F411933

General Info

Members Datasets Scaffolds Average Seq Length
334 223 668 281

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0002388|Ga0495606_0002388_10322_11248
Length 308
Sequence MHFKYVTVKLPWSPRKPFQEIPMIIVTGATGQLGRIVIDQLLARGVPAAGIVAAVRNPAKAADFAARGIVVREADYARPETLEPAFAGAERVLLISSSEVGQRLSQHRVVIDAARKANARQLVYTSLLHADSSPLGLAGEHRDTEAAILASGLTHTILRNGWYTENYLASVPAARQHGAFIGAAGEGRIASATRKDYAAAAAAVLTQGVNGDKVYELAGDVAYTLAELVAELNRQTGGSVHYQNLPQADFAAALVGAGLPPPFAELLADSDAGAAKGALYDDSHQLSALIGRPTTPLAKAMKAALTAE

Samples

Sample ID Description Type Environment
1 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
23 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
24 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
25 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
26 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
39 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
40 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
41 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
42 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
43 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
49 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
59 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
63 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
64 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
65 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
66 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
67 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
70 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
71 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
72 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
73 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
74 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
75 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
76 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
77 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
78 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
79 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
80 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
81 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
82 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
83 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
84 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
85 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
86 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
87 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
94 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
95 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
96 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
97 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
98 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
99 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
100 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
101 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
109 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
112 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
115 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
116 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
117 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
118 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
123 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
124 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
125 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
126 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
127 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
128 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
129 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
132 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
133 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
134 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
141 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
142 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
143 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
144 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
145 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
148 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
149 2547132181 Kosakonia sacchari SP1 Isolate Stem
150 2547132512 Azospira oryzae 6a3 Isolate Unclassified
151 2561511199 Enterobacter sp. R4-368 Isolate Nodule
152 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
153 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
154 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
155 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
156 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
157 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
158 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
159 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
160 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
161 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
162 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
163 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
164 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
165 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
166 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
167 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
168 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
169 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
170 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
171 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
172 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
173 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
174 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
175 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
176 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
177 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
178 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
179 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
180 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
181 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
182 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
183 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
184 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
185 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
186 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
187 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
188 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
189 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
190 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
191 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
192 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
193 2636415599 Klebsiella variicola DX120E Isolate Unclassified
194 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
195 2643221638 Duganella sp. Root336D2 Isolate Unclassified
196 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
197 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
198 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
199 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
200 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
201 2775507074 Klebsiella sp. D5A Isolate Unclassified
202 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
203 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
204 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
205 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
206 2818991450 Burkholderia sp. 604 Isolate Unclassified
207 2876601092 Pantoea endophytica 596 Isolate Unclassified
208 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
209 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
210 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
211 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
212 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
213 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
214 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
215 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
216 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
217 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
218 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
219 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
220 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
221 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
222 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
223 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.25
Metatranscriptomes 0
Isolates 22.75

Biome Distribution

Category Percentage (%)
Aerial Root 0.6
Bulb 0
Endosphere 18.26
Nodule 1.5
Rhizoplane 14.37
Rhizosphere 46.41
Stem 0.3
Stem Tuber 0
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495606_0002388 3300046507 Bacteria 22020
2 JGI25158J39367_1001137 3300002739 Bacteria 4829
3 JGI25152J39213_1002807 3300002773 Bacteria 6292
4 JGI25152J39213_1017754 3300002773 Bacteria 1333
5 JGI25150J39212_1006968 3300002774 Bacteria 2299
6 JGI25159J45721_1000365 3300002987 Bacteria 21057
7 JGI25159J45721_1009244 3300002987 Bacteria 2617
8 rootL2_10159138 3300003322 Bacteria 2511
9 rootH1_10191020 3300003323 Bacteria 1013
10 JGI25161J50226_1000407 3300003374 Bacteria 21057
11 JGI25161J50226_1001312 3300003374 Bacteria 7803
12 Ga0055526_1026591 3300003771 Bacteria 1818
13 Ga0055526_1026643 3300003771 Bacteria 1814
14 Ga0055537_1001985 3300003773 Bacteria 7289
15 Ga0055524_1002578 3300003775 Bacteria 9237
16 Ga0055524_1003266 3300003775 Bacteria 7938
17 Ga0055524_1046379 3300003775 Bacteria 1034
18 Ga0055534_1001719 3300003784 Bacteria 8294
19 Ga0055534_1010030 3300003784 Bacteria 2010
20 Ga0055528_1021145 3300003790 Bacteria 2077
21 Ga0055530_10001783 3300003791 Bacteria 14969
22 Ga0055530_10005121 3300003791 Bacteria 6403
23 Ga0055531_10000818 3300003794 Bacteria 25805
24 Ga0055531_10028013 3300003794 Bacteria 1955
25 Ga0058692_1000088 3300003856 Bacteria 64251
26 Ga0058692_1000425 3300003856 Bacteria 19453
27 Ga0058692_1013074 3300003856 Bacteria 1946
28 Ga0055543_1000546 3300004625 Bacteria 21095
29 Ga0065165_1010796 3300005262 Bacteria 3894
30 Ga0068853_100013017 3300005539 Bacteria 6784
31 Ga0070665_100005069 3300005548 Bacteria 13668
32 Ga0068851_10082809 3300005834 Bacteria 1678
33 Ga0075366_10067166 3300006195 Bacteria 2134
34 Ga0079104_1000617 3300006946 Bacteria 34857
35 Ga0079104_1005403 3300006946 Bacteria 5115
36 Ga0105251_10004841 3300009011 Bacteria 8990
37 Ga0105251_10035055 3300009011 Bacteria 2478
38 Ga0105251_10051371 3300009011 Bacteria 1966
39 Ga0105251_10052378 3300009011 Bacteria 1943
40 Ga0105244_10031788 3300009036 Bacteria 2800
41 Ga0105244_10034325 3300009036 Bacteria 2671
42 Ga0105244_10048931 3300009036 Bacteria 2162
43 Ga0105250_10047670 3300009092 Bacteria 1718
44 Ga0105240_10007984 3300009093 Bacteria 15261
45 Ga0105238_10120336 3300009551 Bacteria 2605
46 Ga0105239_10042661 3300010375 Bacteria 4970
47 Ga0105246_10034116 3300011119 Bacteria 3387
48 Ga0105246_10598109 3300011119 Bacteria 952
49 Ga0157373_10001022 3300013100 Bacteria 21641
50 Ga0157371_10000586 3300013102 Bacteria 43215
51 Ga0157371_10005031 3300013102 Bacteria 11319
52 Ga0157371_10148058 3300013102 Bacteria 1674
53 Ga0157369_10010120 3300013105 Bacteria 10763
54 Ga0157369_10021142 3300013105 Bacteria 7276
55 Ga0163162_10021805 3300013306 Bacteria 6310
56 Ga0157372_10000169 3300013307 Bacteria 72057
57 Ga0157372_10028059 3300013307 Bacteria 6140
58 Ga0182006_1000025 3300015261 Bacteria 255969
59 Ga0163161_10140126 3300017792 Bacteria 1831
60 Ga0213872_10000073 3300021361 Bacteria 91302
61 Ga0213872_10012807 3300021361 Bacteria 3938
62 Ga0209436_100218 3300025208 Bacteria 26371
63 Ga0209436_100682 3300025208 Bacteria 14409
64 Ga0209437_100110 3300025233 Bacteria 215040
65 Ga0207425_1000001 3300025245 Bacteria 2525432
66 Ga0207425_1000109 3300025245 Bacteria 77611
67 Ga0207425_1000122 3300025245 Bacteria 73381
68 Ga0207425_1010532 3300025245 Bacteria 2246
69 Ga0207425_1019268 3300025245 Bacteria 1471
70 Ga0209129_1000003 3300025258 Bacteria 903689
71 Ga0209129_1000008 3300025258 Bacteria 640959
72 Ga0209129_1000964 3300025258 Bacteria 17293
73 Ga0209565_1000560 3300025263 Bacteria 25575
74 Ga0209565_1001427 3300025263 Bacteria 10566
75 Ga0209565_1001853 3300025263 Bacteria 8474
76 Ga0209565_1011866 3300025263 Bacteria 2102
77 Ga0209673_1013530 3300025273 Bacteria 3212
78 Ga0209130_1000171 3300025284 Bacteria 94371
79 Ga0209130_1001864 3300025284 Bacteria 12075
80 Ga0209675_1006570 3300025291 Bacteria 4632
81 Ga0209564_1000095 3300025295 Bacteria 237896
82 Ga0209564_1004770 3300025295 Bacteria 8098
83 Ga0209758_1000668 3300025297 Bacteria 51295
84 Ga0209050_1000011 3300025298 Bacteria 914037
85 Ga0209050_1002570 3300025298 Bacteria 15101
86 Ga0209050_1003063 3300025298 Bacteria 12876
87 Ga0209256_1000987 3300025299 Bacteria 34068
88 Ga0209256_1001953 3300025299 Bacteria 18689
89 Ga0209256_1002118 3300025299 Bacteria 17256
90 Ga0209051_1046146 3300025303 Bacteria 1501
91 Ga0209257_1000003 3300025304 Bacteria 1702593
92 Ga0209257_1004210 3300025304 Bacteria 11405
93 Ga0207696_1000232 3300025711 Bacteria 78423
94 Ga0207696_1009483 3300025711 Bacteria 3628
95 Ga0207696_1037597 3300025711 Bacteria 1432
96 Ga0207655_1002107 3300025728 Bacteria 16645
97 Ga0207655_1005438 3300025728 Bacteria 8659
98 Ga0207655_1012335 3300025728 Bacteria 5002
99 Ga0207655_1021796 3300025728 Bacteria 3236
100 Ga0207655_1028016 3300025728 Bacteria 2666
101 Ga0207713_1000028 3300025735 Bacteria 309074
102 Ga0207713_1015314 3300025735 Bacteria 3943
103 Ga0207713_1047916 3300025735 Bacteria 1725
104 Ga0207647_10003718 3300025904 Bacteria 11407
105 Ga0207695_10077572 3300025913 Bacteria 3374
106 Ga0209281_1000557 3300027111 Bacteria 45338
107 Ga0209281_1000592 3300027111 Bacteria 41903
108 Ga0209371_1000014 3300027312 Bacteria 661118
109 Ga0209371_1000046 3300027312 Bacteria 306549
110 Ga0209371_1000137 3300027312 Bacteria 120900
111 Ga0209371_1000184 3300027312 Bacteria 90920
112 Ga0209371_1000259 3300027312 Bacteria 64107
113 Ga0209371_1002911 3300027312 Bacteria 8939
114 Ga0209371_1004105 3300027312 Bacteria 6545
115 Ga0209371_1004399 3300027312 Bacteria 6167
116 Ga0209371_1031774 3300027312 Bacteria 1141
117 Ga0268266_10060533 3300028379 Bacteria 3264
118 Ga0268264_10208840 3300028381 Bacteria 1791
119 Ga0265337_1026979 3300028556 Bacteria 1735
120 Ga0265324_10000076 3300029957 Bacteria 76602
121 Ga0268256_1000012 3300030500 Bacteria 794553
122 Ga0268256_1000021 3300030500 Bacteria 542735
123 Ga0268256_1000062 3300030500 Bacteria 215802
124 Ga0268256_1000154 3300030500 Bacteria 91615
125 Ga0268256_1000510 3300030500 Bacteria 32695
126 Ga0268256_1002045 3300030500 Bacteria 10884
127 Ga0268256_1003849 3300030500 Bacteria 6545
128 Ga0268256_1004138 3300030500 Bacteria 6167
129 Ga0268256_1005430 3300030500 Bacteria 5002
130 Ga0268256_1018044 3300030500 Bacteria 1971
131 Ga0268256_1036065 3300030500 Bacteria 1143
132 Ga0265332_10000024 3300031238 Bacteria 209663
133 Ga0265339_10000086 3300031249 Bacteria 79034
134 Ga0307509_10023734 3300031507 Bacteria 6876
135 Ga0307408_100000140 3300031548 Bacteria 80709
136 Ga0307408_100001299 3300031548 Bacteria 18704
137 Ga0307408_100003513 3300031548 Bacteria 10675
138 Ga0265313_10002151 3300031595 Bacteria 17525
139 Ga0400484_33482 3300038725 Bacteria 2736
140 Ga0400485_05654 3300038735 Bacteria 11845
141 Ga0400485_15476 3300038735 Bacteria 17000
142 Ga0400488_33556 3300038741 Bacteria 5801
143 Ga0400488_37947 3300038741 Bacteria 5362
144 Ga0400486_16545 3300038742 Bacteria 17067
145 Ga0400486_31881 3300038742 Bacteria 17674
146 Ga0400489_00529 3300039093 Bacteria 8812
147 Ga0400487_06944 3300039110 Bacteria 16691
148 Ga0400487_54961 3300039110 Bacteria 48611
149 Ga0436361_0248769 3300039447 Bacteria 8364
150 Ga0436361_0736070 3300039447 Bacteria 84726
151 Ga0439438_022168 3300041405 Bacteria 1764
152 Ga0439447_002362 3300041407 Bacteria 6893
153 Ga0451800_0731357 3300041459 Unclassified 1342
154 Ga0439452_000005 3300042010 Bacteria 646919
155 Ga0439452_000007 3300042010 Bacteria 613625
156 Ga0439464_0013501 3300042439 Bacteria 2188
157 Ga0466969_0001080 3300044656 Bacteria 14743
158 Ga0466969_0071369 3300044656 Bacteria 1669
159 Ga0466966_0064145 3300044684 Bacteria 2314
160 Ga0466961_0023870 3300044693 Bacteria 3935
161 Ga0466963_0073040 3300044694 Bacteria 2312
162 Ga0466971_0004780 3300044719 Bacteria 5860
163 Ga0466971_0176122 3300044719 Bacteria 1004
164 Ga0466970_0102883 3300044765 Bacteria 1556
165 Ga0466970_0278609 3300044765 Bacteria 940
166 Ga0466959_0010748 3300045049 Bacteria 6557
167 Ga0466959_0258716 3300045049 Bacteria 1198
168 Ga0451576_0013435 3300045051 Bacteria 9162
169 Ga0451576_0121500 3300045051 Bacteria 2719
170 Ga0466958_0024149 3300045836 Bacteria 3576
171 Ga0466958_0062095 3300045836 Bacteria 2277
172 Ga0495627_019316 3300046453 Bacteria 2287
173 Ga0495592_0010299 3300046454 Bacteria 7049
174 Ga0495591_002246 3300046458 Bacteria 11002
175 Ga0495650_0000006 3300046471 Bacteria 721347
176 Ga0495650_0002709 3300046471 Bacteria 13735
177 Ga0495664_0115096 3300046477 Bacteria 1625
178 Ga0495606_0000748 3300046507 Bacteria 50196
179 Ga0495610_0001373 3300046512 Bacteria 21636
180 Ga0495616_0009636 3300046513 Bacteria 5633
181 Ga0495618_0041261 3300046514 Bacteria 2906
182 Ga0495631_0000006 3300046518 Bacteria 132262
183 Ga0495643_0027005 3300046522 Bacteria 3231
184 Ga0495644_0013971 3300046523 Bacteria 3078
185 Ga0495648_0049305 3300046524 Bacteria 2582
186 Ga0495652_0000984 3300046529 Bacteria 32577
187 Ga0495654_0000168 3300046530 Bacteria 64288
188 Ga0495654_0003234 3300046530 Bacteria 10063
189 Ga0495640_0020228 3300046533 Bacteria 4901
190 Ga0495597_0053337 3300046542 Unclassified 1778
191 Ga0495645_0037735 3300046543 Bacteria 3523
192 Ga0495622_0000001 3300046557 Bacteria 365248
193 Ga0495611_0105733 3300046648 Bacteria 1309
194 Ga0495649_0106423 3300046694 Bacteria 1488
195 Ga0495589_0004074 3300046794 Bacteria 7831
196 Ga0495660_0000010 3300046810 Bacteria 370769
197 Ga0495674_0019218 3300047319 Bacteria 6346
198 Ga0495672_0000085 3300047320 Bacteria 156067
199 Ga0495683_0124338 3300047323 Bacteria 1221
200 Ga0495687_000255 3300047443 Bacteria 71830
201 Ga0495673_0000046 3300047469 Bacteria 274271
202 Ga0495673_0000086 3300047469 Bacteria 192268
203 Ga0495673_0018252 3300047469 Bacteria 3544
204 Ga0495602_0113998 3300048088 Bacteria 2190
205 Ga0496101_0000185 3300048904 Bacteria 49057
206 Ga0496102_0011653 3300048905 Bacteria 7588
207 Ga0496105_0059050 3300048908 Bacteria 3165
208 Ga0496105_0216001 3300048908 Bacteria 1562
209 Ga0496116_0117013 3300048919 Bacteria 1552
210 Ga0496117_0000043 3300048920 Bacteria 309583
211 Ga0496117_0002352 3300048920 Bacteria 24165
212 Ga0496117_0050490 3300048920 Bacteria 2949
213 Ga0496118_0000342 3300048921 Bacteria 79311
214 Ga0496118_0002507 3300048921 Bacteria 24636
215 Ga0496118_0003039 3300048921 Bacteria 21633
216 Ga0496118_0055826 3300048921 Bacteria 2975
217 Ga0496118_0208686 3300048921 Bacteria 1148
218 Ga0496119_0000059 3300048922 Bacteria 173056
219 Ga0496119_0000241 3300048922 Bacteria 77335
220 Ga0496119_0011119 3300048922 Bacteria 7496
221 Ga0496120_0000049 3300048923 Bacteria 187654
222 Ga0496120_0001287 3300048923 Bacteria 31253
223 Ga0496120_0036549 3300048923 Bacteria 2921
224 Ga0496121_0002301 3300048924 Bacteria 29625
225 Ga0496121_0177984 3300048924 Bacteria 1538
226 Ga0496122_0001334 3300048925 Bacteria 40363
227 Ga0496122_0011759 3300048925 Bacteria 8817
228 Ga0496122_0012574 3300048925 Bacteria 8404
229 Ga0496122_0024983 3300048925 Bacteria 5211
230 Ga0496122_0112904 3300048925 Bacteria 1777
231 Ga0496123_0001512 3300048926 Bacteria 32222
232 Ga0496123_0010578 3300048926 Bacteria 8127
233 Ga0496123_0021023 3300048926 Bacteria 5085
234 Ga0496123_0025862 3300048926 Bacteria 4411
235 Ga0496124_0005043 3300048927 Bacteria 15089
236 Ga0496124_0020265 3300048927 Bacteria 6152
237 Ga0496124_0064516 3300048927 Bacteria 3056
238 Ga0496125_0005126 3300048928 Bacteria 14741
239 Ga0496125_0008917 3300048928 Bacteria 10412
240 Ga0496126_0000065 3300048929 Bacteria 252549
241 Ga0496126_0096072 3300048929 Bacteria 2598
242 Ga0495678_000451 3300049459 Bacteria 40783
243 Ga0495682_0000024 3300049460 Bacteria 153545
244 Ga0501047_0164875 3300049581 Bacteria 2087
245 Ga0501069_0266373 3300049585 Bacteria 1001
246 Ga0501073_0006496 3300049589 Bacteria 8699
247 Ga0501080_0028970 3300049742 Bacteria 5155
248 nmdc:mga00v17_64599_c1 3300050491 Bacteria 2255
249 Ga0495601_0018187 3300053077 Bacteria 4274
250 Ga0495601_0066747 3300053077 Bacteria 2290
251 Ga0500578_0054713 3300053086 Bacteria 2555
252 Ga0500618_005769 3300053125 Bacteria 3723
253 Ga0500621_000007 3300053126 Bacteria 214505
254 Ga0500573_0023605 3300053140 Bacteria 3533
255 Ga0500616_0102463 3300053153 Bacteria 1396
256 Ga0501084_0380426 3300054114 Bacteria 1193
257 Ga0466962_0000767 3300061719 Bacteria 14401
258 Ga0466962_0011319 3300061719 Bacteria 4296
259 2511381093 2511231025 Bacteria 5324661
260 2547697886 2547132181 Bacteria 4945084
261 2548846790 2547132512 Bacteria 3416496
262 2562465666 2561511199 Bacteria 5155034
263 2599412426 2599185169 Bacteria 5441380
264 2601524861 2600255254 Bacteria 5281859
265 2601530151 2600255255 Bacteria 5282785
266 2601535674 2600255256 Bacteria 5597742
267 2601541333 2600255257 Bacteria 5597196
268 2601617245 2600255280 Bacteria 5292309
269 2601622068 2600255281 Bacteria 5288753
270 2601645613 2600255287 Bacteria 5210468
271 2601650001 2600255288 Bacteria 5282738
272 2601655291 2600255289 Bacteria 5281907
273 2601660526 2600255290 Bacteria 5282218
274 2601665752 2600255291 Bacteria 5217298
275 2601698610 2600255298 Bacteria 5215185
276 2601703761 2600255299 Bacteria 5218662
277 2601708034 2600255300 Bacteria 5287774
278 2601712991 2600255301 Bacteria 5280532
279 2601718291 2600255302 Bacteria 5288235
280 2601723697 2600255303 Bacteria 5219315
281 2601728578 2600255304 Bacteria 5283973
282 2601733239 2600255305 Bacteria 5282329
283 2601737649 2600255306 Bacteria 5281613
284 2601742034 2600255307 Bacteria 5439064
285 2601752968 2600255309 Bacteria 5431045
286 2601759711 2600255310 Bacteria 5600903
287 2601762468 2600255311 Bacteria 5598766
288 2602019456 2600255392 Bacteria 5437392
289 2603641041 2602042046 Bacteria 5483348
290 2603663286 2602042052 Bacteria 5215873
291 2603668488 2602042053 Bacteria 5214361
292 2603840920 2602042103 Bacteria 5284714
293 2603846093 2602042104 Bacteria 5281639
294 2603851067 2602042105 Bacteria 5282303
295 2603856235 2602042106 Bacteria 5282744
296 2603869175 2602042109 Bacteria 5152801
297 2603873814 2602042110 Bacteria 5283285
298 2603879116 2602042111 Bacteria 5212080
299 2606050994 2603880178 Bacteria 5283018
300 2606072911 2603880184 Bacteria 5217896
301 2606148580 2603880202 Bacteria 5284684
302 2606178886 2603880211 Bacteria 5284226
303 2608671095 2608642108 Bacteria 4104624
304 2637227428 2636415599 Bacteria 5718434
305 2643787780 2643221554 Bacteria 6603920
306 2644211889 2643221638 Bacteria 6579467
307 2671113113 2667528174 Bacteria 6435400
308 2676409265 2675903046 Bacteria 5451247
309 2707099152 2706794495 Bacteria 4536932
310 2738743490 2738541281 Bacteria 5112672
311 2739352397 2738543032 Bacteria 5115625
312 2777021798 2775507074 Bacteria 5532402
313 2792314238 2791355010 Bacteria 4864581
314 2793407103 2791355275 Bacteria 4429597
315 2813730900 2811995292 Bacteria 5303342
316 2814698506 2814123068 Bacteria 5687681
317 2819619283 2818991450 Bacteria 6962147
318 2876605394 2876601092 Bacteria 5114497
319 2881612957 2881609920 Bacteria 4405319
320 2891671675 2891670763 Bacteria 4967099
321 2896318754 2896317667 Bacteria 4606601
322 2904515766 2904513164 Bacteria 5476410
323 2928504688 2928503688 Bacteria 7268108
324 2935627696 2935625433 Bacteria 5042964
325 2939605157 2939602548 Bacteria 4950493
326 2939619895 2939617950 Bacteria 4820956
327 2969084465 2969079654 Bacteria 5439582
328 2974436715 2974435778 Bacteria 4876478
329 2984561583 2984559226 Bacteria 5683096
330 2984599648 2984595703 Bacteria 5682994
331 8016734509 8016733728 Bacteria 5274317
332 8019503508 8019499862 Bacteria 5169538
333 8019506582 8019504834 Bacteria 4819156
334 8054848295 8054844752 Bacteria 4450330
335 Ga0495606_0002388
336 JGI25158J39367_1001137
337 JGI25152J39213_1002807
338 JGI25152J39213_1017754
339 JGI25150J39212_1006968
340 JGI25159J45721_1000365
341 JGI25159J45721_1009244
342 rootL2_10159138
343 rootH1_10191020
344 JGI25161J50226_1000407
345 JGI25161J50226_1001312
346 Ga0055526_1026591
347 Ga0055526_1026643
348 Ga0055537_1001985
349 Ga0055524_1002578
350 Ga0055524_1003266
351 Ga0055524_1046379
352 Ga0055534_1001719
353 Ga0055534_1010030
354 Ga0055528_1021145
355 Ga0055530_10001783
356 Ga0055530_10005121
357 Ga0055531_10000818
358 Ga0055531_10028013
359 Ga0058692_1000088
360 Ga0058692_1000425
361 Ga0058692_1013074
362 Ga0055543_1000546
363 Ga0065165_1010796
364 Ga0068853_100013017
365 Ga0070665_100005069
366 Ga0068851_10082809
367 Ga0075366_10067166
368 Ga0079104_1000617
369 Ga0079104_1005403
370 Ga0105251_10004841
371 Ga0105251_10035055
372 Ga0105251_10051371
373 Ga0105251_10052378
374 Ga0105244_10031788
375 Ga0105244_10034325
376 Ga0105244_10048931
377 Ga0105250_10047670
378 Ga0105240_10007984
379 Ga0105238_10120336
380 Ga0105239_10042661
381 Ga0105246_10034116
382 Ga0105246_10598109
383 Ga0157373_10001022
384 Ga0157371_10000586
385 Ga0157371_10005031
386 Ga0157371_10148058
387 Ga0157369_10010120
388 Ga0157369_10021142
389 Ga0163162_10021805
390 Ga0157372_10000169
391 Ga0157372_10028059
392 Ga0182006_1000025
393 Ga0163161_10140126
394 Ga0213872_10000073
395 Ga0213872_10012807
396 Ga0209436_100218
397 Ga0209436_100682
398 Ga0209437_100110
399 Ga0207425_1000001
400 Ga0207425_1000109
401 Ga0207425_1000122
402 Ga0207425_1010532
403 Ga0207425_1019268
404 Ga0209129_1000003
405 Ga0209129_1000008
406 Ga0209129_1000964
407 Ga0209565_1000560
408 Ga0209565_1001427
409 Ga0209565_1001853
410 Ga0209565_1011866
411 Ga0209673_1013530
412 Ga0209130_1000171
413 Ga0209130_1001864
414 Ga0209675_1006570
415 Ga0209564_1000095
416 Ga0209564_1004770
417 Ga0209758_1000668
418 Ga0209050_1000011
419 Ga0209050_1002570
420 Ga0209050_1003063
421 Ga0209256_1000987
422 Ga0209256_1001953
423 Ga0209256_1002118
424 Ga0209051_1046146
425 Ga0209257_1000003
426 Ga0209257_1004210
427 Ga0207696_1000232
428 Ga0207696_1009483
429 Ga0207696_1037597
430 Ga0207655_1002107
431 Ga0207655_1005438
432 Ga0207655_1012335
433 Ga0207655_1021796
434 Ga0207655_1028016
435 Ga0207713_1000028
436 Ga0207713_1015314
437 Ga0207713_1047916
438 Ga0207647_10003718
439 Ga0207695_10077572
440 Ga0209281_1000557
441 Ga0209281_1000592
442 Ga0209371_1000014
443 Ga0209371_1000046
444 Ga0209371_1000137
445 Ga0209371_1000184
446 Ga0209371_1000259
447 Ga0209371_1002911
448 Ga0209371_1004105
449 Ga0209371_1004399
450 Ga0209371_1031774
451 Ga0268266_10060533
452 Ga0268264_10208840
453 Ga0265337_1026979
454 Ga0265324_10000076
455 Ga0268256_1000012
456 Ga0268256_1000021
457 Ga0268256_1000062
458 Ga0268256_1000154
459 Ga0268256_1000510
460 Ga0268256_1002045
461 Ga0268256_1003849
462 Ga0268256_1004138
463 Ga0268256_1005430
464 Ga0268256_1018044
465 Ga0268256_1036065
466 Ga0265332_10000024
467 Ga0265339_10000086
468 Ga0307509_10023734
469 Ga0307408_100000140
470 Ga0307408_100001299
471 Ga0307408_100003513
472 Ga0265313_10002151
473 Ga0400484_33482
474 Ga0400485_05654
475 Ga0400485_15476
476 Ga0400488_33556
477 Ga0400488_37947
478 Ga0400486_16545
479 Ga0400486_31881
480 Ga0400489_00529
481 Ga0400487_06944
482 Ga0400487_54961
483 Ga0436361_0248769
484 Ga0436361_0736070
485 Ga0439438_022168
486 Ga0439447_002362
487 Ga0451800_0731357
488 Ga0439452_000005
489 Ga0439452_000007
490 Ga0439464_0013501
491 Ga0466969_0001080
492 Ga0466969_0071369
493 Ga0466966_0064145
494 Ga0466961_0023870
495 Ga0466963_0073040
496 Ga0466971_0004780
497 Ga0466971_0176122
498 Ga0466970_0102883
499 Ga0466970_0278609
500 Ga0466959_0010748
501 Ga0466959_0258716
502 Ga0451576_0013435
503 Ga0451576_0121500
504 Ga0466958_0024149
505 Ga0466958_0062095
506 Ga0495627_019316
507 Ga0495592_0010299
508 Ga0495591_002246
509 Ga0495650_0000006
510 Ga0495650_0002709
511 Ga0495664_0115096
512 Ga0495606_0000748
513 Ga0495610_0001373
514 Ga0495616_0009636
515 Ga0495618_0041261
516 Ga0495631_0000006
517 Ga0495643_0027005
518 Ga0495644_0013971
519 Ga0495648_0049305
520 Ga0495652_0000984
521 Ga0495654_0000168
522 Ga0495654_0003234
523 Ga0495640_0020228
524 Ga0495597_0053337
525 Ga0495645_0037735
526 Ga0495622_0000001
527 Ga0495611_0105733
528 Ga0495649_0106423
529 Ga0495589_0004074
530 Ga0495660_0000010
531 Ga0495674_0019218
532 Ga0495672_0000085
533 Ga0495683_0124338
534 Ga0495687_000255
535 Ga0495673_0000046
536 Ga0495673_0000086
537 Ga0495673_0018252
538 Ga0495602_0113998
539 Ga0496101_0000185
540 Ga0496102_0011653
541 Ga0496105_0059050
542 Ga0496105_0216001
543 Ga0496116_0117013
544 Ga0496117_0000043
545 Ga0496117_0002352
546 Ga0496117_0050490
547 Ga0496118_0000342
548 Ga0496118_0002507
549 Ga0496118_0003039
550 Ga0496118_0055826
551 Ga0496118_0208686
552 Ga0496119_0000059
553 Ga0496119_0000241
554 Ga0496119_0011119
555 Ga0496120_0000049
556 Ga0496120_0001287
557 Ga0496120_0036549
558 Ga0496121_0002301
559 Ga0496121_0177984
560 Ga0496122_0001334
561 Ga0496122_0011759
562 Ga0496122_0012574
563 Ga0496122_0024983
564 Ga0496122_0112904
565 Ga0496123_0001512
566 Ga0496123_0010578
567 Ga0496123_0021023
568 Ga0496123_0025862
569 Ga0496124_0005043
570 Ga0496124_0020265
571 Ga0496124_0064516
572 Ga0496125_0005126
573 Ga0496125_0008917
574 Ga0496126_0000065
575 Ga0496126_0096072
576 Ga0495678_000451
577 Ga0495682_0000024
578 Ga0501047_0164875
579 Ga0501069_0266373
580 Ga0501073_0006496
581 Ga0501080_0028970
582 nmdc:mga00v17_64599_c1
583 Ga0495601_0018187
584 Ga0495601_0066747
585 Ga0500578_0054713
586 Ga0500618_005769
587 Ga0500621_000007
588 Ga0500573_0023605
589 Ga0500616_0102463
590 Ga0501084_0380426
591 Ga0466962_0000767
592 Ga0466962_0011319
593 2511381093
594 2547697886
595 2548846790
596 2562465666
597 2599412426
598 2601524861
599 2601530151
600 2601535674
601 2601541333
602 2601617245
603 2601622068
604 2601645613
605 2601650001
606 2601655291
607 2601660526
608 2601665752
609 2601698610
610 2601703761
611 2601708034
612 2601712991
613 2601718291
614 2601723697
615 2601728578
616 2601733239
617 2601737649
618 2601742034
619 2601752968
620 2601759711
621 2601762468
622 2602019456
623 2603641041
624 2603663286
625 2603668488
626 2603840920
627 2603846093
628 2603851067
629 2603856235
630 2603869175
631 2603873814
632 2603879116
633 2606050994
634 2606072911
635 2606148580
636 2606178886
637 2608671095
638 2637227428
639 2643787780
640 2644211889
641 2671113113
642 2676409265
643 2707099152
644 2738743490
645 2739352397
646 2777021798
647 2792314238
648 2793407103
649 2813730900
650 2814698506
651 2819619283
652 2876605394
653 2881612957
654 2891671675
655 2896318754
656 2904515766
657 2928504688
658 2935627696
659 2939605157
660 2939619895
661 2969084465
662 2974436715
663 2984561583
664 2984599648
665 8016734509
666 8019503508
667 8019506582
668 8054848295

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05368

NmrA

NmrA-like family

24

244

0.87

PF13460

NAD_binding_10

NAD(P)H-binding

28

208

0.83

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

24

126

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zcv-assembly1.cif.gz_A crystal structure of nadph-dependent quinone oxidoreductase qor2 complexed with nadph from escherichia coli 0.9621 1 270
2zcv-assembly1.cif.gz_A crystal structure of nadph-dependent quinone oxidoreductase qor2 complexed with nadph from escherichia coli 0.9517 1 270
2vrb-assembly1.cif.gz_A-2 crystal structure of the citrobacter sp. triphenylmethane reductase complexed with nadp(h) 0.9261 1 268
2vrc-assembly1.cif.gz_C crystal structure of the citrobacter sp. triphenylmethane reductase complexed with nadp(h) 0.9216 2 268
2zcu-assembly1.cif.gz_A crystal structure of a new type of nadph-dependent quinone oxidoreductase (qor2) from escherichia coli 0.9212 1 270
ID Description Score Start End Superfamily
af_P39315_2_136_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9926 3 134 3.40.50.720
af_P39315_1_278_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9706 1 265 3.40.50.2300
af_P39315_2_136_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9635 3 134 3.40.50.720
2zcuA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.945 1 192 3.40.50.720
af_P39315_1_278_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9425 1 265 3.40.50.2300
ID Description Score Start End GO Terms
AF-L9LPG1-F1-model_v4 NADH(P)-binding protein, PF13460 family 0.9886 2 131
AF-A0A3L9I2Z5-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9878 1 91
AF-A0A4Q3FSL7-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9869 2 103
AF-A0A853BPS0-F1-model_v4 Uncharacterized protein YbjT (DUF2867 family) 0.9867 1 129
AF-A0A0L8QSE3-F1-model_v4 deleted 0.9867 1 101

Map