 80 | Ga0207641_10521415 | 3300026088 | Bacteria | 1156 |
| 81 | Ga0207676_10034862 | 3300026095 | Bacteria | 3813 |
| 82 | Ga0207683_10012703 | 3300026121 | Bacteria | 7184 |
| 83 | Ga0207683_10362299 | 3300026121 | Bacteria | 1331 |
| 84 | Ga0207698_10565845 | 3300026142 | Bacteria | 1116 |
| 85 | Ga0268266_10281816 | 3300028379 | Bacteria | 1546 |
| 86 | Ga0268266_10320233 | 3300028379 | Bacteria | 1451 |
| 87 | Ga0268266_10539566 | 3300028379 | Bacteria | 1116 |
| 88 | Ga0268264_10074197 | 3300028381 | Bacteria | 2889 |
| 89 | Ga0268264_10306150 | 3300028381 | Bacteria | 1497 |
| 90 | Ga0265336_10008047 | 3300028666 | Bacteria | 3718 |
| 91 | Ga0265338_10000522 | 3300028800 | Bacteria | 67694 |
| 92 | Ga0265338_10318944 | 3300028800 | Unclassified | 1125 |
| 93 | Ga0265775_102590 | 3300030762 | Bacteria | 942 |
| 94 | Ga0307513_10002041 | 3300031456 | Bacteria | 28396 |
| 95 | Ga0307513_10350462 | 3300031456 | Bacteria | 1224 |
| 96 | Ga0307509_10614924 | 3300031507 | Bacteria | 758 |
| 97 | Ga0307408_100264325 | 3300031548 | Bacteria | 1426 |
| 98 | Ga0307508_10042105 | 3300031616 | Bacteria | 4098 |
| 99 | Ga0307413_10060446 | 3300031824 | Bacteria | 2333 |
| 100 | Ga0307410_10025094 | 3300031852 | Bacteria | 3734 |
| 101 | Ga0307406_10178497 | 3300031901 | Bacteria | 1544 |
| 102 | Ga0307406_10202830 | 3300031901 | Bacteria | 1461 |
| 103 | Ga0307406_10381871 | 3300031901 | Bacteria | 1111 |
| 104 | Ga0307407_10124970 | 3300031903 | Bacteria | 1637 |
| 105 | Ga0307409_100031288 | 3300031995 | Bacteria | 3838 |
| 106 | Ga0307409_100271796 | 3300031995 | Bacteria | 1561 |
| 107 | Ga0307409_100288308 | 3300031995 | Bacteria | 1521 |
| 108 | Ga0307409_100401165 | 3300031995 | Bacteria | 1310 |
| 109 | Ga0307416_100017061 | 3300032002 | Bacteria | 5067 |
| 110 | Ga0307416_100496550 | 3300032002 | Bacteria | 1284 |
| 111 | Ga0307414_10441068 | 3300032004 | Bacteria | 1140 |
| 112 | Ga0307411_10777620 | 3300032005 | Bacteria | 841 |
| 113 | Ga0307415_100063569 | 3300032126 | Bacteria | 2565 |
| 114 | Ga0307415_100075556 | 3300032126 | Bacteria | 2385 |
| 115 | Ga0373926_0000555 | 3300035083 | Bacteria | 10045 |
| 116 | Ga0373934_0000104 | 3300035086 | Bacteria | 29933 |
| 117 | Ga0373944_0049707 | 3300035089 | Bacteria | 1318 |
| 118 | Ga0373923_0009433 | 3300035111 | Bacteria | 3521 |
| 119 | Ga0373936_0000556 | 3300035113 | Bacteria | 12798 |
| 120 | Ga0373936_0070117 | 3300035113 | Bacteria | 1443 |
| 121 | Ga0373945_0000344 | 3300035116 | Bacteria | 13286 |
| 122 | Ga0373953_0000507 | 3300035117 | Bacteria | 10840 |
| 123 | Ga0373953_0122864 | 3300035117 | Bacteria | 1103 |
| 124 | Ga0373954_0010317 | 3300035118 | Bacteria | 4121 |
| 125 | Ga0373954_0024814 | 3300035118 | Bacteria | 2735 |
| 126 | Ga0373956_0003149 | 3300035119 | Bacteria | 6672 |
| 127 | Ga0373957_0000034 | 3300035120 | Bacteria | 35486 |
| 128 | Ga0373957_0022842 | 3300035120 | Bacteria | 2231 |
| 129 | Ga0373943_0000096 | 3300035170 | Bacteria | 32386 |
| 130 | Ga0373943_0105407 | 3300035170 | Bacteria | 1480 |
| 131 | Ga0373946_0009619 | 3300035171 | Bacteria | 3565 |
| 132 | Ga0373946_0175103 | 3300035171 | Bacteria | 1015 |
| 133 | Ga0373955_0000928 | 3300035172 | Bacteria | 12573 |
| 134 | Ga0373955_0011299 | 3300035172 | Bacteria | 4249 |
| 135 | Ga0373955_0048528 | 3300035172 | Bacteria | 2302 |
| 136 | Ga0373924_0009695 | 3300035410 | Bacteria | 3538 |
| 137 | Ga0373924_0090936 | 3300035410 | Bacteria | 1305 |
| 138 | Ga0373935_0001117 | 3300035692 | Bacteria | 14635 |
| 139 | Ga0373927_0003277 | 3300035695 | Bacteria | 11645 |
| 140 | Ga0373927_0190484 | 3300035695 | Bacteria | 1346 |
| 141 | Ga0373927_0306889 | 3300035695 | Bacteria | 1045 |
| 142 | Ga0373933_0000230 | 3300035724 | Bacteria | 37223 |
| 143 | Ga0373933_0053343 | 3300035724 | Bacteria | 2422 |
| 144 | Ga0373933_0087720 | 3300035724 | Bacteria | 1916 |
| 145 | Ga0373947_0000450 | 3300035725 | Bacteria | 23417 |
| 146 | Ga0373947_0087972 | 3300035725 | Bacteria | 1933 |
| 147 | Ga0373947_0105398 | 3300035725 | Bacteria | 1776 |
| 148 | Ga0373937_0000010 | 3300036401 | Bacteria | 163001 |
| 149 | Ga0373937_0023500 | 3300036401 | Bacteria | 5551 |
| 150 | Ga0373937_0119957 | 3300036401 | Bacteria | 2450 |
| 151 | Ga0373937_0260805 | 3300036401 | Bacteria | 1634 |
| 152 | Ga0373925_0015390 | 3300037068 | Bacteria | 5529 |
| 153 | Ga0373925_0113558 | 3300037068 | Bacteria | 2095 |
| 154 | Ga0395900_0407748 | 3300037418 | Bacteria | 1322 |
| 155 | Ga0395898_0003436 | 3300037466 | Bacteria | 17717 |
| 156 | Ga0395905_0090105 | 3300037471 | Bacteria | 2875 |
| 157 | Ga0436364_0797116 | 3300037853 | Bacteria | 7644 |
| 158 | Ga0436364_1044436 | 3300037853 | Bacteria | 1963 |
| 159 | Ga0395901_0009032 | 3300038443 | Bacteria | 10091 |
| 160 | Ga0395901_0048305 | 3300038443 | Bacteria | 4419 |
| 161 | Ga0436365_0085734 | 3300039437 | Bacteria | 3102 |
| 162 | Ga0436363_1021360 | 3300039450 | Bacteria | 1196 |
| 163 | Ga0436362_0346627 | 3300039453 | Bacteria | 688 |
| 164 | Ga0451787_108881 | 3300041441 | Bacteria | 2029 |
| 165 | Ga0451791_0347104 | 3300041451 | Bacteria | 3231 |
| 166 | Ga0451793_0046820 | 3300041452 | Bacteria | 4702 |
| 167 | Ga0451797_0152092 | 3300041453 | Bacteria | 7806 |
| 168 | Ga0451795_0988715 | 3300041456 | Bacteria | 4498 |
| 169 | Ga0451802_0683453 | 3300041460 | Bacteria | 2004 |
| 170 | Ga0451837_1108925 | 3300041494 | Bacteria | 3179 |
| 171 | Ga0451839_0663846 | 3300041496 | Bacteria | 1379 |
| 172 | Ga0451847_0824435 | 3300041503 | Bacteria | 723 |
| 173 | Ga0451849_1563122 | 3300041505 | Bacteria | 2423 |
| 174 | Ga0451843_1339351 | 3300041509 | Bacteria | 1065 |
| 175 | Ga0466963_0320877 | 3300044694 | Bacteria | 1090 |
| 176 | Ga0466960_0000079 | 3300044901 | Bacteria | 31870 |
| 177 | Ga0495592_0000225 | 3300046454 | Bacteria | 48726 |
| 178 | Ga0495592_0036046 | 3300046454 | Bacteria | 3726 |
| 179 | Ga0495592_0046368 | 3300046454 | Bacteria | 3240 |
| 180 | Ga0495592_0064767 | 3300046454 | Bacteria | 2677 |
| 181 | Ga0495629_0002801 | 3300046459 | Bacteria | 13294 |
| 182 | Ga0495629_0179670 | 3300046459 | Bacteria | 1467 |
| 183 | Ga0495641_0006742 | 3300046461 | Bacteria | 7370 |
| 184 | Ga0495641_0042115 | 3300046461 | Bacteria | 2118 |
| 185 | Ga0495641_0109559 | 3300046461 | Bacteria | 1232 |
| 186 | Ga0495651_0000166 | 3300046462 | Bacteria | 48436 |
| 187 | Ga0495651_0006403 | 3300046462 | Bacteria | 9009 |
| 188 | Ga0495651_0016424 | 3300046462 | Bacteria | 5733 |
| 189 | Ga0495651_0033536 | 3300046462 | Bacteria | 4004 |
| 190 | Ga0495651_0040931 | 3300046462 | Bacteria | 3600 |
| 191 | Ga0495653_0015392 | 3300046463 | Bacteria | 6234 |
| 192 | Ga0495653_0025502 | 3300046463 | Bacteria | 4749 |
| 193 | Ga0495653_0308295 | 3300046463 | Bacteria | 1030 |
| 194 | Ga0495582_0017634 | 3300046473 | Bacteria | 3906 |
| 195 | Ga0495582_0018308 | 3300046473 | Bacteria | 3832 |
| 196 | Ga0495639_0025760 | 3300046475 | Bacteria | 2595 |
| 197 | Ga0495639_0103452 | 3300046475 | Bacteria | 1346 |
| 198 | Ga0495662_0003771 | 3300046476 | Bacteria | 7644 |
| 199 | Ga0495662_0098290 | 3300046476 | Bacteria | 1431 |
| 200 | Ga0495664_0000542 | 3300046477 | Bacteria | 18993 |
| 201 | Ga0495664_0018238 | 3300046477 | Bacteria | 4017 |
| 202 | Ga0495594_0020733 | 3300046499 | Bacteria | 3503 |
| 203 | Ga0495594_0234913 | 3300046499 | Bacteria | 1045 |
| 204 | Ga0495608_0000292 | 3300046511 | Bacteria | 35120 |
| 205 | Ga0495608_0011223 | 3300046511 | Bacteria | 6236 |
| 206 | Ga0495608_0013553 | 3300046511 | Bacteria | 5654 |
| 207 | Ga0495608_0049512 | 3300046511 | Bacteria | 2789 |
| 208 | Ga0495608_0213806 | 3300046511 | Bacteria | 1211 |
| 209 | Ga0495618_0008502 | 3300046514 | Bacteria | 6207 |
| 210 | Ga0495618_0065801 | 3300046514 | Bacteria | 2303 |
| 211 | Ga0495618_0440019 | 3300046514 | Bacteria | 792 |
| 212 | Ga0495628_0000535 | 3300046516 | Bacteria | 34786 |
| 213 | Ga0495628_0027226 | 3300046516 | Bacteria | 4654 |
| 214 | Ga0495628_0055673 | 3300046516 | Bacteria | 3115 |
| 215 | Ga0495628_0197609 | 3300046516 | Bacteria | 1516 |
| 216 | Ga0495628_0620756 | 3300046516 | Bacteria | 770 |
| 217 | Ga0495630_0030463 | 3300046517 | Bacteria | 4013 |
| 218 | Ga0495630_0054124 | 3300046517 | Bacteria | 3006 |
| 219 | Ga0495630_0263562 | 3300046517 | Bacteria | 1316 |
| 220 | Ga0495666_0035603 | 3300046526 | Bacteria | 2427 |
| 221 | Ga0495666_0199973 | 3300046526 | Bacteria | 919 |
| 222 | Ga0495652_0001880 | 3300046529 | Bacteria | 22338 |
| 223 | Ga0495652_0018143 | 3300046529 | Bacteria | 6280 |
| 224 | Ga0495652_0097874 | 3300046529 | Bacteria | 2385 |
| 225 | Ga0495665_0036346 | 3300046531 | Bacteria | 2630 |
| 226 | Ga0495665_0246763 | 3300046531 | Bacteria | 920 |
| 227 | Ga0495640_0030926 | 3300046533 | Bacteria | 3827 |
| 228 | Ga0495586_0055675 | 3300046535 | Bacteria | 2143 |
| 229 | Ga0495587_0000294 | 3300046536 | Bacteria | 35500 |
| 230 | Ga0495587_0085850 | 3300046536 | Bacteria | 1822 |
| 231 | Ga0495587_0141043 | 3300046536 | Bacteria | 1375 |
| 232 | Ga0495587_0378065 | 3300046536 | Bacteria | 788 |
| 233 | Ga0495645_0028207 | 3300046543 | Bacteria | 4078 |
| 234 | Ga0495645_0107605 | 3300046543 | Bacteria | 1976 |
| 235 | Ga0495645_0133382 | 3300046543 | Bacteria | 1739 |
| 236 | Ga0495645_0143012 | 3300046543 | Bacteria | 1667 |
| 237 | Ga0495645_0173888 | 3300046543 | Bacteria | 1480 |
| 238 | Ga0495645_0325914 | 3300046543 | Bacteria | 996 |
| 239 | Ga0495622_0136066 | 3300046557 | Bacteria | 1117 |
| 240 | Ga0495667_0000064 | 3300046559 | Bacteria | 89628 |
| 241 | Ga0495667_0010691 | 3300046559 | Bacteria | 6206 |
| 242 | Ga0495667_0016533 | 3300046559 | Bacteria | 4983 |
| 243 | Ga0495667_0034323 | 3300046559 | Bacteria | 3392 |
| 244 | Ga0495634_0013531 | 3300046642 | Bacteria | 5894 |
| 245 | Ga0495635_0001583 | 3300046663 | Bacteria | 15304 |
| 246 | Ga0495635_0036829 | 3300046663 | Bacteria | 3388 |
| 247 | Ga0495635_0216141 | 3300046663 | Bacteria | 1297 |
| 248 | Ga0495657_0002352 | 3300046675 | Bacteria | 15904 |
| 249 | Ga0495657_0350615 | 3300046675 | Bacteria | 873 |
| 250 | Ga0495599_0000179 | 3300046678 | Bacteria | 41497 |
| 251 | Ga0495599_0014964 | 3300046678 | Bacteria | 4808 |
| 252 | Ga0495599_0038118 | 3300046678 | Bacteria | 3019 |
| 253 | Ga0495599_0190377 | 3300046678 | Bacteria | 1262 |
| 254 | Ga0495623_0029880 | 3300046679 | Bacteria | 3506 |
| 255 | Ga0495623_0035524 | 3300046679 | Bacteria | 3194 |
| 256 | Ga0495623_0092378 | 3300046679 | Bacteria | 1855 |
| 257 | Ga0495646_0016519 | 3300046680 | Bacteria | 4685 |
| 258 | Ga0495646_0017759 | 3300046680 | Bacteria | 4510 |
| 259 | Ga0495646_0045595 | 3300046680 | Bacteria | 2677 |
| 260 | Ga0495646_0301190 | 3300046680 | Bacteria | 848 |
| 261 | Ga0495613_0016929 | 3300046689 | Bacteria | 5428 |
| 262 | Ga0495624_0001511 | 3300046690 | Bacteria | 18030 |
| 263 | Ga0495624_0025498 | 3300046690 | Bacteria | 3880 |
| 264 | Ga0495624_0187619 | 3300046690 | Bacteria | 1258 |
| 265 | Ga0495600_0007298 | 3300046809 | Bacteria | 6756 |
| 266 | Ga0495600_0048204 | 3300046809 | Bacteria | 2779 |
| 267 | Ga0495600_0055409 | 3300046809 | Bacteria | 2589 |
| 268 | Ga0495600_0096753 | 3300046809 | Bacteria | 1924 |
| 269 | Ga0495600_0183012 | 3300046809 | Bacteria | 1350 |
| 270 | Ga0495581_0022148 | 3300047315 | Bacteria | 3682 |
| 271 | Ga0495581_0575853 | 3300047315 | Bacteria | 653 |
| 272 | Ga0495604_0000245 | 3300047317 | Bacteria | 48436 |
| 273 | Ga0495604_0042814 | 3300047317 | Bacteria | 3546 |
| 274 | Ga0495604_0136889 | 3300047317 | Bacteria | 1754 |
| 275 | Ga0495604_0195150 | 3300047317 | Bacteria | 1408 |
| 276 | Ga0495604_0227329 | 3300047317 | Bacteria | 1282 |
| 277 | Ga0495674_0001396 | 3300047319 | Bacteria | 23606 |
| 278 | Ga0495674_0069301 | 3300047319 | Bacteria | 3050 |
| 279 | Ga0495674_0141644 | 3300047319 | Bacteria | 2021 |
| 280 | Ga0495674_0367873 | 3300047319 | Bacteria | 1165 |
| 281 | Ga0495674_0470269 | 3300047319 | Bacteria | 1008 |
| 282 | Ga0495676_0003980 | 3300047321 | Bacteria | 13450 |
| 283 | Ga0495676_0271974 | 3300047321 | Bacteria | 1149 |
| 284 | Ga0495680_0004678 | 3300047322 | Bacteria | 13041 |
| 285 | Ga0495680_0009346 | 3300047322 | Bacteria | 8825 |
| 286 | Ga0495680_0091366 | 3300047322 | Bacteria | 2282 |
| 287 | Ga0495680_0092091 | 3300047322 | Bacteria | 2271 |
| 288 | Ga0495680_0094319 | 3300047322 | Bacteria | 2239 |
| 289 | Ga0495680_0226510 | 3300047322 | Bacteria | 1332 |
| 290 | Ga0495675_0146443 | 3300047444 | Bacteria | 1461 |
| 291 | Ga0495675_0277890 | 3300047444 | Bacteria | 999 |
| 292 | Ga0495684_0007161 | 3300047471 | Bacteria | 8660 |
| 293 | Ga0495684_0007262 | 3300047471 | Bacteria | 8593 |
| 294 | Ga0495684_0100014 | 3300047471 | Bacteria | 2192 |
| 295 | Ga0495593_0042249 | 3300047673 | Bacteria | 2447 |
| 296 | Ga0495593_0071697 | 3300047673 | Bacteria | 1799 |
| 297 | Ga0495602_0129442 | 3300048088 | Bacteria | 2016 |
| 298 | Ga0495602_0303184 | 3300048088 | Bacteria | 1168 |
| 299 | Ga0495614_0019379 | 3300048089 | Bacteria | 2943 |
| 300 | Ga0496100_0367345 | 3300048903 | Bacteria | 1090 |
| 301 | Ga0496105_0461321 | 3300048908 | Bacteria | 1002 |
| 302 | Ga0496106_0079053 | 3300048909 | Bacteria | 2525 |
| 303 | Ga0496106_0152751 | 3300048909 | Bacteria | 1822 |
| 304 | Ga0496109_0303810 | 3300048912 | Bacteria | 1505 |
| 305 | Ga0496109_0485733 | 3300048912 | Bacteria | 1166 |
| 306 | Ga0496109_0672880 | 3300048912 | Bacteria | 972 |
| 307 | Ga0496109_0834807 | 3300048912 | Bacteria | 859 |
| 308 | Ga0496111_0202693 | 3300048914 | Bacteria | 1475 |
| 309 | Ga0496111_0458868 | 3300048914 | Bacteria | 940 |
| 310 | Ga0496114_0058703 | 3300048917 | Bacteria | 3213 |
| 311 | Ga0496114_0166914 | 3300048917 | Bacteria | 1917 |
| 312 | nmdc:mga06z11_68615_c1 | 3300050494 | Unclassified | 1869 |
| 313 | nmdc:mga0qj67_148450_c1 | 3300050509 | Bacteria | 1901 |
| 314 | Ga0495601_0003188 | 3300053077 | Bacteria | 9389 |
| 315 | Ga0495601_0005692 | 3300053077 | Bacteria | 7261 |
| 316 | Ga0495601_0021402 | 3300053077 | Bacteria | 3960 |
| 317 | Ga0495601_0207047 | 3300053077 | Bacteria | 1281 |
| 318 | Ga0495612_0000359 | 3300053078 | Bacteria | 18494 |
| 319 | Ga0495612_0006774 | 3300053078 | Bacteria | 4693 |
| 320 | Ga0495612_0147090 | 3300053078 | Bacteria | 1024 |
| 321 | Ga0495595_0005396 | 3300053084 | Bacteria | 5180 |
| 322 | Ga0495595_0006788 | 3300053084 | Bacteria | 4672 |
| 323 | Ga0495595_0082836 | 3300053084 | Bacteria | 1530 |
| 324 | Ga0495595_0101560 | 3300053084 | Bacteria | 1389 |
| 325 | Ga0495619_0013425 | 3300053085 | Bacteria | 5161 |
| 326 | Ga0495619_0081168 | 3300053085 | Bacteria | 2183 |
| 327 | Ga0495619_0091840 | 3300053085 | Bacteria | 2056 |
| 328 | Ga0495619_0112617 | 3300053085 | Bacteria | 1860 |
| 329 | Ga0495619_0122335 | 3300053085 | Bacteria | 1784 |
| 330 | Ga0495619_0203432 | 3300053085 | Bacteria | 1371 |
| 331 | Ga0495619_0441188 | 3300053085 | Bacteria | 898 |
| 332 | Ga0587073_0007340 | 3300059492 | Bacteria | 1738 |
| 333 | Ga0587090_013854 | 3300059510 | Bacteria | 1172 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005434 | Ga0070709_10229941 | Ga0070709_102299412 | 158 |
| 2 | 3300025940 | Ga0207691_10387061 | Ga0207691_103870611 | 158 |
| 3 | 3300006028 | Ga0070717_10714455 | Ga0070717_107144551 | 159 |
| 4 | 3300046543 | Ga0495645_0133382 | Ga0495645_0133382_159_752 | 161 |
| 5 | 3300041503 | Ga0451847_0824435 | Ga0451847_0824435_100_693 | 162 |
| 6 | 3300005437 | Ga0070710_10343085 | Ga0070710_103430852 | 164 |
| 7 | 3300005439 | Ga0070711_100290935 | Ga0070711_1002909352 | 164 |
| 8 | 3300025928 | Ga0207700_10034984 | Ga0207700_100349844 | 164 |
| 9 | 3300035083 | Ga0373926_0000555 | Ga0373926_0000555_4645_5196 | 165 |
| 10 | 3300035089 | Ga0373944_0049707 | Ga0373944_0049707_540_1091 | 165 |
| 11 | 3300035111 | Ga0373923_0009433 | Ga0373923_0009433_443_994 | 165 |
| 12 | 3300035113 | Ga0373936_0000556 | Ga0373936_0000556_8037_8588 | 165 |
| 13 | 3300035116 | Ga0373945_0000344 | Ga0373945_0000344_8065_8616 | 165 |
| 14 | 3300035170 | Ga0373943_0000096 | Ga0373943_0000096_14376_14927 | 165 |
| 15 | 3300035171 | Ga0373946_0009619 | Ga0373946_0009619_421_972 | 165 |
| 16 | 3300035692 | Ga0373935_0001117 | Ga0373935_0001117_5870_6421 | 165 |
| 17 | 3300035695 | Ga0373927_0003277 | Ga0373927_0003277_1447_1998 | 165 |
| 18 | 3300035724 | Ga0373933_0053343 | Ga0373933_0053343_1318_1869 | 165 |
| 19 | 3300035725 | Ga0373947_0000450 | Ga0373947_0000450_8039_8590 | 165 |
| 20 | 3300036401 | Ga0373937_0260805 | Ga0373937_0260805_844_1395 | 165 |
| 21 | 3300046461 | Ga0495641_0006742 | Ga0495641_0006742_3462_4013 | 165 |
| 22 | 3300046462 | Ga0495651_0033536 | Ga0495651_0033536_987_1538 | 165 |
| 23 | 3300046463 | Ga0495653_0025502 | Ga0495653_0025502_228_779 | 165 |
| 24 | 3300046473 | Ga0495582_0018308 | Ga0495582_0018308_675_1226 | 165 |
| 25 | 3300046475 | Ga0495639_0103452 | Ga0495639_0103452_430_981 | 165 |
| 26 | 3300046476 | Ga0495662_0098290 | Ga0495662_0098290_420_971 | 165 |
| 27 | 3300046477 | Ga0495664_0000542 | Ga0495664_0000542_481_1032 | 165 |
| 28 | 3300046511 | Ga0495608_0011223 | Ga0495608_0011223_4426_4977 | 165 |
| 29 | 3300046514 | Ga0495618_0008502 | Ga0495618_0008502_1939_2490 | 165 |
| 30 | 3300046517 | Ga0495630_0054124 | Ga0495630_0054124_1824_2375 | 165 |
| 31 | 3300046529 | Ga0495652_0018143 | Ga0495652_0018143_993_1544 | 165 |
| 32 | 3300046531 | Ga0495665_0036346 | Ga0495665_0036346_1977_2528 | 165 |
| 33 | 3300046543 | Ga0495645_0173888 | Ga0495645_0173888_525_1076 | 165 |
| 34 | 3300046559 | Ga0495667_0034323 | Ga0495667_0034323_843_1394 | 165 |
| 35 | 3300046663 | Ga0495635_0001583 | Ga0495635_0001583_8210_8761 | 165 |
| 36 | 3300046678 | Ga0495599_0014964 | Ga0495599_0014964_1684_2235 | 165 |
| 37 | 3300046690 | Ga0495624_0001511 | Ga0495624_0001511_897_1448 | 165 |
| 38 | 3300046809 | Ga0495600_0007298 | Ga0495600_0007298_1226_1777 | 165 |
| 39 | 3300047315 | Ga0495581_0575853 | Ga0495581_0575853_87_635 | 165 |
| 40 | 3300047319 | Ga0495674_0001396 | Ga0495674_0001396_8065_8616 | 165 |
| 41 | 3300047321 | Ga0495676_0003980 | Ga0495676_0003980_8057_8608 | 165 |
| 42 | 3300047322 | Ga0495680_0004678 | Ga0495680_0004678_8015_8566 | 165 |
| 43 | 3300047471 | Ga0495684_0007262 | Ga0495684_0007262_2382_2933 | 165 |
| 44 | 3300047673 | Ga0495593_0071697 | Ga0495593_0071697_663_1214 | 165 |
| 45 | 3300036401 | Ga0373937_0023500 | Ga0373937_0023500_1765_2358 | 168 |
| 46 | 3300046462 | Ga0495651_0016424 | Ga0495651_0016424_3842_4435 | 168 |
| 47 | 3300046511 | Ga0495608_0213806 | Ga0495608_0213806_424_1017 | 168 |
| 48 | 3300046559 | Ga0495667_0016533 | Ga0495667_0016533_1259_1852 | 168 |
| 49 | 3300046675 | Ga0495657_0002352 | Ga0495657_0002352_13448_14041 | 168 |
| 50 | 3300046679 | Ga0495623_0035524 | Ga0495623_0035524_471_1064 | 168 |
| 51 | 3300046809 | Ga0495600_0055409 | Ga0495600_0055409_955_1548 | 168 |
| 52 | 3300047322 | Ga0495680_0094319 | Ga0495680_0094319_1044_1637 | 168 |
| 53 | 3300047444 | Ga0495675_0146443 | Ga0495675_0146443_457_1050 | 168 |
| 54 | 3300053085 | Ga0495619_0091840 | Ga0495619_0091840_204_797 | 168 |
| 55 | 3300053078 | Ga0495612_0000359 | Ga0495612_0000359_1514_2215 | 169 |
| 56 | 3300014325 | Ga0163163_10865879 | Ga0163163_108658792 | 170 |
| 57 | 3300031824 | Ga0307413_10060446 | Ga0307413_100604462 | 170 |
| 58 | 3300031901 | Ga0307406_10202830 | Ga0307406_102028302 | 170 |
| 59 | 3300031995 | Ga0307409_100031288 | Ga0307409_1000312884 | 170 |
| 60 | 3300032002 | Ga0307416_100017061 | Ga0307416_1000170614 | 170 |
| 61 | 3300032004 | Ga0307414_10441068 | Ga0307414_104410682 | 170 |
| 62 | 3300032005 | Ga0307411_10777620 | Ga0307411_107776202 | 170 |
| 63 | 3300032126 | Ga0307415_100063569 | Ga0307415_1000635692 | 170 |
| 64 | 3300035170 | Ga0373943_0105407 | Ga0373943_0105407_761_1363 | 170 |
| 65 | 3300035695 | Ga0373927_0306889 | Ga0373927_0306889_110_712 | 170 |
| 66 | 3300035725 | Ga0373947_0105398 | Ga0373947_0105398_1111_1713 | 170 |
| 67 | 3300037068 | Ga0373925_0113558 | Ga0373925_0113558_413_1015 | 170 |
| 68 | 3300041505 | Ga0451849_1563122 | Ga0451849_1563122_455_1054 | 170 |
| 69 | 3300047321 | Ga0495676_0271974 | Ga0495676_0271974_93_695 | 170 |
| 70 | 3300005455 | Ga0070663_100308436 | Ga0070663_1003084362 | 171 |
| 71 | 3300005543 | Ga0070672_100747232 | Ga0070672_1007472321 | 171 |
| 72 | 3300005841 | Ga0068863_100677133 | Ga0068863_1006771332 | 171 |
| 73 | 3300009098 | Ga0105245_10402183 | Ga0105245_104021832 | 171 |
| 74 | 3300013307 | Ga0157372_10381424 | Ga0157372_103814242 | 171 |
| 75 | 3300025927 | Ga0207687_10381699 | Ga0207687_103816991 | 171 |
| 76 | 3300026121 | Ga0207683_10012703 | Ga0207683_100127032 | 171 |
| 77 | 3300031616 | Ga0307508_10042105 | Ga0307508_100421055 | 171 |
| 78 | 3300035086 | Ga0373934_0000104 | Ga0373934_0000104_22475_23077 | 171 |
| 79 | 3300035117 | Ga0373953_0000507 | Ga0373953_0000507_8520_9122 | 171 |
| 80 | 3300035118 | Ga0373954_0010317 | Ga0373954_0010317_1388_1990 | 171 |
| 81 | 3300035120 | Ga0373957_0000034 | Ga0373957_0000034_2471_3073 | 171 |
| 82 | 3300035172 | Ga0373955_0000928 | Ga0373955_0000928_10029_10631 | 171 |
| 83 | 3300035410 | Ga0373924_0009695 | Ga0373924_0009695_2105_2707 | 171 |
| 84 | 3300035724 | Ga0373933_0000230 | Ga0373933_0000230_3913_4515 | 171 |
| 85 | 3300036401 | Ga0373937_0000010 | Ga0373937_0000010_129986_130588 | 171 |
| 86 | 3300039437 | Ga0436365_0085734 | Ga0436365_0085734_1025_1645 | 171 |
| 87 | 3300041441 | Ga0451787_108881 | Ga0451787_108881_635_1234 | 171 |
| 88 | 3300041451 | Ga0451791_0347104 | Ga0451791_0347104_2199_2798 | 171 |
| 89 | 3300041452 | Ga0451793_0046820 | Ga0451793_0046820_1993_2592 | 171 |
| 90 | 3300041453 | Ga0451797_0152092 | Ga0451797_0152092_6394_6993 | 171 |
| 91 | 3300041456 | Ga0451795_0988715 | Ga0451795_0988715_1378_1977 | 171 |
| 92 | 3300041460 | Ga0451802_0683453 | Ga0451802_0683453_763_1362 | 171 |
| 93 | 3300041494 | Ga0451837_1108925 | Ga0451837_1108925_1308_1907 | 171 |
| 94 | 3300041496 | Ga0451839_0663846 | Ga0451839_0663846_341_940 | 171 |
| 95 | 3300041509 | Ga0451843_1339351 | Ga0451843_1339351_60_659 | 171 |
| 96 | 3300046454 | Ga0495592_0000225 | Ga0495592_0000225_15416_16018 | 171 |
| 97 | 3300046462 | Ga0495651_0000166 | Ga0495651_0000166_15421_16023 | 171 |
| 98 | 3300046463 | Ga0495653_0308295 | Ga0495653_0308295_156_728 | 171 |
| 99 | 3300046511 | Ga0495608_0000292 | Ga0495608_0000292_32414_33016 | 171 |
| 100 | 3300046514 | Ga0495618_0440019 | Ga0495618_0440019_38_610 | 171 |
| 101 | 3300046516 | Ga0495628_0000535 | Ga0495628_0000535_32391_32993 | 171 |
| 102 | 3300046516 | Ga0495628_0055673 | Ga0495628_0055673_59_631 | 171 |
| 103 | 3300046517 | Ga0495630_0263562 | Ga0495630_0263562_357_929 | 171 |
| 104 | 3300046536 | Ga0495587_0000294 | Ga0495587_0000294_32414_33016 | 171 |
| 105 | 3300046543 | Ga0495645_0143012 | Ga0495645_0143012_480_1052 | 171 |
| 106 | 3300046543 | Ga0495645_0325914 | Ga0495645_0325914_380_982 | 171 |
| 107 | 3300046559 | Ga0495667_0000064 | Ga0495667_0000064_32406_33008 | 171 |
| 108 | 3300046678 | Ga0495599_0000179 | Ga0495599_0000179_8495_9097 | 171 |
| 109 | 3300046680 | Ga0495646_0045595 | Ga0495646_0045595_2056_2658 | 171 |
| 110 | 3300046690 | Ga0495624_0187619 | Ga0495624_0187619_94_696 | 171 |
| 111 | 3300046809 | Ga0495600_0048204 | Ga0495600_0048204_1334_1936 | 171 |
| 112 | 3300046809 | Ga0495600_0183012 | Ga0495600_0183012_705_1277 | 171 |
| 113 | 3300047317 | Ga0495604_0000245 | Ga0495604_0000245_15421_16023 | 171 |
| 114 | 3300047317 | Ga0495604_0136889 | Ga0495604_0136889_1071_1643 | 171 |
| 115 | 3300047319 | Ga0495674_0470269 | Ga0495674_0470269_116_688 | 171 |
| 116 | 3300047322 | Ga0495680_0091366 | Ga0495680_0091366_1369_1941 | 171 |
| 117 | 3300053077 | Ga0495601_0207047 | Ga0495601_0207047_362_934 | 171 |
| 118 | 3300053084 | Ga0495595_0005396 | Ga0495595_0005396_1837_2439 | 171 |
| 119 | 3300053084 | Ga0495595_0082836 | Ga0495595_0082836_868_1440 | 171 |
| 120 | 3300053085 | Ga0495619_0081168 | Ga0495619_0081168_1284_1856 | 171 |
| 121 | 3300005616 | Ga0068852_100005066 | Ga0068852_10000506616 | 172 |
| 122 | 3300009177 | Ga0105248_10843247 | Ga0105248_108432472 | 172 |
| 123 | 3300046462 | Ga0495651_0006403 | Ga0495651_0006403_3795_4367 | 172 |
| 124 | 3300048088 | Ga0495602_0129442 | Ga0495602_0129442_227_799 | 172 |
| 125 | 3300053085 | Ga0495619_0122335 | Ga0495619_0122335_204_776 | 172 |
| 126 | 3300009545 | Ga0105237_11346116 | Ga0105237_113461161 | 173 |
| 127 | 3300046526 | Ga0495666_0199973 | Ga0495666_0199973_148_762 | 173 |
| 128 | 3300013104 | Ga0157370_10480558 | Ga0157370_104805582 | 176 |
| 129 | 3300013105 | Ga0157369_10231284 | Ga0157369_102312842 | 176 |
| 130 | 3300035113 | Ga0373936_0070117 | Ga0373936_0070117_518_1117 | 176 |
| 131 | 3300035172 | Ga0373955_0011299 | Ga0373955_0011299_2060_2659 | 176 |
| 132 | 3300035695 | Ga0373927_0190484 | Ga0373927_0190484_698_1297 | 176 |
| 133 | 3300046461 | Ga0495641_0109559 | Ga0495641_0109559_487_1086 | 176 |
| 134 | 3300046463 | Ga0495653_0015392 | Ga0495653_0015392_2214_2813 | 176 |
| 135 | 3300046511 | Ga0495608_0013553 | Ga0495608_0013553_1394_1993 | 176 |
| 136 | 3300046516 | Ga0495628_0620756 | Ga0495628_0620756_150_743 | 176 |
| 137 | 3300046536 | Ga0495587_0378065 | Ga0495587_0378065_104_697 | 176 |
| 138 | 3300046663 | Ga0495635_0036829 | Ga0495635_0036829_2658_3257 | 176 |
| 139 | 3300046675 | Ga0495657_0350615 | Ga0495657_0350615_132_731 | 176 |
| 140 | 3300046809 | Ga0495600_0096753 | Ga0495600_0096753_1079_1678 | 176 |
| 141 | 3300047317 | Ga0495604_0195150 | Ga0495604_0195150_178_777 | 176 |
| 142 | 3300047322 | Ga0495680_0226510 | Ga0495680_0226510_406_1005 | 176 |
| 143 | 3300047471 | Ga0495684_0007161 | Ga0495684_0007161_760_1359 | 176 |
| 144 | 3300025927 | Ga0207687_10597808 | Ga0207687_105978082 | 177 |
| 145 | 3300047322 | Ga0495680_0009346 | Ga0495680_0009346_5507_6106 | 178 |
| 146 | 3300053085 | Ga0495619_0441188 | Ga0495619_0441188_202_783 | 178 |
| 147 | 3300005436 | Ga0070713_100026545 | Ga0070713_1000265455 | 179 |
| 148 | 3300025928 | Ga0207700_10026159 | Ga0207700_100261591 | 179 |
| 149 | 3300025928 | Ga0207700_10094307 | Ga0207700_100943072 | 179 |
| 150 | 3300025934 | Ga0207686_10480066 | Ga0207686_104800661 | 179 |
| 151 | 3300026142 | Ga0207698_10565845 | Ga0207698_105658451 | 179 |
| 152 | 3300044901 | Ga0466960_0000079 | Ga0466960_0000079_27886_28455 | 180 |
| 153 | 3300005435 | Ga0070714_100019153 | Ga0070714_1000191534 | 181 |
| 154 | 3300028800 | Ga0265338_10318944 | Ga0265338_103189442 | 181 |
| 155 | 3300046499 | Ga0495594_0234913 | Ga0495594_0234913_25_588 | 181 |
| 156 | 3300047317 | Ga0495604_0227329 | Ga0495604_0227329_97_660 | 181 |
| 157 | 3300048914 | Ga0496111_0458868 | Ga0496111_0458868_311_874 | 181 |
| 158 | 3300053084 | Ga0495595_0101560 | Ga0495595_0101560_238_828 | 181 |
| 159 | 3300005471 | Ga0070698_100126267 | Ga0070698_1001262675 | 182 |
| 160 | 3300037068 | Ga0373925_0015390 | Ga0373925_0015390_2942_3541 | 182 |
| 161 | 3300013308 | Ga0157375_10803406 | Ga0157375_108034062 | 183 |
| 162 | 3300025960 | Ga0207651_10358616 | Ga0207651_103586163 | 183 |
| 163 | 3300028379 | Ga0268266_10281816 | Ga0268266_102818162 | 183 |
| 164 | 3300037853 | Ga0436364_1044436 | Ga0436364_1044436_29_652 | 183 |
| 165 | 3300048912 | Ga0496109_0672880 | Ga0496109_0672880_378_947 | 183 |
| 166 | iso_pu_bacteria | 2675903059 | 2676485572 | 183 |
| 167 | 3300005937 | Ga0081455_10297095 | Ga0081455_102970952 | 184 |
| 168 | 3300011119 | Ga0105246_10727076 | Ga0105246_107270761 | 184 |
| 169 | 3300005843 | Ga0068860_100063510 | Ga0068860_1000635101 | 185 |
| 170 | 3300025913 | Ga0207695_10613289 | Ga0207695_106132892 | 185 |
| 171 | 3300028381 | Ga0268264_10074197 | Ga0268264_100741973 | 185 |
| 172 | 3300028666 | Ga0265336_10008047 | Ga0265336_100080473 | 185 |
| 173 | 3300028800 | Ga0265338_10000522 | Ga0265338_1000052237 | 185 |
| 174 | 3300031456 | Ga0307513_10350462 | Ga0307513_103504621 | 185 |
| 175 | 3300005337 | Ga0070682_100330419 | Ga0070682_1003304192 | 186 |
| 176 | 3300005535 | Ga0070684_100145658 | Ga0070684_1001456582 | 186 |
| 177 | 3300009098 | Ga0105245_10266856 | Ga0105245_102668562 | 186 |
| 178 | 3300009148 | Ga0105243_10077619 | Ga0105243_100776193 | 186 |
| 179 | 3300013306 | Ga0163162_10360132 | Ga0163162_103601322 | 186 |
| 180 | 3300013307 | Ga0157372_10000006 | Ga0157372_10000006303 | 186 |
| 181 | 3300013308 | Ga0157375_10813643 | Ga0157375_108136432 | 186 |
| 182 | 3300014969 | Ga0157376_10027903 | Ga0157376_100279033 | 186 |
| 183 | 3300025935 | Ga0207709_10043704 | Ga0207709_100437043 | 186 |
| 184 | 3300026067 | Ga0207678_10772190 | Ga0207678_107721902 | 186 |
| 185 | 3300026095 | Ga0207676_10034862 | Ga0207676_100348624 | 186 |
| 186 | 3300046459 | Ga0495629_0179670 | Ga0495629_0179670_835_1428 | 186 |
| 187 | 3300046499 | Ga0495594_0020733 | Ga0495594_0020733_1530_2129 | 186 |
| 188 | 3300046531 | Ga0495665_0246763 | Ga0495665_0246763_171_752 | 186 |
| 189 | 3300047319 | Ga0495674_0141644 | Ga0495674_0141644_694_1275 | 186 |
| 190 | 3300047319 | Ga0495674_0367873 | Ga0495674_0367873_13_594 | 186 |
| 191 | 3300048917 | Ga0496114_0058703 | Ga0496114_0058703_19_606 | 186 |
| 192 | 3300005328 | Ga0070676_10070540 | Ga0070676_100705402 | 187 |
| 193 | 3300005334 | Ga0068869_100570728 | Ga0068869_1005707282 | 187 |
| 194 | 3300005365 | Ga0070688_100076051 | Ga0070688_1000760512 | 187 |
| 195 | 3300005435 | Ga0070714_100011043 | Ga0070714_1000110435 | 187 |
| 196 | 3300005437 | Ga0070710_10519378 | Ga0070710_105193782 | 187 |
| 197 | 3300005441 | Ga0070700_100051987 | Ga0070700_1000519872 | 187 |
| 198 | 3300005456 | Ga0070678_100104338 | Ga0070678_1001043382 | 187 |
| 199 | 3300005466 | Ga0070685_10283043 | Ga0070685_102830432 | 187 |
| 200 | 3300005467 | Ga0070706_100080615 | Ga0070706_1000806152 | 187 |
| 201 | 3300005467 | Ga0070706_100429326 | Ga0070706_1004293262 | 187 |
| 202 | 3300005471 | Ga0070698_100642808 | Ga0070698_1006428082 | 187 |
| 203 | 3300005548 | Ga0070665_100434068 | Ga0070665_1004340682 | 187 |
| 204 | 3300005616 | Ga0068852_100092008 | Ga0068852_1000920083 | 187 |
| 205 | 3300005618 | Ga0068864_100329572 | Ga0068864_1003295721 | 187 |
| 206 | 3300005841 | Ga0068863_100056657 | Ga0068863_1000566572 | 187 |
| 207 | 3300005843 | Ga0068860_100212755 | Ga0068860_1002127552 | 187 |
| 208 | 3300005985 | Ga0081539_10049620 | Ga0081539_100496201 | 187 |
| 209 | 3300006028 | Ga0070717_10100409 | Ga0070717_101004092 | 187 |
| 210 | 3300006175 | Ga0070712_100082593 | Ga0070712_1000825933 | 187 |
| 211 | 3300006844 | Ga0075428_100000355 | Ga0075428_10000035528 | 187 |
| 212 | 3300006844 | Ga0075428_100668110 | Ga0075428_1006681102 | 187 |
| 213 | 3300006846 | Ga0075430_100160258 | Ga0075430_1001602583 | 187 |
| 214 | 3300006847 | Ga0075431_100150026 | Ga0075431_1001500261 | 187 |
| 215 | 3300009094 | Ga0111539_10520053 | Ga0111539_105200532 | 187 |
| 216 | 3300009101 | Ga0105247_10216555 | Ga0105247_102165552 | 187 |
| 217 | 3300010375 | Ga0105239_10194782 | Ga0105239_101947822 | 187 |
| 218 | 3300010375 | Ga0105239_11779779 | Ga0105239_117797791 | 187 |
| 219 | 3300013307 | Ga0157372_10892013 | Ga0157372_108920132 | 187 |
| 220 | 3300013308 | Ga0157375_10568553 | Ga0157375_105685531 | 187 |
| 221 | 3300025910 | Ga0207684_10239921 | Ga0207684_102399212 | 187 |
| 222 | 3300025914 | Ga0207671_10192013 | Ga0207671_101920132 | 187 |
| 223 | 3300025924 | Ga0207694_10751277 | Ga0207694_107512772 | 187 |
| 224 | 3300025928 | Ga0207700_10942075 | Ga0207700_109420751 | 187 |
| 225 | 3300025936 | Ga0207670_10430374 | Ga0207670_104303742 | 187 |
| 226 | 3300025942 | Ga0207689_10415714 | Ga0207689_104157142 | 187 |
| 227 | 3300025960 | Ga0207651_10490738 | Ga0207651_104907382 | 187 |
| 228 | 3300026067 | Ga0207678_10053512 | Ga0207678_100535123 | 187 |
| 229 | 3300026075 | Ga0207708_10075087 | Ga0207708_100750872 | 187 |
| 230 | 3300026088 | Ga0207641_10521415 | Ga0207641_105214152 | 187 |
| 231 | 3300026121 | Ga0207683_10362299 | Ga0207683_103622992 | 187 |
| 232 | 3300028379 | Ga0268266_10320233 | Ga0268266_103202332 | 187 |
| 233 | 3300028379 | Ga0268266_10539566 | Ga0268266_105395662 | 187 |
| 234 | 3300028381 | Ga0268264_10306150 | Ga0268264_103061502 | 187 |
| 235 | 3300030762 | Ga0265775_102590 | Ga0265775_1025902 | 187 |
| 236 | 3300031456 | Ga0307513_10002041 | Ga0307513_100020415 | 187 |
| 237 | 3300031507 | Ga0307509_10614924 | Ga0307509_106149241 | 187 |
| 238 | 3300031548 | Ga0307408_100264325 | Ga0307408_1002643252 | 187 |
| 239 | 3300031852 | Ga0307410_10025094 | Ga0307410_100250943 | 187 |
| 240 | 3300031901 | Ga0307406_10178497 | Ga0307406_101784971 | 187 |
| 241 | 3300031901 | Ga0307406_10381871 | Ga0307406_103818712 | 187 |
| 242 | 3300031903 | Ga0307407_10124970 | Ga0307407_101249703 | 187 |
| 243 | 3300031995 | Ga0307409_100271796 | Ga0307409_1002717962 | 187 |
| 244 | 3300031995 | Ga0307409_100288308 | Ga0307409_1002883081 | 187 |
| 245 | 3300031995 | Ga0307409_100401165 | Ga0307409_1004011652 | 187 |
| 246 | 3300032002 | Ga0307416_100496550 | Ga0307416_1004965501 | 187 |
| 247 | 3300032126 | Ga0307415_100075556 | Ga0307415_1000755562 | 187 |
| 248 | 3300035117 | Ga0373953_0122864 | Ga0373953_0122864_49_636 | 187 |
| 249 | 3300035118 | Ga0373954_0024814 | Ga0373954_0024814_1171_1788 | 187 |
| 250 | 3300035119 | Ga0373956_0003149 | Ga0373956_0003149_643_1260 | 187 |
| 251 | 3300035120 | Ga0373957_0022842 | Ga0373957_0022842_1123_1740 | 187 |
| 252 | 3300035171 | Ga0373946_0175103 | Ga0373946_0175103_365_982 | 187 |
| 253 | 3300035172 | Ga0373955_0048528 | Ga0373955_0048528_1043_1660 | 187 |
| 254 | 3300035410 | Ga0373924_0090936 | Ga0373924_0090936_47_664 | 187 |
| 255 | 3300035724 | Ga0373933_0087720 | Ga0373933_0087720_1171_1788 | 187 |
| 256 | 3300035725 | Ga0373947_0087972 | Ga0373947_0087972_605_1195 | 187 |
| 257 | 3300036401 | Ga0373937_0119957 | Ga0373937_0119957_1705_2322 | 187 |
| 258 | 3300037418 | Ga0395900_0407748 | Ga0395900_0407748_165_788 | 187 |
| 259 | 3300037466 | Ga0395898_0003436 | Ga0395898_0003436_1856_2464 | 187 |
| 260 | 3300037471 | Ga0395905_0090105 | Ga0395905_0090105_1881_2489 | 187 |
| 261 | 3300037853 | Ga0436364_0797116 | Ga0436364_0797116_1484_2095 | 187 |
| 262 | 3300038443 | Ga0395901_0009032 | Ga0395901_0009032_6862_7485 | 187 |
| 263 | 3300038443 | Ga0395901_0048305 | Ga0395901_0048305_1972_2580 | 187 |
| 264 | 3300039450 | Ga0436363_1021360 | Ga0436363_1021360_346_939 | 187 |
| 265 | 3300039453 | Ga0436362_0346627 | Ga0436362_0346627_19_612 | 187 |
| 266 | 3300044694 | Ga0466963_0320877 | Ga0466963_0320877_91_678 | 187 |
| 267 | 3300046454 | Ga0495592_0036046 | Ga0495592_0036046_49_648 | 187 |
| 268 | 3300046454 | Ga0495592_0046368 | Ga0495592_0046368_221_814 | 187 |
| 269 | 3300046454 | Ga0495592_0064767 | Ga0495592_0064767_763_1380 | 187 |
| 270 | 3300046459 | Ga0495629_0002801 | Ga0495629_0002801_5195_5812 | 187 |
| 271 | 3300046461 | Ga0495641_0042115 | Ga0495641_0042115_1073_1690 | 187 |
| 272 | 3300046462 | Ga0495651_0040931 | Ga0495651_0040931_709_1326 | 187 |
| 273 | 3300046473 | Ga0495582_0017634 | Ga0495582_0017634_54_671 | 187 |
| 274 | 3300046475 | Ga0495639_0025760 | Ga0495639_0025760_164_781 | 187 |
| 275 | 3300046476 | Ga0495662_0003771 | Ga0495662_0003771_745_1362 | 187 |
| 276 | 3300046477 | Ga0495664_0018238 | Ga0495664_0018238_1519_2136 | 187 |
| 277 | 3300046511 | Ga0495608_0049512 | Ga0495608_0049512_2014_2631 | 187 |
| 278 | 3300046514 | Ga0495618_0065801 | Ga0495618_0065801_1171_1788 | 187 |
| 279 | 3300046516 | Ga0495628_0027226 | Ga0495628_0027226_1021_1638 | 187 |
| 280 | 3300046516 | Ga0495628_0197609 | Ga0495628_0197609_271_885 | 187 |
| 281 | 3300046517 | Ga0495630_0030463 | Ga0495630_0030463_1122_1739 | 187 |
| 282 | 3300046526 | Ga0495666_0035603 | Ga0495666_0035603_1342_1959 | 187 |
| 283 | 3300046529 | Ga0495652_0001880 | Ga0495652_0001880_5874_6467 | 187 |
| 284 | 3300046529 | Ga0495652_0097874 | Ga0495652_0097874_129_746 | 187 |
| 285 | 3300046533 | Ga0495640_0030926 | Ga0495640_0030926_2040_2657 | 187 |
| 286 | 3300046535 | Ga0495586_0055675 | Ga0495586_0055675_137_754 | 187 |
| 287 | 3300046536 | Ga0495587_0085850 | Ga0495587_0085850_1174_1767 | 187 |
| 288 | 3300046536 | Ga0495587_0141043 | Ga0495587_0141043_516_1133 | 187 |
| 289 | 3300046543 | Ga0495645_0028207 | Ga0495645_0028207_1603_2220 | 187 |
| 290 | 3300046543 | Ga0495645_0107605 | Ga0495645_0107605_690_1283 | 187 |
| 291 | 3300046557 | Ga0495622_0136066 | Ga0495622_0136066_86_679 | 187 |
| 292 | 3300046559 | Ga0495667_0010691 | Ga0495667_0010691_3016_3633 | 187 |
| 293 | 3300046642 | Ga0495634_0013531 | Ga0495634_0013531_3546_4163 | 187 |
| 294 | 3300046663 | Ga0495635_0216141 | Ga0495635_0216141_516_1133 | 187 |
| 295 | 3300046678 | Ga0495599_0038118 | Ga0495599_0038118_2275_2892 | 187 |
| 296 | 3300046678 | Ga0495599_0190377 | Ga0495599_0190377_418_1032 | 187 |
| 297 | 3300046679 | Ga0495623_0029880 | Ga0495623_0029880_1298_1915 | 187 |
| 298 | 3300046679 | Ga0495623_0092378 | Ga0495623_0092378_108_701 | 187 |
| 299 | 3300046680 | Ga0495646_0016519 | Ga0495646_0016519_2187_2804 | 187 |
| 300 | 3300046680 | Ga0495646_0017759 | Ga0495646_0017759_2279_2872 | 187 |
| 301 | 3300046680 | Ga0495646_0301190 | Ga0495646_0301190_128_742 | 187 |
| 302 | 3300046689 | Ga0495613_0016929 | Ga0495613_0016929_1856_2473 | 187 |
| 303 | 3300046690 | Ga0495624_0025498 | Ga0495624_0025498_1350_1967 | 187 |
| 304 | 3300047315 | Ga0495581_0022148 | Ga0495581_0022148_643_1260 | 187 |
| 305 | 3300047317 | Ga0495604_0042814 | Ga0495604_0042814_2147_2764 | 187 |
| 306 | 3300047319 | Ga0495674_0069301 | Ga0495674_0069301_1090_1680 | 187 |
| 307 | 3300047322 | Ga0495680_0092091 | Ga0495680_0092091_516_1133 | 187 |
| 308 | 3300047444 | Ga0495675_0277890 | Ga0495675_0277890_337_924 | 187 |
| 309 | 3300047471 | Ga0495684_0100014 | Ga0495684_0100014_159_776 | 187 |
| 310 | 3300047673 | Ga0495593_0042249 | Ga0495593_0042249_127_744 | 187 |
| 311 | 3300048088 | Ga0495602_0303184 | Ga0495602_0303184_361_948 | 187 |
| 312 | 3300048089 | Ga0495614_0019379 | Ga0495614_0019379_1741_2358 | 187 |
| 313 | 3300048903 | Ga0496100_0367345 | Ga0496100_0367345_388_969 | 187 |
| 314 | 3300048908 | Ga0496105_0461321 | Ga0496105_0461321_168_758 | 187 |
| 315 | 3300048909 | Ga0496106_0079053 | Ga0496106_0079053_1748_2329 | 187 |
| 316 | 3300048909 | Ga0496106_0152751 | Ga0496106_0152751_499_1092 | 187 |
| 317 | 3300048912 | Ga0496109_0303810 | Ga0496109_0303810_275_937 | 187 |
| 318 | 3300048912 | Ga0496109_0485733 | Ga0496109_0485733_167_760 | 187 |
| 319 | 3300048912 | Ga0496109_0834807 | Ga0496109_0834807_14_595 | 187 |
| 320 | 3300048914 | Ga0496111_0202693 | Ga0496111_0202693_520_1182 | 187 |
| 321 | 3300048917 | Ga0496114_0166914 | Ga0496114_0166914_430_1020 | 187 |
| 322 | 3300050494 | nmdc:mga06z11_68615_c1 | nmdc:mga06z11_68615_c1_1213_1806 | 187 |
| 323 | 3300050509 | nmdc:mga0qj67_148450_c1 | nmdc:mga0qj67_148450_c1_240_839 | 187 |
| 324 | 3300053077 | Ga0495601_0003188 | Ga0495601_0003188_3579_4193 | 187 |
| 325 | 3300053077 | Ga0495601_0005692 | Ga0495601_0005692_1980_2573 | 187 |
| 326 | 3300053077 | Ga0495601_0021402 | Ga0495601_0021402_33_650 | 187 |
| 327 | 3300053078 | Ga0495612_0006774 | Ga0495612_0006774_1005_1622 | 187 |
| 328 | 3300053078 | Ga0495612_0147090 | Ga0495612_0147090_202_792 | 187 |
| 329 | 3300053084 | Ga0495595_0006788 | Ga0495595_0006788_3353_3970 | 187 |
| 330 | 3300053085 | Ga0495619_0013425 | Ga0495619_0013425_3054_3671 | 187 |
| 331 | 3300053085 | Ga0495619_0112617 | Ga0495619_0112617_1170_1787 | 187 |
| 332 | 3300053085 | Ga0495619_0203432 | Ga0495619_0203432_379_972 | 187 |
| 333 | 3300059492 | Ga0587073_0007340 | Ga0587073_0007340_138_734 | 187 |
| 334 | 3300059510 | Ga0587090_013854 | Ga0587090_013854_433_1029 | 187 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hjp-assembly2.cif.gz_D | the crystal structure of bcp4 from sulfolobus solfataricus | 0.902 | 7 | 157 |
| 3drn-assembly2.cif.gz_B | the crystal structure of bcp1 from sulfolobus sulfataricus | 0.897 | 5 | 159 |
| 3drn-assembly2.cif.gz_B | the crystal structure of bcp1 from sulfolobus sulfataricus | 0.8859 | 5 | 159 |
| 2cx4-assembly4.cif.gz_H | crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the aeropyrum pernix k1 (form-2 crystal) | 0.8815 | 7 | 160 |
| 2h1b-assembly2.cif.gz_B | resa e80q | 0.8783 | 8 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3drnB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.897 | 5 | 159 | 3.40.30.10 |
| 2cx4E00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8894 | 8 | 160 | 3.40.30.10 |
| 3drnB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8859 | 5 | 159 | 3.40.30.10 |
| af_I1MS47_66_213_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8745 | 5 | 158 | 3.40.30.10 |
| af_Q55E48_3_135_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8734 | 6 | 139 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534NT50-F1-model_v4 | Redoxin domain-containing protein | 0.9965 | 1 | 107 |
GO:0016209
GO:0016491 |
| AF-A0A534NT50-F1-model_v4 | Redoxin domain-containing protein | 0.9873 | 1 | 107 |
GO:0016209
GO:0016491 |
| AF-A0A538NGE8-F1-model_v4 | Redoxin domain-containing protein | 0.9656 | 1 | 133 |
GO:0016209
GO:0016491 |
| AF-A0A7W0X9U1-F1-model_v4 | Redoxin domain-containing protein | 0.9525 | 5 | 165 |
GO:0016209
GO:0016491 |
| AF-A0A538NGE8-F1-model_v4 | Redoxin domain-containing protein | 0.9516 | 1 | 133 |
GO:0016209
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar