F411697

General Info

Members Datasets Scaffolds Average Seq Length
334 167 668 234

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100045407|Ga0068855_1000454074
Length 258
Sequence MLSCVIIDDEPLAQEILAGYIGQEELRLLGCFNNAFEGQAFLKDHAVDVLFLDIEMPEMNGITFLQSLASPPITVFTTAFRDYAFEGFELGVIDFLLKPISLERFRVAVEKVRDFLALRRDDAGLEPGGEGAWAGDSSAGAVRQAPEYVFVKSGVERIKLFFAEVTHIQGLKDYAIIHTAAGGRMGKIVIKGSVKHVLPLFPEGAFIRVHKSFIVAKDKIRRIERNRILIGEHQIPIGRNYKEEVGRLISPNTQSGYL

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
134 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
143 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
144 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
145 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
155 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
159 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
160 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
161 2738541284 Pedobacter sp. YR016 Isolate Unclassified
162 2739367651 Pedobacter sp. OK291 Isolate Unclassified
163 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
164 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
165 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
166 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
167 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.31
Metatranscriptomes 0
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.79
Nodule 0
Rhizoplane 0.6
Rhizosphere 88.92
Stem 0
Stem Tuber 0
Unclassified 11.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100045407 3300005563 Bacteria 5197
2 SwRhRL2b_contig_1567641 2162886007 Bacteria 114185
3 SwRhRL2b_contig_676118 2162886007 Bacteria 147446
4 JGI24739J22299_10005254 3300001989 Bacteria 4934
5 JGI24739J22299_10015449 3300001989 Bacteria 2774
6 JGI24739J22299_10037842 3300001989 Bacteria 1623
7 JGI24737J22298_10000034 3300001990 Bacteria 39811
8 JGI24735J21928_10000008 3300002067 Bacteria 319819
9 JGI24735J21928_10000009 3300002067 Bacteria 247425
10 JGI24735J21928_10000036 3300002067 Bacteria 65596
11 JGI25406J46586_10006472 3300003203 Bacteria 5388
12 rootH1_10054746 3300003316 Bacteria 7422
13 rootH1_10188898 3300003316 Bacteria 3099
14 rootH2_10000115 3300003320 Bacteria 133613
15 rootL2_10188846 3300003322 Unclassified 1179
16 rootL2_10276594 3300003322 Bacteria 1770
17 rootH1_10134188 3300003323 Bacteria 5929
18 rootH1_10278548 3300003323 Bacteria 3525
19 rootH1_10306319 3300003323 Bacteria 5380
20 Ga0055536_1000009 3300003781 Bacteria 311572
21 Ga0055531_10000209 3300003794 Bacteria 64439
22 Ga0065714_10011534 3300005288 Unclassified 2602
23 Ga0065714_10064455 3300005288 Bacteria 72722
24 Ga0065704_10070136 3300005289 Bacteria 560402
25 Ga0065704_10075261 3300005289 Bacteria 5701
26 Ga0070676_10037996 3300005328 Unclassified 2779
27 Ga0070683_100009496 3300005329 Bacteria 8324
28 Ga0070683_100010075 3300005329 Bacteria 8107
29 Ga0070683_100023967 3300005329 Bacteria 5463
30 Ga0070683_100045159 3300005329 Unclassified 4066
31 Ga0070690_100302482 3300005330 Unclassified 1147
32 Ga0070670_100043696 3300005331 Bacteria 3852
33 Ga0070670_100570949 3300005331 Bacteria 1010
34 Ga0068869_100005251 3300005334 Bacteria 8134
35 Ga0068869_100166495 3300005334 Unclassified 1719
36 Ga0070666_10048608 3300005335 Bacteria 2851
37 Ga0070682_100035722 3300005337 Unclassified 3035
38 Ga0070682_100423709 3300005337 Bacteria 1012
39 Ga0070682_100645825 3300005337 Bacteria 842
40 Ga0068868_100002794 3300005338 Bacteria 12093
41 Ga0068868_100053694 3300005338 Unclassified 3175
42 Ga0068868_100232160 3300005338 Bacteria 1548
43 Ga0070660_100780182 3300005339 Bacteria 803
44 Ga0070689_100015770 3300005340 Bacteria 5518
45 Ga0070689_100020000 3300005340 Bacteria 4961
46 Ga0070661_100005419 3300005344 Bacteria 8798
47 Ga0070661_100006160 3300005344 Bacteria 8269
48 Ga0070661_100012565 3300005344 Bacteria 5926
49 Ga0070661_100039254 3300005344 Bacteria 3450
50 Ga0070668_100016367 3300005347 Bacteria 5544
51 Ga0070669_100133809 3300005353 Bacteria 1905
52 Ga0070675_100012097 3300005354 Bacteria 6764
53 Ga0070675_100074682 3300005354 Bacteria 2817
54 Ga0070671_100032459 3300005355 Unclassified 4316
55 Ga0070673_100070745 3300005364 Bacteria 2801
56 Ga0070673_100075495 3300005364 Bacteria 2719
57 Ga0070673_100297509 3300005364 Bacteria 1420
58 Ga0070688_100010435 3300005365 Bacteria 5121
59 Ga0070688_100020137 3300005365 Bacteria 3874
60 Ga0070688_100089076 3300005365 Bacteria 2013
61 Ga0070659_100050595 3300005366 Unclassified 3266
62 Ga0070659_100063140 3300005366 Unclassified 2930
63 Ga0070667_100005050 3300005367 Bacteria 11044
64 Ga0070667_100261523 3300005367 Bacteria 1550
65 Ga0070713_100872545 3300005436 Bacteria 865
66 Ga0070662_100064109 3300005457 Bacteria 2690
67 Ga0070662_100147504 3300005457 Unclassified 1829
68 Ga0070662_100310093 3300005457 Bacteria 1284
69 Ga0070681_10224154 3300005458 Bacteria 1795
70 Ga0068867_100043942 3300005459 Bacteria 3272
71 Ga0068867_100162131 3300005459 Unclassified 1764
72 Ga0070685_10036657 3300005466 Unclassified 2773
73 Ga0070684_100005416 3300005535 Bacteria 9777
74 Ga0070684_100040912 3300005535 Bacteria 3993
75 Ga0070684_100107018 3300005535 Bacteria 2504
76 Ga0068853_100003607 3300005539 Bacteria 11855
77 Ga0068853_100037453 3300005539 Unclassified 4127
78 Ga0068853_100045952 3300005539 Bacteria 3742
79 Ga0070672_100019362 3300005543 Bacteria 4939
80 Ga0070672_100914564 3300005543 Unclassified 775
81 Ga0070693_100301078 3300005547 Bacteria 1081
82 Ga0068855_100055063 3300005563 Bacteria 4673
83 Ga0068855_100339338 3300005563 Bacteria 1657
84 Ga0068855_100609806 3300005563 Bacteria 1176
85 Ga0070664_100013955 3300005564 Bacteria 6551
86 Ga0070664_100022806 3300005564 Bacteria 5164
87 Ga0070664_100028423 3300005564 Bacteria 4651
88 Ga0070664_100065271 3300005564 Bacteria 3105
89 Ga0070664_100232235 3300005564 Bacteria 1654
90 Ga0068857_100006306 3300005577 Bacteria 10152
91 Ga0068857_100022974 3300005577 Bacteria 5484
92 Ga0068857_100081097 3300005577 Bacteria 2897
93 Ga0068857_100355222 3300005577 Bacteria 1358
94 Ga0068854_100232682 3300005578 Bacteria 1463
95 Ga0068854_100647575 3300005578 Bacteria 907
96 Ga0068856_100000100 3300005614 Bacteria 82857
97 Ga0068856_100337416 3300005614 Unclassified 1525
98 Ga0070702_100472718 3300005615 Bacteria 914
99 Ga0068852_100231442 3300005616 Bacteria 1762
100 Ga0068852_100495568 3300005616 Bacteria 1216
101 Ga0068859_100034033 3300005617 Bacteria 5115
102 Ga0068859_100041439 3300005617 Bacteria 4624
103 Ga0068859_100044412 3300005617 Bacteria 4465
104 Ga0068859_100137695 3300005617 Bacteria 2515
105 Ga0068859_100938951 3300005617 Bacteria 949
106 Ga0068864_100010087 3300005618 Bacteria 7801
107 Ga0068864_100012664 3300005618 Bacteria 6974
108 Ga0068864_100021200 3300005618 Bacteria 5442
109 Ga0068864_100053293 3300005618 Bacteria 3489
110 Ga0068864_100490527 3300005618 Bacteria 1180
111 Ga0068861_100083898 3300005719 Unclassified 2500
112 Ga0068851_10005761 3300005834 Bacteria 5641
113 Ga0068851_10014797 3300005834 Bacteria 3709
114 Ga0068863_100038019 3300005841 Bacteria 4580
115 Ga0068860_100006824 3300005843 Bacteria 11442
116 Ga0068860_100064684 3300005843 Bacteria 3474
117 Ga0081539_10000042 3300005985 Bacteria 289955
118 Ga0075366_10009535 3300006195 Bacteria 5423
119 Ga0075366_10040836 3300006195 Bacteria 2745
120 Ga0097621_100731012 3300006237 Unclassified 913
121 Ga0068871_100235610 3300006358 Bacteria 1590
122 Ga0068865_100223018 3300006881 Bacteria 1475
123 Ga0068865_100317138 3300006881 Bacteria 1253
124 Ga0097620_100034033 3300006931 Bacteria 5115
125 Ga0097620_100041440 3300006931 Bacteria 4624
126 Ga0097620_100044411 3300006931 Bacteria 4465
127 Ga0097620_100137695 3300006931 Bacteria 2515
128 Ga0097620_100939003 3300006931 Bacteria 949
129 Ga0105240_10025679 3300009093 Bacteria 7738
130 Ga0105240_10031402 3300009093 Bacteria 6889
131 Ga0105240_10750156 3300009093 Bacteria 1061
132 Ga0114129_10101581 3300009147 Bacteria 3979
133 Ga0105241_10050841 3300009174 Bacteria 3159
134 Ga0105241_10075491 3300009174 Bacteria 2627
135 Ga0105241_10470897 3300009174 Bacteria 1115
136 Ga0105242_10350141 3300009176 Unclassified 1364
137 Ga0105242_10503331 3300009176 Unclassified 1153
138 Ga0105237_10017364 3300009545 Bacteria 7460
139 Ga0105237_10045321 3300009545 Bacteria 4426
140 Ga0105237_10140352 3300009545 Bacteria 2410
141 Ga0105237_10733612 3300009545 Bacteria 994
142 Ga0105238_10231119 3300009551 Bacteria 1826
143 Ga0105249_10002023 3300009553 Bacteria 17609
144 Ga0105249_10056974 3300009553 Bacteria 3578
145 Ga0105249_10115893 3300009553 Unclassified 2539
146 Ga0105249_10201799 3300009553 Bacteria 1946
147 Ga0105239_10004455 3300010375 Bacteria 16741
148 Ga0105239_10007898 3300010375 Bacteria 12163
149 Ga0105239_10051182 3300010375 Bacteria 4528
150 Ga0105239_10103046 3300010375 Bacteria 3158
151 Ga0105246_10043436 3300011119 Bacteria 3050
152 Ga0105246_10221795 3300011119 Bacteria 1482
153 Ga0157373_10020554 3300013100 Unclassified 4797
154 Ga0157371_10001440 3300013102 Bacteria 24703
155 Ga0157371_10071807 3300013102 Bacteria 2451
156 Ga0157370_10024013 3300013104 Bacteria 6045
157 Ga0157370_10031578 3300013104 Bacteria 5179
158 Ga0157370_10042949 3300013104 Bacteria 4353
159 Ga0157369_10093094 3300013105 Bacteria 3217
160 Ga0157374_10000015 3300013296 Bacteria 296773
161 Ga0157374_10003869 3300013296 Bacteria 12564
162 Ga0157374_10006760 3300013296 Bacteria 9751
163 Ga0157374_10046036 3300013296 Bacteria 4038
164 Ga0157374_10320316 3300013296 Unclassified 1536
165 Ga0157378_10114964 3300013297 Unclassified 2472
166 Ga0157378_10181761 3300013297 Unclassified 1979
167 Ga0157378_10858813 3300013297 Unclassified 936
168 Ga0163162_10021185 3300013306 Bacteria 6395
169 Ga0163162_10030502 3300013306 Bacteria 5342
170 Ga0163162_10062626 3300013306 Bacteria 3760
171 Ga0163162_10109057 3300013306 Bacteria 2865
172 Ga0163162_10117031 3300013306 Bacteria 2767
173 Ga0163162_10143290 3300013306 Bacteria 2504
174 Ga0163162_10275373 3300013306 Bacteria 1815
175 Ga0157372_10000438 3300013307 Bacteria 45862
176 Ga0157372_10003756 3300013307 Bacteria 16309
177 Ga0157372_10038726 3300013307 Bacteria 5261
178 Ga0157375_10044359 3300013308 Bacteria 4320
179 Ga0157375_10127196 3300013308 Bacteria 2664
180 Ga0157375_10129524 3300013308 Bacteria 2641
181 Ga0163163_10000276 3300014325 Bacteria 51378
182 Ga0163163_10011633 3300014325 Bacteria 7994
183 Ga0163163_10018134 3300014325 Bacteria 6579
184 Ga0157377_10002350 3300014745 Bacteria 8343
185 Ga0157377_10013525 3300014745 Bacteria 4132
186 Ga0157377_10240401 3300014745 Unclassified 1168
187 Ga0157379_10046596 3300014968 Bacteria 3867
188 Ga0157379_10059600 3300014968 Bacteria 3413
189 Ga0157379_10536028 3300014968 Bacteria 1088
190 Ga0157376_10002217 3300014969 Bacteria 13101
191 Ga0183373_1004 3300015682 Bacteria 537398
192 Ga0163161_10040468 3300017792 Bacteria 3348
193 Ga0163161_10041776 3300017792 Bacteria 3296
194 Ga0163161_10114170 3300017792 Bacteria 2023
195 Ga0213876_10073756 3300021384 Bacteria 1802
196 Ga0209436_100233 3300025208 Bacteria 25515
197 Ga0209455_1002651 3300025272 Bacteria 6758
198 Ga0209130_1002933 3300025284 Bacteria 7793
199 Ga0209676_1000001 3300025292 Bacteria 1852142
200 Ga0209050_1000018 3300025298 Bacteria 723263
201 Ga0207426_1000539 3300025302 Bacteria 54198
202 Ga0209257_1000001 3300025304 Bacteria 2274655
203 Ga0207656_10010332 3300025321 Bacteria 3495
204 Ga0207688_10279137 3300025901 Bacteria 1017
205 Ga0207647_10031099 3300025904 Bacteria 3437
206 Ga0207647_10084701 3300025904 Bacteria 1897
207 Ga0207647_10188512 3300025904 Bacteria 1196
208 Ga0207645_10089954 3300025907 Unclassified 1974
209 Ga0207654_10012174 3300025911 Bacteria 4403
210 Ga0207707_10317726 3300025912 Bacteria 1345
211 Ga0207695_10087761 3300025913 Bacteria 3133
212 Ga0207695_10125340 3300025913 Bacteria 2531
213 Ga0207695_10285317 3300025913 Bacteria 1544
214 Ga0207695_10655868 3300025913 Bacteria 930
215 Ga0207649_10003101 3300025920 Bacteria 9118
216 Ga0207649_10127001 3300025920 Unclassified 1727
217 Ga0207681_10341635 3300025923 Unclassified 1196
218 Ga0207650_10035430 3300025925 Bacteria 3624
219 Ga0207650_10049501 3300025925 Unclassified 3103
220 Ga0207650_10257598 3300025925 Bacteria 1414
221 Ga0207690_10011379 3300025932 Bacteria 5321
222 Ga0207690_10095916 3300025932 Bacteria 2108
223 Ga0207706_10011453 3300025933 Bacteria 8080
224 Ga0207706_10026125 3300025933 Bacteria 5228
225 Ga0207706_10349075 3300025933 Bacteria 1287
226 Ga0207686_10269896 3300025934 Unclassified 1251
227 Ga0207670_10008042 3300025936 Bacteria 5929
228 Ga0207670_10045886 3300025936 Bacteria 2900
229 Ga0207704_10109406 3300025938 Bacteria 1864
230 Ga0207704_10162463 3300025938 Bacteria 1591
231 Ga0207689_10004213 3300025942 Bacteria 13077
232 Ga0207689_10008332 3300025942 Bacteria 9030
233 Ga0207661_10015054 3300025944 Bacteria 5681
234 Ga0207661_10020062 3300025944 Bacteria 4992
235 Ga0207661_10039724 3300025944 Bacteria 3695
236 Ga0207661_10073216 3300025944 Bacteria 2805
237 Ga0207679_10006459 3300025945 Bacteria 7412
238 Ga0207679_10021204 3300025945 Bacteria 4400
239 Ga0207679_10051508 3300025945 Bacteria 3014
240 Ga0207679_10133166 3300025945 Bacteria 1997
241 Ga0207667_10061891 3300025949 Bacteria 3915
242 Ga0207667_10061938 3300025949 Bacteria 3913
243 Ga0207667_10445533 3300025949 Bacteria 1316
244 Ga0207667_10470678 3300025949 Bacteria 1276
245 Ga0207651_10094346 3300025960 Unclassified 2200
246 Ga0207651_10150783 3300025960 Bacteria 1809
247 Ga0207712_10000442 3300025961 Bacteria 35214
248 Ga0207712_10119096 3300025961 Bacteria 1994
249 Ga0207658_10015293 3300025986 Bacteria 5264
250 Ga0207658_10016068 3300025986 Bacteria 5141
251 Ga0207677_10039298 3300026023 Bacteria 3110
252 Ga0207677_10085001 3300026023 Bacteria 2282
253 Ga0207677_10370253 3300026023 Bacteria 1206
254 Ga0207703_10782900 3300026035 Unclassified 910
255 Ga0207639_10025599 3300026041 Bacteria 4279
256 Ga0207639_10051654 3300026041 Unclassified 3128
257 Ga0207639_10458149 3300026041 Bacteria 1159
258 Ga0207639_10603048 3300026041 Unclassified 1013
259 Ga0207639_10735818 3300026041 Unclassified 916
260 Ga0207678_10018052 3300026067 Bacteria 6197
261 Ga0207678_10045993 3300026067 Bacteria 3774
262 Ga0207708_10231942 3300026075 Bacteria 1482
263 Ga0207702_10000288 3300026078 Bacteria 58420
264 Ga0207702_10034520 3300026078 Bacteria 4229
265 Ga0207641_10057491 3300026088 Bacteria 3308
266 Ga0207676_10008559 3300026095 Bacteria 7272
267 Ga0207676_10031153 3300026095 Bacteria 4009
268 Ga0207676_10042583 3300026095 Bacteria 3493
269 Ga0207674_10007545 3300026116 Bacteria 12670
270 Ga0207674_10015716 3300026116 Bacteria 8304
271 Ga0207674_10023217 3300026116 Bacteria 6646
272 Ga0207674_10177006 3300026116 Bacteria 2085
273 Ga0207675_100044126 3300026118 Bacteria 4165
274 Ga0207675_100341829 3300026118 Bacteria 1465
275 Ga0207698_10158478 3300026142 Bacteria 1976
276 Ga0268266_10069872 3300028379 Bacteria 3044
277 Ga0268266_10608793 3300028379 Bacteria 1050
278 Ga0307515_10000479 3300028794 Bacteria 95197
279 Ga0307515_10323916 3300028794 Unclassified 1205
280 Ga0265327_10000084 3300031251 Bacteria 204433
281 Ga0307516_10010225 3300031730 Bacteria 10344
282 Ga0307415_100880651 3300032126 Bacteria 824
283 Ga0373937_0394425 3300036401 Bacteria 1313
284 Ga0436365_1878535 3300039437 Bacteria 6427
285 Ga0439441_000400 3300042001 Bacteria 4541
286 Ga0439460_0041688 3300042461 Bacteria 1350
287 Ga0451576_0001894 3300045051 Bacteria 33576
288 Ga0495650_0000025 3300046471 Bacteria 486001
289 Ga0495650_0000447 3300046471 Bacteria 65735
290 Ga0495585_0000017 3300046492 Bacteria 164054
291 Ga0495585_0000116 3300046492 Bacteria 86272
292 Ga0495583_0020225 3300046506 Bacteria 3455
293 Ga0495606_0000026 3300046507 Bacteria 259118
294 Ga0495606_0000844 3300046507 Bacteria 46120
295 Ga0495606_0055094 3300046507 Bacteria 2573
296 Ga0495610_0000197 3300046512 Bacteria 67429
297 Ga0495610_0002228 3300046512 Bacteria 16396
298 Ga0495616_0002102 3300046513 Bacteria 13386
299 Ga0495616_0005934 3300046513 Bacteria 7448
300 Ga0495632_0133125 3300046519 Bacteria 1156
301 Ga0495637_0019193 3300046520 Bacteria 3162
302 Ga0495637_0055566 3300046520 Bacteria 1641
303 Ga0495609_0074973 3300046538 Bacteria 1483
304 Ga0495633_0000043 3300046558 Bacteria 172356
305 Ga0495633_0003971 3300046558 Bacteria 9602
306 Ga0495625_0000008 3300046660 Bacteria 536165
307 Ga0495625_0000021 3300046660 Bacteria 282133
308 Ga0495625_0006096 3300046660 Bacteria 10813
309 Ga0495661_0006379 3300046665 Bacteria 8299
310 Ga0495661_0014134 3300046665 Bacteria 5348
311 Ga0495658_0374699 3300046683 Bacteria 906
312 Ga0495671_0015777 3300046692 Bacteria 4043
313 Ga0495649_0000006 3300046694 Bacteria 542188
314 Ga0495649_0005506 3300046694 Bacteria 8031
315 Ga0495687_006931 3300047443 Bacteria 6815
316 Ga0495686_0048802 3300047472 Bacteria 2667
317 Ga0496111_0652809 3300048914 Bacteria 767
318 Ga0501241_002130 3300049758 Bacteria 3875
319 nmdc:mga0k408_14761_c1 3300050493 Bacteria 4310
320 nmdc:mga0k408_4657_c1 3300050493 Bacteria 7269
321 nmdc:mga05p37_40028_c1 3300050507 Bacteria 5755
322 nmdc:mga0a205_863639_c1 3300050515 Bacteria 752
323 Ga0500618_018792 3300053125 Bacteria 1707
324 Ga0500622_0000016 3300053156 Bacteria 337983
325 Ga0500622_0070098 3300053156 Bacteria 1774
326 2599480120 2599185184 Bacteria 6430550
327 2738761042 2738541284 Bacteria 5199923
328 2739588950 2739367651 Bacteria 6359826
329 2776613225 2775506987 Bacteria 5373360
330 2839990939 2839989709 Bacteria 3773432
331 2928083563 2928078545 Bacteria 6534839
332 2928151175 2928147474 Bacteria 6512076
333 2932084475 2932082852 Bacteria 6563563
334 2932088413 2932082852 Bacteria 6563563
335 Ga0068855_100045407
336 SwRhRL2b_contig_1567641
337 SwRhRL2b_contig_676118
338 JGI24739J22299_10005254
339 JGI24739J22299_10015449
340 JGI24739J22299_10037842
341 JGI24737J22298_10000034
342 JGI24735J21928_10000008
343 JGI24735J21928_10000009
344 JGI24735J21928_10000036
345 JGI25406J46586_10006472
346 rootH1_10054746
347 rootH1_10188898
348 rootH2_10000115
349 rootL2_10188846
350 rootL2_10276594
351 rootH1_10134188
352 rootH1_10278548
353 rootH1_10306319
354 Ga0055536_1000009
355 Ga0055531_10000209
356 Ga0065714_10011534
357 Ga0065714_10064455
358 Ga0065704_10070136
359 Ga0065704_10075261
360 Ga0070676_10037996
361 Ga0070683_100009496
362 Ga0070683_100010075
363 Ga0070683_100023967
364 Ga0070683_100045159
365 Ga0070690_100302482
366 Ga0070670_100043696
367 Ga0070670_100570949
368 Ga0068869_100005251
369 Ga0068869_100166495
370 Ga0070666_10048608
371 Ga0070682_100035722
372 Ga0070682_100423709
373 Ga0070682_100645825
374 Ga0068868_100002794
375 Ga0068868_100053694
376 Ga0068868_100232160
377 Ga0070660_100780182
378 Ga0070689_100015770
379 Ga0070689_100020000
380 Ga0070661_100005419
381 Ga0070661_100006160
382 Ga0070661_100012565
383 Ga0070661_100039254
384 Ga0070668_100016367
385 Ga0070669_100133809
386 Ga0070675_100012097
387 Ga0070675_100074682
388 Ga0070671_100032459
389 Ga0070673_100070745
390 Ga0070673_100075495
391 Ga0070673_100297509
392 Ga0070688_100010435
393 Ga0070688_100020137
394 Ga0070688_100089076
395 Ga0070659_100050595
396 Ga0070659_100063140
397 Ga0070667_100005050
398 Ga0070667_100261523
399 Ga0070713_100872545
400 Ga0070662_100064109
401 Ga0070662_100147504
402 Ga0070662_100310093
403 Ga0070681_10224154
404 Ga0068867_100043942
405 Ga0068867_100162131
406 Ga0070685_10036657
407 Ga0070684_100005416
408 Ga0070684_100040912
409 Ga0070684_100107018
410 Ga0068853_100003607
411 Ga0068853_100037453
412 Ga0068853_100045952
413 Ga0070672_100019362
414 Ga0070672_100914564
415 Ga0070693_100301078
416 Ga0068855_100055063
417 Ga0068855_100339338
418 Ga0068855_100609806
419 Ga0070664_100013955
420 Ga0070664_100022806
421 Ga0070664_100028423
422 Ga0070664_100065271
423 Ga0070664_100232235
424 Ga0068857_100006306
425 Ga0068857_100022974
426 Ga0068857_100081097
427 Ga0068857_100355222
428 Ga0068854_100232682
429 Ga0068854_100647575
430 Ga0068856_100000100
431 Ga0068856_100337416
432 Ga0070702_100472718
433 Ga0068852_100231442
434 Ga0068852_100495568
435 Ga0068859_100034033
436 Ga0068859_100041439
437 Ga0068859_100044412
438 Ga0068859_100137695
439 Ga0068859_100938951
440 Ga0068864_100010087
441 Ga0068864_100012664
442 Ga0068864_100021200
443 Ga0068864_100053293
444 Ga0068864_100490527
445 Ga0068861_100083898
446 Ga0068851_10005761
447 Ga0068851_10014797
448 Ga0068863_100038019
449 Ga0068860_100006824
450 Ga0068860_100064684
451 Ga0081539_10000042
452 Ga0075366_10009535
453 Ga0075366_10040836
454 Ga0097621_100731012
455 Ga0068871_100235610
456 Ga0068865_100223018
457 Ga0068865_100317138
458 Ga0097620_100034033
459 Ga0097620_100041440
460 Ga0097620_100044411
461 Ga0097620_100137695
462 Ga0097620_100939003
463 Ga0105240_10025679
464 Ga0105240_10031402
465 Ga0105240_10750156
466 Ga0114129_10101581
467 Ga0105241_10050841
468 Ga0105241_10075491
469 Ga0105241_10470897
470 Ga0105242_10350141
471 Ga0105242_10503331
472 Ga0105237_10017364
473 Ga0105237_10045321
474 Ga0105237_10140352
475 Ga0105237_10733612
476 Ga0105238_10231119
477 Ga0105249_10002023
478 Ga0105249_10056974
479 Ga0105249_10115893
480 Ga0105249_10201799
481 Ga0105239_10004455
482 Ga0105239_10007898
483 Ga0105239_10051182
484 Ga0105239_10103046
485 Ga0105246_10043436
486 Ga0105246_10221795
487 Ga0157373_10020554
488 Ga0157371_10001440
489 Ga0157371_10071807
490 Ga0157370_10024013
491 Ga0157370_10031578
492 Ga0157370_10042949
493 Ga0157369_10093094
494 Ga0157374_10000015
495 Ga0157374_10003869
496 Ga0157374_10006760
497 Ga0157374_10046036
498 Ga0157374_10320316
499 Ga0157378_10114964
500 Ga0157378_10181761
501 Ga0157378_10858813
502 Ga0163162_10021185
503 Ga0163162_10030502
504 Ga0163162_10062626
505 Ga0163162_10109057
506 Ga0163162_10117031
507 Ga0163162_10143290
508 Ga0163162_10275373
509 Ga0157372_10000438
510 Ga0157372_10003756
511 Ga0157372_10038726
512 Ga0157375_10044359
513 Ga0157375_10127196
514 Ga0157375_10129524
515 Ga0163163_10000276
516 Ga0163163_10011633
517 Ga0163163_10018134
518 Ga0157377_10002350
519 Ga0157377_10013525
520 Ga0157377_10240401
521 Ga0157379_10046596
522 Ga0157379_10059600
523 Ga0157379_10536028
524 Ga0157376_10002217
525 Ga0183373_1004
526 Ga0163161_10040468
527 Ga0163161_10041776
528 Ga0163161_10114170
529 Ga0213876_10073756
530 Ga0209436_100233
531 Ga0209455_1002651
532 Ga0209130_1002933
533 Ga0209676_1000001
534 Ga0209050_1000018
535 Ga0207426_1000539
536 Ga0209257_1000001
537 Ga0207656_10010332
538 Ga0207688_10279137
539 Ga0207647_10031099
540 Ga0207647_10084701
541 Ga0207647_10188512
542 Ga0207645_10089954
543 Ga0207654_10012174
544 Ga0207707_10317726
545 Ga0207695_10087761
546 Ga0207695_10125340
547 Ga0207695_10285317
548 Ga0207695_10655868
549 Ga0207649_10003101
550 Ga0207649_10127001
551 Ga0207681_10341635
552 Ga0207650_10035430
553 Ga0207650_10049501
554 Ga0207650_10257598
555 Ga0207690_10011379
556 Ga0207690_10095916
557 Ga0207706_10011453
558 Ga0207706_10026125
559 Ga0207706_10349075
560 Ga0207686_10269896
561 Ga0207670_10008042
562 Ga0207670_10045886
563 Ga0207704_10109406
564 Ga0207704_10162463
565 Ga0207689_10004213
566 Ga0207689_10008332
567 Ga0207661_10015054
568 Ga0207661_10020062
569 Ga0207661_10039724
570 Ga0207661_10073216
571 Ga0207679_10006459
572 Ga0207679_10021204
573 Ga0207679_10051508
574 Ga0207679_10133166
575 Ga0207667_10061891
576 Ga0207667_10061938
577 Ga0207667_10445533
578 Ga0207667_10470678
579 Ga0207651_10094346
580 Ga0207651_10150783
581 Ga0207712_10000442
582 Ga0207712_10119096
583 Ga0207658_10015293
584 Ga0207658_10016068
585 Ga0207677_10039298
586 Ga0207677_10085001
587 Ga0207677_10370253
588 Ga0207703_10782900
589 Ga0207639_10025599
590 Ga0207639_10051654
591 Ga0207639_10458149
592 Ga0207639_10603048
593 Ga0207639_10735818
594 Ga0207678_10018052
595 Ga0207678_10045993
596 Ga0207708_10231942
597 Ga0207702_10000288
598 Ga0207702_10034520
599 Ga0207641_10057491
600 Ga0207676_10008559
601 Ga0207676_10031153
602 Ga0207676_10042583
603 Ga0207674_10007545
604 Ga0207674_10015716
605 Ga0207674_10023217
606 Ga0207674_10177006
607 Ga0207675_100044126
608 Ga0207675_100341829
609 Ga0207698_10158478
610 Ga0268266_10069872
611 Ga0268266_10608793
612 Ga0307515_10000479
613 Ga0307515_10323916
614 Ga0265327_10000084
615 Ga0307516_10010225
616 Ga0307415_100880651
617 Ga0373937_0394425
618 Ga0436365_1878535
619 Ga0439441_000400
620 Ga0439460_0041688
621 Ga0451576_0001894
622 Ga0495650_0000025
623 Ga0495650_0000447
624 Ga0495585_0000017
625 Ga0495585_0000116
626 Ga0495583_0020225
627 Ga0495606_0000026
628 Ga0495606_0000844
629 Ga0495606_0055094
630 Ga0495610_0000197
631 Ga0495610_0002228
632 Ga0495616_0002102
633 Ga0495616_0005934
634 Ga0495632_0133125
635 Ga0495637_0019193
636 Ga0495637_0055566
637 Ga0495609_0074973
638 Ga0495633_0000043
639 Ga0495633_0003971
640 Ga0495625_0000008
641 Ga0495625_0000021
642 Ga0495625_0006096
643 Ga0495661_0006379
644 Ga0495661_0014134
645 Ga0495658_0374699
646 Ga0495671_0015777
647 Ga0495649_0000006
648 Ga0495649_0005506
649 Ga0495687_006931
650 Ga0495686_0048802
651 Ga0496111_0652809
652 Ga0501241_002130
653 nmdc:mga0k408_14761_c1
654 nmdc:mga0k408_4657_c1
655 nmdc:mga05p37_40028_c1
656 nmdc:mga0a205_863639_c1
657 Ga0500618_018792
658 Ga0500622_0000016
659 Ga0500622_0070098
660 2599480120
661 2738761042
662 2739588950
663 2776613225
664 2839990939
665 2928083563
666 2928151175
667 2932084475
668 2932088413

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

4

110

0.91

PF04397

LytTR

LytTr DNA-binding domain

156

250

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7od9-assembly1.cif.gz_B crystal structure of activated chey fused to the c-terminal domain of chef 0.9203 2 115
5w43-assembly1.cif.gz_A structure of the two-component response regulator rcsb-dna complex 0.9195 2 115
5vxn-assembly2.cif.gz_C structure of two rcsb dimers bound to two parallel dnas. 0.9173 2 115
3ffw-assembly1.cif.gz_A crystal structure of chey triple mutant f14q, n59k, e89y complexed with bef3- and mn2+ 0.9155 3 115
5vxn-assembly1.cif.gz_A structure of two rcsb dimers bound to two parallel dnas. 0.9148 2 115
ID Description Score Start End Superfamily
af_P0DMC7_1_147_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9253 1 115 3.40.50.2300
af_P60611_1_129_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9246 4 115 3.40.50.2300
af_P0AD01_1_135_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9246 4 115 3.40.50.2300
af_P0AFT5_1_126_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9185 4 119 3.40.50.2300
af_P60611_135_244_2.40.50.1020 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);LytTr DNA-binding domain 0.9162 132 230 2.40.50.1020
ID Description Score Start End GO Terms
AF-A0A4Q5YEC4-F1-model_v4 Response regulator 0.9877 4 114 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1K1NG08-F1-model_v4 Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains 0.9708 4 115 GO:0000160
GO:0003677
GO:0006355
AF-A0A4Q8QFW8-F1-model_v4 Response regulator 0.9691 3 115 GO:0000160
AF-A0A519UEC9-F1-model_v4 Response regulator 0.9689 4 114 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1F2VPX2-F1-model_v4 Response regulatory domain-containing protein 0.9605 4 115 GO:0000160
GO:0016791

Map