F411713

General Info

Members Datasets Scaffolds Average Seq Length
334 226 668 271

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10010611|Ga0081455_100106115
Length 306
Sequence MVLVAGARRMTWDMASLYGYNPCRHTEEIMAETLDKSRRIVFTGASGGIGTMTRPLLAKLYPGLVLSDRVKPKDLQPGETFVAADLTKPDEVAAAVTGAHSVIHLGGHSVEGTWDQILNANIVGCYNLFEAARQAGVKRVIFASSNHAVGFYPRKRKIGTDVTVRPDSRYGVSKAFGEALGALYSDKHGMAVTCLRIGNVGPRPLDVRRLSIWISPEDIVQLFRIGLEHPDIRFEILYGASDNAASWWDNSRARQLGYRPSGKGEDHRPHAEAEQSKIGADPVGDLFQGGTFTSAEFSNDVKRAGP

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
109 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
113 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
134 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
220 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
221 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 2643221651 Afipia sp. Root123D2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.6
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.18
Nodule 0
Rhizoplane 4.49
Rhizosphere 84.13
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10010611 3300005937 Bacteria 9321
2 JGI25404J52841_10014907 3300003659 Bacteria 1687
3 Ga0070658_10039900 3300005327 Bacteria 3788
4 Ga0070683_100029635 3300005329 Bacteria 4958
5 Ga0068869_100018235 3300005334 Bacteria 4774
6 Ga0070680_100006050 3300005336 Bacteria 9164
7 Ga0070680_100037502 3300005336 Bacteria 3917
8 Ga0070689_100009108 3300005340 Bacteria 7028
9 Ga0070689_100073026 3300005340 Bacteria 2682
10 Ga0070691_10050968 3300005341 Bacteria 1975
11 Ga0070668_100161915 3300005347 Bacteria 1816
12 Ga0070669_100119183 3300005353 Bacteria 2011
13 Ga0070675_100374121 3300005354 Bacteria 1267
14 Ga0070659_100111205 3300005366 Bacteria 2212
15 Ga0070703_10004084 3300005406 Bacteria 4120
16 Ga0070701_10008313 3300005438 Bacteria 4483
17 Ga0070705_100000109 3300005440 Bacteria 46841
18 Ga0070700_100000924 3300005441 Bacteria 14528
19 Ga0070694_100001730 3300005444 Bacteria 12866
20 Ga0070708_100024316 3300005445 Bacteria 5166
21 Ga0070708_100067152 3300005445 Bacteria 3219
22 Ga0070678_100303444 3300005456 Bacteria 1358
23 Ga0070681_10268039 3300005458 Bacteria 1619
24 Ga0070706_100057150 3300005467 Bacteria 3600
25 Ga0070706_100237025 3300005467 Bacteria 1704
26 Ga0070707_100102807 3300005468 Bacteria 2769
27 Ga0070707_100227365 3300005468 Bacteria 1817
28 Ga0070698_100005878 3300005471 Bacteria 13396
29 Ga0070698_100130837 3300005471 Bacteria 2465
30 Ga0070699_100000687 3300005518 Bacteria 31517
31 Ga0070699_100031228 3300005518 Bacteria 4598
32 Ga0070684_100062311 3300005535 Bacteria 3266
33 Ga0070697_100059019 3300005536 Bacteria 3123
34 Ga0070686_100259438 3300005544 Bacteria 1273
35 Ga0070696_100002231 3300005546 Bacteria 12775
36 Ga0070693_100075161 3300005547 Bacteria 2000
37 Ga0070704_100002342 3300005549 Bacteria 10627
38 Ga0070664_100074646 3300005564 Bacteria 2911
39 Ga0068857_100053626 3300005577 Bacteria 3577
40 Ga0068856_100027121 3300005614 Bacteria 5588
41 Ga0068856_100491210 3300005614 Bacteria 1248
42 Ga0070702_100452464 3300005615 Bacteria 932
43 Ga0068852_100126777 3300005616 Bacteria 2345
44 Ga0068859_100001135 3300005617 Bacteria 27124
45 Ga0068864_100016017 3300005618 Bacteria 6237
46 Ga0068864_100721309 3300005618 Bacteria 975
47 Ga0068861_100417904 3300005719 Bacteria 1194
48 Ga0068863_100230837 3300005841 Bacteria 1785
49 Ga0068862_100004667 3300005844 Bacteria 11540
50 Ga0068862_100116196 3300005844 Bacteria 2353
51 Ga0081455_10009609 3300005937 Bacteria 9932
52 Ga0081455_10013628 3300005937 Bacteria 8010
53 Ga0081455_10056207 3300005937 Bacteria 3343
54 Ga0081540_1001062 3300005983 Bacteria 24441
55 Ga0081539_10001566 3300005985 Bacteria 37942
56 Ga0081539_10014051 3300005985 Bacteria 5959
57 Ga0075365_10023979 3300006038 Bacteria 3843
58 Ga0075365_10064948 3300006038 Bacteria 2446
59 Ga0075365_10068181 3300006038 Bacteria 2390
60 Ga0075368_10032552 3300006042 Bacteria 2026
61 Ga0070712_100291548 3300006175 Bacteria 1317
62 Ga0075362_10037701 3300006177 Bacteria 2121
63 Ga0075362_10037770 3300006177 Bacteria 2119
64 Ga0075362_10115652 3300006177 Bacteria 1266
65 Ga0075362_10166340 3300006177 Bacteria 1064
66 Ga0075367_10012508 3300006178 Bacteria 4529
67 Ga0075369_10002147 3300006186 Bacteria 6962
68 Ga0075369_10008656 3300006186 Bacteria 3925
69 Ga0075369_10096143 3300006186 Bacteria 1325
70 Ga0075369_10199133 3300006186 Bacteria 924
71 Ga0075370_10017132 3300006353 Bacteria 3910
72 Ga0075370_10260805 3300006353 Bacteria 1028
73 Ga0075428_100020274 3300006844 Bacteria 7363
74 Ga0075428_100456896 3300006844 Bacteria 1368
75 Ga0075430_100178836 3300006846 Bacteria 1764
76 Ga0075431_100184073 3300006847 Bacteria 2143
77 Ga0068865_100328766 3300006881 Bacteria 1232
78 Ga0097620_100001135 3300006931 Bacteria 27124
79 Ga0105240_10112087 3300009093 Bacteria 3298
80 Ga0105240_10413536 3300009093 Bacteria 1517
81 Ga0111539_10237230 3300009094 Bacteria 2123
82 Ga0111539_10397032 3300009094 Bacteria 1606
83 Ga0105245_10808137 3300009098 Bacteria 976
84 Ga0114129_10036579 3300009147 Bacteria 6932
85 Ga0114129_10698685 3300009147 Bacteria 1304
86 Ga0105241_10049908 3300009174 Bacteria 3189
87 Ga0105241_10069088 3300009174 Bacteria 2738
88 Ga0105248_10891612 3300009177 Bacteria 1004
89 Ga0105249_10002068 3300009553 Bacteria 17398
90 Ga0105246_10012173 3300011119 Bacteria 5360
91 Ga0157373_10062171 3300013100 Bacteria 2644
92 Ga0157370_10040310 3300013104 Bacteria 4509
93 Ga0157378_10102142 3300013297 Bacteria 2619
94 Ga0157376_10082182 3300014969 Bacteria 2768
95 Ga0206354_10695614 3300020081 Bacteria 1275
96 Ga0206353_10125089 3300020082 Bacteria 1088
97 Ga0207426_1009153 3300025302 Bacteria 3938
98 Ga0207653_10000927 3300025885 Bacteria 9715
99 Ga0207699_10210331 3300025906 Bacteria 1323
100 Ga0207705_10150691 3300025909 Bacteria 1743
101 Ga0207654_10113089 3300025911 Bacteria 1692
102 Ga0207707_10019135 3300025912 Bacteria 5976
103 Ga0207695_10023529 3300025913 Bacteria 6956
104 Ga0207695_10166897 3300025913 Bacteria 2129
105 Ga0207695_10267673 3300025913 Bacteria 1605
106 Ga0207693_10001794 3300025915 Bacteria 18812
107 Ga0207693_10036752 3300025915 Bacteria 3861
108 Ga0207660_10023599 3300025917 Bacteria 4156
109 Ga0207660_10025473 3300025917 Bacteria 4014
110 Ga0207649_10196092 3300025920 Bacteria 1423
111 Ga0207652_10143272 3300025921 Bacteria 2137
112 Ga0207646_10237749 3300025922 Bacteria 1646
113 Ga0207646_10238112 3300025922 Bacteria 1644
114 Ga0207694_10114016 3300025924 Bacteria 2152
115 Ga0207650_10075117 3300025925 Bacteria 2549
116 Ga0207687_10657163 3300025927 Bacteria 887
117 Ga0207644_10196211 3300025931 Bacteria 1590
118 Ga0207644_10336396 3300025931 Bacteria 1223
119 Ga0207670_10025657 3300025936 Bacteria 3703
120 Ga0207670_10044337 3300025936 Bacteria 2942
121 Ga0207704_10131301 3300025938 Bacteria 1735
122 Ga0207661_10148199 3300025944 Bacteria 2026
123 Ga0207712_10001217 3300025961 Bacteria 17751
124 Ga0207668_10133153 3300025972 Bacteria 1901
125 Ga0207640_10334248 3300025981 Bacteria 1211
126 Ga0207703_10598849 3300026035 Bacteria 1042
127 Ga0207678_10019422 3300026067 Bacteria 5969
128 Ga0207708_10001143 3300026075 Bacteria 19931
129 Ga0207702_10067552 3300026078 Bacteria 3068
130 Ga0207702_10684008 3300026078 Bacteria 1010
131 Ga0207674_10001741 3300026116 Bacteria 27826
132 Ga0207674_10053060 3300026116 Bacteria 4133
133 Ga0207674_10105803 3300026116 Bacteria 2791
134 Ga0207674_10355522 3300026116 Bacteria 1416
135 Ga0207674_10937680 3300026116 Bacteria 834
136 Ga0207675_100048775 3300026118 Bacteria 3952
137 Ga0207683_10055434 3300026121 Bacteria 3476
138 Ga0207698_10124917 3300026142 Bacteria 2186
139 Ga0207698_10159954 3300026142 Bacteria 1968
140 Ga0268266_10002972 3300028379 Bacteria 17478
141 Ga0268265_10468703 3300028380 Bacteria 1180
142 Ga0268264_10002183 3300028381 Bacteria 17395
143 Ga0268264_10693133 3300028381 Bacteria 1011
144 Ga0265313_10001817 3300031595 Bacteria 19506
145 Ga0265313_10007913 3300031595 Bacteria 7152
146 Ga0265342_10105577 3300031712 Bacteria 1600
147 Ga0307413_10019509 3300031824 Bacteria 3585
148 Ga0307410_10022414 3300031852 Bacteria 3904
149 Ga0307416_100257082 3300032002 Bacteria 1704
150 Ga0307411_10017355 3300032005 Bacteria 4099
151 Ga0373938_0021583 3300034957 Bacteria 1307
152 Ga0373926_0084840 3300035083 Bacteria 1174
153 Ga0373923_0003299 3300035111 Bacteria 5150
154 Ga0373936_0000090 3300035113 Bacteria 32876
155 Ga0373941_0000722 3300035115 Bacteria 6791
156 Ga0373953_0030053 3300035117 Bacteria 2104
157 Ga0373954_0001188 3300035118 Bacteria 10452
158 Ga0373956_0015859 3300035119 Bacteria 3160
159 Ga0373943_0019710 3300035170 Bacteria 3104
160 Ga0373943_0165508 3300035170 Bacteria 1207
161 Ga0373946_0000606 3300035171 Bacteria 11883
162 Ga0373955_0000428 3300035172 Bacteria 17775
163 Ga0373931_0003942 3300035691 Bacteria 6717
164 Ga0373935_0013224 3300035692 Bacteria 4977
165 Ga0373933_0002376 3300035724 Bacteria 10639
166 Ga0373947_0003494 3300035725 Bacteria 9283
167 Ga0373937_0000003 3300036401 Bacteria 235408
168 Ga0373937_0139682 3300036401 Bacteria 2266
169 Ga0373937_0331349 3300036401 Bacteria 1441
170 Ga0373925_0000052 3300037068 Bacteria 127490
171 Ga0373925_0531660 3300037068 Bacteria 966
172 Ga0395899_0011274 3300037312 Bacteria 6846
173 Ga0395899_0014443 3300037312 Bacteria 6028
174 Ga0395899_0016581 3300037312 Bacteria 5619
175 Ga0395899_0034806 3300037312 Bacteria 3783
176 Ga0395899_0052950 3300037312 Bacteria 3007
177 Ga0395900_0001834 3300037418 Bacteria 24209
178 Ga0395900_0008489 3300037418 Bacteria 10560
179 Ga0395900_0061178 3300037418 Bacteria 3872
180 Ga0395900_0067250 3300037418 Bacteria 3681
181 Ga0395898_0002110 3300037466 Bacteria 24600
182 Ga0395898_0015677 3300037466 Bacteria 7766
183 Ga0395905_0276737 3300037471 Bacteria 1564
184 Ga0436364_1081908 3300037853 Bacteria 1902
185 Ga0395901_0008205 3300038443 Bacteria 10549
186 Ga0395901_0010089 3300038443 Bacteria 9570
187 Ga0395901_0013388 3300038443 Bacteria 8335
188 Ga0395901_0065428 3300038443 Bacteria 3785
189 Ga0395901_0093287 3300038443 Bacteria 3152
190 Ga0395901_0237106 3300038443 Bacteria 1903
191 Ga0436365_0068438 3300039437 Bacteria 915
192 Ga0436360_0284379 3300039438 Bacteria 2371
193 Ga0436360_0305574 3300039438 Bacteria 1046
194 Ga0436361_0745733 3300039447 Bacteria 2377
195 Ga0436362_1036687 3300039453 Bacteria 1088
196 Ga0466963_0107807 3300044694 Bacteria 1910
197 Ga0466967_0044762 3300045976 Bacteria 3841
198 Ga0495592_0000051 3300046454 Bacteria 111216
199 Ga0495629_0013297 3300046459 Bacteria 5938
200 Ga0495651_0001358 3300046462 Bacteria 18936
201 Ga0495653_0000071 3300046463 Bacteria 86572
202 Ga0495662_0000895 3300046476 Bacteria 14547
203 Ga0495664_0000015 3300046477 Bacteria 192569
204 Ga0495608_0000025 3300046511 Bacteria 158132
205 Ga0495618_0000022 3300046514 Bacteria 127582
206 Ga0495628_0000011 3300046516 Bacteria 225267
207 Ga0495630_0001200 3300046517 Bacteria 17880
208 Ga0495652_0000014 3300046529 Bacteria 225484
209 Ga0495640_0000008 3300046533 Bacteria 220320
210 Ga0495586_0109548 3300046535 Bacteria 1536
211 Ga0495587_0000015 3300046536 Bacteria 187415
212 Ga0495645_0000020 3300046543 Bacteria 143867
213 Ga0495667_0000013 3300046559 Bacteria 220294
214 Ga0495634_0000043 3300046642 Bacteria 99897
215 Ga0495635_0000012 3300046663 Bacteria 225271
216 Ga0495657_0000048 3300046675 Bacteria 104278
217 Ga0495599_0000008 3300046678 Bacteria 225534
218 Ga0495623_0000002 3300046679 Bacteria 166669
219 Ga0495646_0000004 3300046680 Bacteria 268993
220 Ga0495613_0088389 3300046689 Bacteria 2245
221 Ga0495624_0010573 3300046690 Bacteria 6359
222 Ga0495600_0000024 3300046809 Bacteria 92414
223 Ga0495581_0080688 3300047315 Bacteria 1883
224 Ga0495604_0000001 3300047317 Bacteria 708627
225 Ga0495674_0000023 3300047319 Bacteria 157443
226 Ga0495680_0000233 3300047322 Bacteria 60821
227 Ga0495675_0000023 3300047444 Bacteria 111081
228 Ga0495684_0000007 3300047471 Bacteria 225614
229 Ga0495593_0001125 3300047673 Bacteria 15563
230 Ga0495602_0000045 3300048088 Bacteria 118132
231 Ga0496102_0002655 3300048905 Bacteria 15211
232 Ga0496104_0007587 3300048907 Bacteria 9603
233 Ga0496104_0016778 3300048907 Bacteria 6655
234 Ga0496104_0475052 3300048907 Bacteria 1162
235 Ga0496105_0016603 3300048908 Bacteria 5878
236 Ga0496105_0386804 3300048908 Bacteria 1113
237 Ga0496106_0003203 3300048909 Bacteria 12249
238 Ga0496108_0018499 3300048911 Bacteria 5705
239 Ga0496108_0231051 3300048911 Bacteria 1608
240 Ga0496109_0009939 3300048912 Bacteria 8125
241 Ga0496110_0146423 3300048913 Bacteria 2136
242 Ga0496111_0005061 3300048914 Bacteria 8389
243 Ga0496112_0028729 3300048915 Bacteria 5371
244 Ga0496115_0036765 3300048918 Bacteria 3878
245 Ga0496115_0070199 3300048918 Bacteria 2839
246 Ga0496126_0012440 3300048929 Bacteria 8717
247 Ga0501031_0060939 3300049568 Bacteria 2459
248 Ga0501032_0020372 3300049569 Bacteria 4619
249 Ga0501033_0020502 3300049570 Bacteria 4994
250 Ga0501033_0134965 3300049570 Bacteria 1786
251 Ga0501033_0188734 3300049570 Bacteria 1475
252 Ga0501034_0002658 3300049571 Bacteria 21149
253 Ga0501034_0008762 3300049571 Bacteria 10647
254 Ga0501034_0011574 3300049571 Bacteria 9135
255 Ga0501034_0046278 3300049571 Bacteria 4395
256 Ga0501034_0291907 3300049571 Bacteria 1568
257 Ga0501036_0001220 3300049572 Bacteria 19652
258 Ga0501036_0026889 3300049572 Bacteria 4861
259 Ga0501036_0075770 3300049572 Bacteria 2845
260 Ga0501037_0030275 3300049573 Bacteria 4000
261 Ga0501037_0057784 3300049573 Bacteria 2831
262 Ga0501038_0032113 3300049574 Bacteria 4634
263 Ga0501038_0164361 3300049574 Bacteria 1801
264 Ga0501040_0061100 3300049576 Bacteria 2591
265 Ga0501043_0012113 3300049579 Bacteria 6744
266 Ga0501043_0022705 3300049579 Bacteria 4920
267 Ga0501043_0027401 3300049579 Bacteria 4473
268 Ga0501046_0029215 3300049580 Bacteria 4484
269 Ga0501046_0138582 3300049580 Bacteria 1842
270 Ga0501046_0246773 3300049580 Bacteria 1315
271 Ga0501047_0002952 3300049581 Bacteria 16116
272 Ga0501047_0034679 3300049581 Bacteria 4872
273 Ga0501047_0058595 3300049581 Bacteria 3720
274 Ga0501047_0090142 3300049581 Bacteria 2943
275 Ga0501048_0016886 3300049582 Bacteria 5381
276 Ga0501067_0010791 3300049583 Bacteria 5053
277 Ga0501067_0106444 3300049583 Bacteria 1558
278 Ga0501068_0004233 3300049584 Bacteria 7783
279 Ga0501068_0019863 3300049584 Bacteria 3907
280 Ga0501070_0010469 3300049586 Bacteria 7842
281 Ga0501070_0055334 3300049586 Bacteria 3288
282 Ga0501070_0087332 3300049586 Bacteria 2581
283 Ga0501070_0164142 3300049586 Bacteria 1830
284 Ga0501073_0013276 3300049589 Bacteria 6002
285 Ga0501073_0026866 3300049589 Bacteria 4121
286 Ga0501073_0029639 3300049589 Bacteria 3910
287 Ga0501073_0384675 3300049589 Bacteria 969
288 Ga0501074_0068747 3300049590 Bacteria 2546
289 Ga0501076_0077109 3300049592 Bacteria 2673
290 Ga0501077_0125127 3300049593 Bacteria 1630
291 Ga0501079_0125193 3300049741 Bacteria 1999
292 Ga0501080_0000628 3300049742 Bacteria 27971
293 Ga0501080_0010071 3300049742 Bacteria 8641
294 Ga0501080_0398407 3300049742 Bacteria 1238
295 Ga0501083_0004186 3300049744 Bacteria 10156
296 Ga0501083_0056945 3300049744 Bacteria 2618
297 Ga0501035_0052057 3300049822 Bacteria 3664
298 Ga0501035_0117398 3300049822 Bacteria 2328
299 Ga0501035_0220125 3300049822 Bacteria 1621
300 Ga0501035_0359768 3300049822 Bacteria 1216
301 Ga0501044_0006674 3300049823 Bacteria 12723
302 Ga0501044_0304887 3300049823 Bacteria 1520
303 Ga0501044_0538737 3300049823 Bacteria 1065
304 nmdc:mga03683_26595_c1 3300050489 Bacteria 2283
305 nmdc:mga03683_59817_c1 3300050489 Bacteria 1608
306 nmdc:mga00v17_407061_c1 3300050491 Bacteria 884
307 nmdc:mga0yw44_24358_c1 3300050492 Bacteria 2444
308 nmdc:mga0yw44_26066_c1 3300050492 Bacteria 3334
309 nmdc:mga0yw44_30303_c1 3300050492 Bacteria 3133
310 nmdc:mga0yw44_52181_c1 3300050492 Bacteria 2478
311 nmdc:mga0k408_4310_c1 3300050493 Bacteria 7557
312 nmdc:mga07m45_299571_c1 3300050496 Bacteria 935
313 nmdc:mga07m45_3424_c1 3300050496 Bacteria 7642
314 nmdc:mga05p37_553349_c1 3300050507 Bacteria 1309
315 nmdc:mga0qj67_136927_c1 3300050509 Bacteria 1984
316 nmdc:mga06r32_169527_c1 3300050510 Bacteria 2166
317 nmdc:mga06r32_249412_c1 3300050510 Bacteria 1763
318 nmdc:mga08y16_187686_c1 3300050511 Bacteria 2145
319 nmdc:mga0sz30_1103_c1 3300050516 Bacteria 9701
320 nmdc:mga0sz30_38589_c1 3300050516 Bacteria 2001
321 nmdc:mga0sz30_4136_c1 3300050516 Bacteria 5230
322 Ga0495601_0000014 3300053077 Bacteria 220318
323 Ga0495612_0000014 3300053078 Bacteria 187444
324 Ga0495595_0000160 3300053084 Bacteria 26780
325 Ga0495619_0000006 3300053085 Bacteria 384835
326 Ga0500651_0069767 3300053093 Bacteria 2188
327 Ga0500566_0124062 3300053094 Unclassified 1389
328 Ga0500641_0000678 3300053096 Bacteria 12275
329 Ga0500616_0000335 3300053153 Bacteria 67106
330 Ga0500552_001761 3300053733 Bacteria 2070
331 Ga0501084_0076006 3300054114 Bacteria 2814
332 Ga0501082_0032819 3300060353 Bacteria 4478
333 Ga0501082_0232951 3300060353 Bacteria 1603
334 2644291295 2643221651 Bacteria 4798932
335 Ga0081455_10010611
336 JGI25404J52841_10014907
337 Ga0070658_10039900
338 Ga0070683_100029635
339 Ga0068869_100018235
340 Ga0070680_100006050
341 Ga0070680_100037502
342 Ga0070689_100009108
343 Ga0070689_100073026
344 Ga0070691_10050968
345 Ga0070668_100161915
346 Ga0070669_100119183
347 Ga0070675_100374121
348 Ga0070659_100111205
349 Ga0070703_10004084
350 Ga0070701_10008313
351 Ga0070705_100000109
352 Ga0070700_100000924
353 Ga0070694_100001730
354 Ga0070708_100024316
355 Ga0070708_100067152
356 Ga0070678_100303444
357 Ga0070681_10268039
358 Ga0070706_100057150
359 Ga0070706_100237025
360 Ga0070707_100102807
361 Ga0070707_100227365
362 Ga0070698_100005878
363 Ga0070698_100130837
364 Ga0070699_100000687
365 Ga0070699_100031228
366 Ga0070684_100062311
367 Ga0070697_100059019
368 Ga0070686_100259438
369 Ga0070696_100002231
370 Ga0070693_100075161
371 Ga0070704_100002342
372 Ga0070664_100074646
373 Ga0068857_100053626
374 Ga0068856_100027121
375 Ga0068856_100491210
376 Ga0070702_100452464
377 Ga0068852_100126777
378 Ga0068859_100001135
379 Ga0068864_100016017
380 Ga0068864_100721309
381 Ga0068861_100417904
382 Ga0068863_100230837
383 Ga0068862_100004667
384 Ga0068862_100116196
385 Ga0081455_10009609
386 Ga0081455_10013628
387 Ga0081455_10056207
388 Ga0081540_1001062
389 Ga0081539_10001566
390 Ga0081539_10014051
391 Ga0075365_10023979
392 Ga0075365_10064948
393 Ga0075365_10068181
394 Ga0075368_10032552
395 Ga0070712_100291548
396 Ga0075362_10037701
397 Ga0075362_10037770
398 Ga0075362_10115652
399 Ga0075362_10166340
400 Ga0075367_10012508
401 Ga0075369_10002147
402 Ga0075369_10008656
403 Ga0075369_10096143
404 Ga0075369_10199133
405 Ga0075370_10017132
406 Ga0075370_10260805
407 Ga0075428_100020274
408 Ga0075428_100456896
409 Ga0075430_100178836
410 Ga0075431_100184073
411 Ga0068865_100328766
412 Ga0097620_100001135
413 Ga0105240_10112087
414 Ga0105240_10413536
415 Ga0111539_10237230
416 Ga0111539_10397032
417 Ga0105245_10808137
418 Ga0114129_10036579
419 Ga0114129_10698685
420 Ga0105241_10049908
421 Ga0105241_10069088
422 Ga0105248_10891612
423 Ga0105249_10002068
424 Ga0105246_10012173
425 Ga0157373_10062171
426 Ga0157370_10040310
427 Ga0157378_10102142
428 Ga0157376_10082182
429 Ga0206354_10695614
430 Ga0206353_10125089
431 Ga0207426_1009153
432 Ga0207653_10000927
433 Ga0207699_10210331
434 Ga0207705_10150691
435 Ga0207654_10113089
436 Ga0207707_10019135
437 Ga0207695_10023529
438 Ga0207695_10166897
439 Ga0207695_10267673
440 Ga0207693_10001794
441 Ga0207693_10036752
442 Ga0207660_10023599
443 Ga0207660_10025473
444 Ga0207649_10196092
445 Ga0207652_10143272
446 Ga0207646_10237749
447 Ga0207646_10238112
448 Ga0207694_10114016
449 Ga0207650_10075117
450 Ga0207687_10657163
451 Ga0207644_10196211
452 Ga0207644_10336396
453 Ga0207670_10025657
454 Ga0207670_10044337
455 Ga0207704_10131301
456 Ga0207661_10148199
457 Ga0207712_10001217
458 Ga0207668_10133153
459 Ga0207640_10334248
460 Ga0207703_10598849
461 Ga0207678_10019422
462 Ga0207708_10001143
463 Ga0207702_10067552
464 Ga0207702_10684008
465 Ga0207674_10001741
466 Ga0207674_10053060
467 Ga0207674_10105803
468 Ga0207674_10355522
469 Ga0207674_10937680
470 Ga0207675_100048775
471 Ga0207683_10055434
472 Ga0207698_10124917
473 Ga0207698_10159954
474 Ga0268266_10002972
475 Ga0268265_10468703
476 Ga0268264_10002183
477 Ga0268264_10693133
478 Ga0265313_10001817
479 Ga0265313_10007913
480 Ga0265342_10105577
481 Ga0307413_10019509
482 Ga0307410_10022414
483 Ga0307416_100257082
484 Ga0307411_10017355
485 Ga0373938_0021583
486 Ga0373926_0084840
487 Ga0373923_0003299
488 Ga0373936_0000090
489 Ga0373941_0000722
490 Ga0373953_0030053
491 Ga0373954_0001188
492 Ga0373956_0015859
493 Ga0373943_0019710
494 Ga0373943_0165508
495 Ga0373946_0000606
496 Ga0373955_0000428
497 Ga0373931_0003942
498 Ga0373935_0013224
499 Ga0373933_0002376
500 Ga0373947_0003494
501 Ga0373937_0000003
502 Ga0373937_0139682
503 Ga0373937_0331349
504 Ga0373925_0000052
505 Ga0373925_0531660
506 Ga0395899_0011274
507 Ga0395899_0014443
508 Ga0395899_0016581
509 Ga0395899_0034806
510 Ga0395899_0052950
511 Ga0395900_0001834
512 Ga0395900_0008489
513 Ga0395900_0061178
514 Ga0395900_0067250
515 Ga0395898_0002110
516 Ga0395898_0015677
517 Ga0395905_0276737
518 Ga0436364_1081908
519 Ga0395901_0008205
520 Ga0395901_0010089
521 Ga0395901_0013388
522 Ga0395901_0065428
523 Ga0395901_0093287
524 Ga0395901_0237106
525 Ga0436365_0068438
526 Ga0436360_0284379
527 Ga0436360_0305574
528 Ga0436361_0745733
529 Ga0436362_1036687
530 Ga0466963_0107807
531 Ga0466967_0044762
532 Ga0495592_0000051
533 Ga0495629_0013297
534 Ga0495651_0001358
535 Ga0495653_0000071
536 Ga0495662_0000895
537 Ga0495664_0000015
538 Ga0495608_0000025
539 Ga0495618_0000022
540 Ga0495628_0000011
541 Ga0495630_0001200
542 Ga0495652_0000014
543 Ga0495640_0000008
544 Ga0495586_0109548
545 Ga0495587_0000015
546 Ga0495645_0000020
547 Ga0495667_0000013
548 Ga0495634_0000043
549 Ga0495635_0000012
550 Ga0495657_0000048
551 Ga0495599_0000008
552 Ga0495623_0000002
553 Ga0495646_0000004
554 Ga0495613_0088389
555 Ga0495624_0010573
556 Ga0495600_0000024
557 Ga0495581_0080688
558 Ga0495604_0000001
559 Ga0495674_0000023
560 Ga0495680_0000233
561 Ga0495675_0000023
562 Ga0495684_0000007
563 Ga0495593_0001125
564 Ga0495602_0000045
565 Ga0496102_0002655
566 Ga0496104_0007587
567 Ga0496104_0016778
568 Ga0496104_0475052
569 Ga0496105_0016603
570 Ga0496105_0386804
571 Ga0496106_0003203
572 Ga0496108_0018499
573 Ga0496108_0231051
574 Ga0496109_0009939
575 Ga0496110_0146423
576 Ga0496111_0005061
577 Ga0496112_0028729
578 Ga0496115_0036765
579 Ga0496115_0070199
580 Ga0496126_0012440
581 Ga0501031_0060939
582 Ga0501032_0020372
583 Ga0501033_0020502
584 Ga0501033_0134965
585 Ga0501033_0188734
586 Ga0501034_0002658
587 Ga0501034_0008762
588 Ga0501034_0011574
589 Ga0501034_0046278
590 Ga0501034_0291907
591 Ga0501036_0001220
592 Ga0501036_0026889
593 Ga0501036_0075770
594 Ga0501037_0030275
595 Ga0501037_0057784
596 Ga0501038_0032113
597 Ga0501038_0164361
598 Ga0501040_0061100
599 Ga0501043_0012113
600 Ga0501043_0022705
601 Ga0501043_0027401
602 Ga0501046_0029215
603 Ga0501046_0138582
604 Ga0501046_0246773
605 Ga0501047_0002952
606 Ga0501047_0034679
607 Ga0501047_0058595
608 Ga0501047_0090142
609 Ga0501048_0016886
610 Ga0501067_0010791
611 Ga0501067_0106444
612 Ga0501068_0004233
613 Ga0501068_0019863
614 Ga0501070_0010469
615 Ga0501070_0055334
616 Ga0501070_0087332
617 Ga0501070_0164142
618 Ga0501073_0013276
619 Ga0501073_0026866
620 Ga0501073_0029639
621 Ga0501073_0384675
622 Ga0501074_0068747
623 Ga0501076_0077109
624 Ga0501077_0125127
625 Ga0501079_0125193
626 Ga0501080_0000628
627 Ga0501080_0010071
628 Ga0501080_0398407
629 Ga0501083_0004186
630 Ga0501083_0056945
631 Ga0501035_0052057
632 Ga0501035_0117398
633 Ga0501035_0220125
634 Ga0501035_0359768
635 Ga0501044_0006674
636 Ga0501044_0304887
637 Ga0501044_0538737
638 nmdc:mga03683_26595_c1
639 nmdc:mga03683_59817_c1
640 nmdc:mga00v17_407061_c1
641 nmdc:mga0yw44_24358_c1
642 nmdc:mga0yw44_26066_c1
643 nmdc:mga0yw44_30303_c1
644 nmdc:mga0yw44_52181_c1
645 nmdc:mga0k408_4310_c1
646 nmdc:mga07m45_299571_c1
647 nmdc:mga07m45_3424_c1
648 nmdc:mga05p37_553349_c1
649 nmdc:mga0qj67_136927_c1
650 nmdc:mga06r32_169527_c1
651 nmdc:mga06r32_249412_c1
652 nmdc:mga08y16_187686_c1
653 nmdc:mga0sz30_1103_c1
654 nmdc:mga0sz30_38589_c1
655 nmdc:mga0sz30_4136_c1
656 Ga0495601_0000014
657 Ga0495612_0000014
658 Ga0495595_0000160
659 Ga0495619_0000006
660 Ga0500651_0069767
661 Ga0500566_0124062
662 Ga0500641_0000678
663 Ga0500616_0000335
664 Ga0500552_001761
665 Ga0501084_0076006
666 Ga0501082_0032819
667 Ga0501082_0232951
668 2644291295

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

43

206

0.89

PF13460

NAD_binding_10

NAD(P)H-binding

44

198

0.84

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

65

196

0.82

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

40

216

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rfx-assembly1.cif.gz_A crystal structure of uronate dehydrogenase from agrobacterium tumefaciens, y136a mutant complexed with nad 0.9561 1 258
3rft-assembly1.cif.gz_A crystal structure of uronate dehydrogenase from agrobacterium tumefaciens 0.9478 1 258
3ay3-assembly2.cif.gz_D crystal structure of glucuronic acid dehydrogeanse from chromohalobacter salexigens 0.9478 2 258
6mfh-assembly1.cif.gz_A mutated uronate dehydrogenase 0.9395 2 267
3rfx-assembly1.cif.gz_A crystal structure of uronate dehydrogenase from agrobacterium tumefaciens, y136a mutant complexed with nad 0.9282 1 258
ID Description Score Start End Superfamily
3rftA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9684 1 226 3.40.50.720
3rftA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.956 1 226 3.40.50.720
3aw9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8656 2 202 3.40.50.720
af_A0A1D6MTK5_41_178_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8629 2 109 3.40.50.720
af_I1KG15_128_276_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8615 2 99 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A537RTH7-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9941 1 188
AF-A0A059WSP6-F1-model_v4 NAD dependent epimerase/dehydratase family 0.9939 7 190
AF-A0A516H2E7-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9924 1 268
AF-A0A537RTH7-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9888 1 188
AF-A0A537ED74-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9863 1 194

Map