F411967
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 334 | 200 | 330 | 114 |
Family's Representative Sequence
| Representative Sequence | 3300048929|Ga0496126_0024094|Ga0496126_0024094_1595_1996 |
| Length | 133 |
| Sequence | LRKNFAALERWRNLTVEQGMKATIWHNPNCGTSRKTLAILQETPGVDVTVVEYLKNPPSADKLAQLYRDAGLTPQQGLRTRGTDAVERALPDADDATVLAAMAAEPILIERPLVETDKGVRLCRPQEKVHEIL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 3 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 4 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 5 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 36 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 37 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 38 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 39 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 40 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 41 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 42 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 43 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 46 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 91 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 95 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 96 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 97 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 98 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 99 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 100 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 101 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 102 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 103 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 104 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 105 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 106 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 107 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 108 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 109 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 110 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 111 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 112 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 113 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 114 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 115 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 116 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 117 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 118 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 119 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 120 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 121 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 122 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 123 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 124 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 125 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 148 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 149 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 150 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 151 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 152 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 153 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 154 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 155 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 156 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 157 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 158 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 159 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 160 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 161 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 162 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 163 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 175 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 176 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 177 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 178 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 179 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 180 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 181 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 182 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 185 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 186 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 187 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 188 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 189 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 190 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 191 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 192 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 193 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 194 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 195 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 196 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 197 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 198 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 199 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 200 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.8 |
| Metatranscriptomes | 0 |
| Isolates | 1.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.56 |
| Nodule | 0 |
| Rhizoplane | 1.5 |
| Rhizosphere | 70.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2139679 | 2162886007 | Bacteria | 32324 |
| 2 | JGI24740J21852_10007723 | 3300001979 | Bacteria | 4349 |
| 3 | JGI24739J22299_10006039 | 3300001989 | Bacteria | 4584 |
| 4 | JGI24739J22299_10015785 | 3300001989 | Bacteria | 2743 |
| 5 | JGI24737J22298_10018925 | 3300001990 | Bacteria | 2204 |
| 6 | JGI24751J29686_10093544 | 3300002459 | Bacteria | 626 |
| 7 | Ga0065704_10070184 | 3300005289 | Bacteria | 119655 |
| 8 | Ga0065704_10091329 | 3300005289 | Bacteria | 2724 |
| 9 | Ga0065707_10095751 | 3300005295 | Bacteria | 3342 |
| 10 | Ga0065707_10483252 | 3300005295 | Bacteria | 772 |
| 11 | Ga0070670_100230570 | 3300005331 | Bacteria | 1611 |
| 12 | Ga0070670_100594498 | 3300005331 | Bacteria | 990 |
| 13 | Ga0070666_10362584 | 3300005335 | Bacteria | 1038 |
| 14 | Ga0070660_100051814 | 3300005339 | Bacteria | 3162 |
| 15 | Ga0070660_101163637 | 3300005339 | Bacteria | 653 |
| 16 | Ga0070668_100004671 | 3300005347 | Bacteria | 10151 |
| 17 | Ga0070668_100007677 | 3300005347 | Bacteria | 8005 |
| 18 | Ga0070668_100035236 | 3300005347 | Bacteria | 3816 |
| 19 | Ga0070668_100839402 | 3300005347 | Bacteria | 818 |
| 20 | Ga0070668_101486562 | 3300005347 | Bacteria | 619 |
| 21 | Ga0070669_100000470 | 3300005353 | Bacteria | 30618 |
| 22 | Ga0070669_100054642 | 3300005353 | Bacteria | 2925 |
| 23 | Ga0070669_100580750 | 3300005353 | Bacteria | 937 |
| 24 | Ga0070671_100027935 | 3300005355 | Bacteria | 4645 |
| 25 | Ga0070671_100847291 | 3300005355 | Bacteria | 797 |
| 26 | Ga0070667_100000361 | 3300005367 | Bacteria | 49412 |
| 27 | Ga0070667_100004988 | 3300005367 | Bacteria | 11124 |
| 28 | Ga0070667_100074931 | 3300005367 | Bacteria | 2888 |
| 29 | Ga0070667_101855598 | 3300005367 | Bacteria | 567 |
| 30 | Ga0070667_101941361 | 3300005367 | Bacteria | 554 |
| 31 | Ga0070663_100274868 | 3300005455 | Bacteria | 1340 |
| 32 | Ga0070662_100031601 | 3300005457 | Bacteria | 3717 |
| 33 | Ga0070706_100525396 | 3300005467 | Bacteria | 1101 |
| 34 | Ga0070707_100625153 | 3300005468 | Bacteria | 1039 |
| 35 | Ga0068853_100016030 | 3300005539 | Bacteria | 6161 |
| 36 | Ga0070665_100000079 | 3300005548 | Bacteria | 186925 |
| 37 | Ga0070665_100002115 | 3300005548 | Bacteria | 22199 |
| 38 | Ga0068855_100135496 | 3300005563 | Bacteria | 2810 |
| 39 | Ga0068855_100689714 | 3300005563 | Bacteria | 1094 |
| 40 | Ga0068855_101218939 | 3300005563 | Bacteria | 782 |
| 41 | Ga0068857_100130170 | 3300005577 | Bacteria | 2269 |
| 42 | Ga0068857_100302289 | 3300005577 | Bacteria | 1475 |
| 43 | Ga0068857_100406839 | 3300005577 | Bacteria | 1267 |
| 44 | Ga0068857_100574969 | 3300005577 | Bacteria | 1063 |
| 45 | Ga0068854_100002482 | 3300005578 | Bacteria | 11417 |
| 46 | Ga0068854_100046755 | 3300005578 | Bacteria | 3082 |
| 47 | Ga0068854_100302054 | 3300005578 | Bacteria | 1295 |
| 48 | Ga0068856_100584502 | 3300005614 | Bacteria | 1138 |
| 49 | Ga0068852_100048891 | 3300005616 | Bacteria | 3616 |
| 50 | Ga0068852_100373413 | 3300005616 | Bacteria | 1397 |
| 51 | Ga0068852_100461561 | 3300005616 | Bacteria | 1259 |
| 52 | Ga0068852_100738676 | 3300005616 | Bacteria | 996 |
| 53 | Ga0068852_101331214 | 3300005616 | Bacteria | 740 |
| 54 | Ga0068859_100489480 | 3300005617 | Bacteria | 1325 |
| 55 | Ga0068864_100083785 | 3300005618 | Bacteria | 2800 |
| 56 | Ga0068863_100000052 | 3300005841 | Bacteria | 125430 |
| 57 | Ga0068863_100031745 | 3300005841 | Bacteria | 5040 |
| 58 | Ga0068863_100829113 | 3300005841 | Bacteria | 923 |
| 59 | Ga0068858_100013942 | 3300005842 | Bacteria | 7582 |
| 60 | Ga0068860_100000007 | 3300005843 | Bacteria | 429329 |
| 61 | Ga0068860_100026003 | 3300005843 | Bacteria | 5646 |
| 62 | Ga0068860_100187933 | 3300005843 | Bacteria | 1998 |
| 63 | Ga0068862_100004597 | 3300005844 | Bacteria | 11629 |
| 64 | Ga0068862_100020390 | 3300005844 | Bacteria | 5538 |
| 65 | Ga0068862_100111124 | 3300005844 | Bacteria | 2405 |
| 66 | Ga0075365_10180159 | 3300006038 | Bacteria | 1477 |
| 67 | Ga0075368_10005996 | 3300006042 | Bacteria | 4216 |
| 68 | Ga0075363_100061212 | 3300006048 | Bacteria | 2028 |
| 69 | Ga0075364_10010170 | 3300006051 | Bacteria | 5674 |
| 70 | Ga0075364_10025657 | 3300006051 | Bacteria | 3753 |
| 71 | Ga0075364_10152530 | 3300006051 | Bacteria | 1557 |
| 72 | Ga0075364_10153695 | 3300006051 | Bacteria | 1551 |
| 73 | Ga0075432_10002998 | 3300006058 | Bacteria | 5686 |
| 74 | Ga0075432_10090532 | 3300006058 | Bacteria | 1119 |
| 75 | Ga0075362_10000026 | 3300006177 | Bacteria | 58544 |
| 76 | Ga0075362_10001144 | 3300006177 | Bacteria | 8286 |
| 77 | Ga0075367_10002649 | 3300006178 | Bacteria | 8240 |
| 78 | Ga0075367_10325390 | 3300006178 | Bacteria | 969 |
| 79 | Ga0075369_10000639 | 3300006186 | Bacteria | 11123 |
| 80 | Ga0075369_10006377 | 3300006186 | Bacteria | 4459 |
| 81 | Ga0075369_10027164 | 3300006186 | Bacteria | 2391 |
| 82 | Ga0075366_10000156 | 3300006195 | Bacteria | 28915 |
| 83 | Ga0075366_10011959 | 3300006195 | Bacteria | 4915 |
| 84 | Ga0075366_10150292 | 3300006195 | Bacteria | 1410 |
| 85 | Ga0075370_10000033 | 3300006353 | Bacteria | 44344 |
| 86 | Ga0075370_10262124 | 3300006353 | Bacteria | 1025 |
| 87 | Ga0075370_10360354 | 3300006353 | Bacteria | 869 |
| 88 | Ga0075436_100681779 | 3300006914 | Bacteria | 761 |
| 89 | Ga0097620_100489490 | 3300006931 | Bacteria | 1325 |
| 90 | Ga0105251_10000232 | 3300009011 | Bacteria | 56006 |
| 91 | Ga0105251_10208613 | 3300009011 | Bacteria | 880 |
| 92 | Ga0111539_10945551 | 3300009094 | Bacteria | 1002 |
| 93 | Ga0105247_10335487 | 3300009101 | Bacteria | 1059 |
| 94 | Ga0105248_10129158 | 3300009177 | Bacteria | 2851 |
| 95 | Ga0105248_10265393 | 3300009177 | Bacteria | 1933 |
| 96 | Ga0105238_10187296 | 3300009551 | Bacteria | 2046 |
| 97 | Ga0105249_10491709 | 3300009553 | Bacteria | 1271 |
| 98 | Ga0157371_10029643 | 3300013102 | Bacteria | 3954 |
| 99 | Ga0157371_10536584 | 3300013102 | Bacteria | 866 |
| 100 | Ga0157369_10443195 | 3300013105 | Bacteria | 1345 |
| 101 | Ga0163162_10780183 | 3300013306 | Bacteria | 1074 |
| 102 | Ga0157372_10224794 | 3300013307 | Bacteria | 2176 |
| 103 | Ga0157375_10348721 | 3300013308 | Bacteria | 1646 |
| 104 | Ga0163161_10005548 | 3300017792 | Bacteria | 8740 |
| 105 | Ga0207713_1022603 | 3300025735 | Bacteria | 2980 |
| 106 | Ga0207710_10750217 | 3300025900 | Bacteria | 513 |
| 107 | Ga0207680_10084120 | 3300025903 | Bacteria | 2007 |
| 108 | Ga0207705_10002600 | 3300025909 | Bacteria | 13873 |
| 109 | Ga0207705_10128424 | 3300025909 | Bacteria | 1885 |
| 110 | Ga0207705_10274557 | 3300025909 | Bacteria | 1289 |
| 111 | Ga0207657_10631220 | 3300025919 | Bacteria | 835 |
| 112 | Ga0207657_10988840 | 3300025919 | Bacteria | 646 |
| 113 | Ga0207646_10523053 | 3300025922 | Bacteria | 1068 |
| 114 | Ga0207681_10001640 | 3300025923 | Bacteria | 14420 |
| 115 | Ga0207681_10374132 | 3300025923 | Bacteria | 1145 |
| 116 | Ga0207681_10904732 | 3300025923 | Bacteria | 739 |
| 117 | Ga0207694_10176241 | 3300025924 | Bacteria | 1732 |
| 118 | Ga0207650_10414828 | 3300025925 | Bacteria | 1116 |
| 119 | Ga0207650_10426786 | 3300025925 | Bacteria | 1101 |
| 120 | Ga0207644_10000301 | 3300025931 | Bacteria | 32173 |
| 121 | Ga0207644_10007717 | 3300025931 | Bacteria | 7022 |
| 122 | Ga0207706_10040385 | 3300025933 | Bacteria | 4135 |
| 123 | Ga0207711_10003527 | 3300025941 | Bacteria | 13542 |
| 124 | Ga0207711_10603000 | 3300025941 | Bacteria | 1024 |
| 125 | Ga0207679_10329728 | 3300025945 | Bacteria | 1324 |
| 126 | Ga0207667_10167283 | 3300025949 | Bacteria | 2260 |
| 127 | Ga0207667_11030557 | 3300025949 | Bacteria | 809 |
| 128 | Ga0207712_10857301 | 3300025961 | Bacteria | 801 |
| 129 | Ga0207668_10005163 | 3300025972 | Bacteria | 7682 |
| 130 | Ga0207668_11759465 | 3300025972 | Bacteria | 559 |
| 131 | Ga0207640_10001764 | 3300025981 | Bacteria | 11618 |
| 132 | Ga0207640_10027132 | 3300025981 | Bacteria | 3487 |
| 133 | Ga0207640_10258502 | 3300025981 | Bacteria | 1356 |
| 134 | Ga0207658_10002164 | 3300025986 | Bacteria | 14602 |
| 135 | Ga0207658_10002795 | 3300025986 | Bacteria | 12557 |
| 136 | Ga0207658_10006034 | 3300025986 | Bacteria | 8273 |
| 137 | Ga0207658_11893773 | 3300025986 | Bacteria | 543 |
| 138 | Ga0207703_10009721 | 3300026035 | Bacteria | 7547 |
| 139 | Ga0207703_10036151 | 3300026035 | Bacteria | 3929 |
| 140 | Ga0207639_10028642 | 3300026041 | Bacteria | 4069 |
| 141 | Ga0207639_11499786 | 3300026041 | Bacteria | 633 |
| 142 | Ga0207678_10169745 | 3300026067 | Bacteria | 1863 |
| 143 | Ga0207702_10264385 | 3300026078 | Bacteria | 1621 |
| 144 | Ga0207641_10000042 | 3300026088 | Bacteria | 186384 |
| 145 | Ga0207641_10002483 | 3300026088 | Bacteria | 17018 |
| 146 | Ga0207641_10009181 | 3300026088 | Bacteria | 8162 |
| 147 | Ga0207641_10440177 | 3300026088 | Bacteria | 1258 |
| 148 | Ga0207676_10003074 | 3300026095 | Bacteria | 11910 |
| 149 | Ga0207674_10275696 | 3300026116 | Bacteria | 1630 |
| 150 | Ga0207674_10347554 | 3300026116 | Bacteria | 1434 |
| 151 | Ga0207674_10648300 | 3300026116 | Bacteria | 1020 |
| 152 | Ga0207698_10091494 | 3300026142 | Bacteria | 2490 |
| 153 | Ga0207698_10492629 | 3300026142 | Bacteria | 1191 |
| 154 | Ga0207698_10537869 | 3300026142 | Bacteria | 1143 |
| 155 | Ga0207698_10859098 | 3300026142 | Bacteria | 913 |
| 156 | Ga0207698_11273778 | 3300026142 | Bacteria | 750 |
| 157 | Ga0209371_1018849 | 3300027312 | Bacteria | 1740 |
| 158 | Ga0209983_1033705 | 3300027665 | Bacteria | 1096 |
| 159 | Ga0209813_10000060 | 3300027866 | Bacteria | 44068 |
| 160 | Ga0209974_10017694 | 3300027876 | Bacteria | 2363 |
| 161 | Ga0207428_10208715 | 3300027907 | Bacteria | 1468 |
| 162 | Ga0268266_10000175 | 3300028379 | Bacteria | 115897 |
| 163 | Ga0268266_10123791 | 3300028379 | Bacteria | 2304 |
| 164 | Ga0268265_10001670 | 3300028380 | Bacteria | 18127 |
| 165 | Ga0268265_10023931 | 3300028380 | Bacteria | 4313 |
| 166 | Ga0268265_10081784 | 3300028380 | Bacteria | 2551 |
| 167 | Ga0268264_10000134 | 3300028381 | Bacteria | 179475 |
| 168 | Ga0268264_10001327 | 3300028381 | Bacteria | 23270 |
| 169 | Ga0268256_1021114 | 3300030500 | Bacteria | 1740 |
| 170 | Ga0307408_100102864 | 3300031548 | Bacteria | 2179 |
| 171 | Ga0307408_100521979 | 3300031548 | Bacteria | 1043 |
| 172 | Ga0307408_100526141 | 3300031548 | Bacteria | 1039 |
| 173 | Ga0307508_10006626 | 3300031616 | Bacteria | 10875 |
| 174 | Ga0316579_10029677 | 3300031691 | Bacteria | 2496 |
| 175 | Ga0307405_10139980 | 3300031731 | Bacteria | 1685 |
| 176 | Ga0307413_10964327 | 3300031824 | Bacteria | 728 |
| 177 | Ga0307410_10064487 | 3300031852 | Bacteria | 2517 |
| 178 | Ga0307410_10144217 | 3300031852 | Bacteria | 1765 |
| 179 | Ga0307406_10134319 | 3300031901 | Bacteria | 1741 |
| 180 | Ga0307406_10440824 | 3300031901 | Bacteria | 1042 |
| 181 | Ga0307406_10557700 | 3300031901 | Bacteria | 938 |
| 182 | Ga0307406_11008351 | 3300031901 | Bacteria | 715 |
| 183 | Ga0307406_11237320 | 3300031901 | Bacteria | 649 |
| 184 | Ga0307407_10432047 | 3300031903 | Bacteria | 952 |
| 185 | Ga0307407_11482502 | 3300031903 | Bacteria | 536 |
| 186 | Ga0307412_10009408 | 3300031911 | Bacteria | 5606 |
| 187 | Ga0307412_10363307 | 3300031911 | Bacteria | 1166 |
| 188 | Ga0307409_100121099 | 3300031995 | Bacteria | 2216 |
| 189 | Ga0307409_100477402 | 3300031995 | Bacteria | 1209 |
| 190 | Ga0307409_101506201 | 3300031995 | Bacteria | 700 |
| 191 | Ga0307416_100401395 | 3300032002 | Bacteria | 1408 |
| 192 | Ga0307414_10021612 | 3300032004 | Bacteria | 4043 |
| 193 | Ga0307414_10243909 | 3300032004 | Bacteria | 1489 |
| 194 | Ga0307414_10983919 | 3300032004 | Bacteria | 776 |
| 195 | Ga0307411_10026273 | 3300032005 | Bacteria | 3504 |
| 196 | Ga0307411_10174709 | 3300032005 | Bacteria | 1624 |
| 197 | Ga0307411_10278336 | 3300032005 | Bacteria | 1330 |
| 198 | Ga0307411_11391375 | 3300032005 | Bacteria | 642 |
| 199 | Ga0373948_0024597 | 3300034817 | Bacteria | 1176 |
| 200 | Ga0373951_0026572 | 3300035091 | Bacteria | 1349 |
| 201 | Ga0373932_0028330 | 3300035112 | Bacteria | 1539 |
| 202 | Ga0373932_0078030 | 3300035112 | Bacteria | 1041 |
| 203 | Ga0373946_0072817 | 3300035171 | Bacteria | 1488 |
| 204 | Ga0373931_0009733 | 3300035691 | Bacteria | 4602 |
| 205 | Ga0316582_0001804 | 3300036647 | Bacteria | 9669 |
| 206 | Ga0373925_0815504 | 3300037068 | Bacteria | 769 |
| 207 | Ga0395900_1503880 | 3300037418 | Bacteria | 585 |
| 208 | Ga0395905_0368918 | 3300037471 | Bacteria | 1329 |
| 209 | Ga0316581_0119451 | 3300037588 | Bacteria | 812 |
| 210 | Ga0395901_0540749 | 3300038443 | Bacteria | 1182 |
| 211 | Ga0451841_1261334 | 3300041498 | Bacteria | 732 |
| 212 | Ga0451847_0054085 | 3300041503 | Bacteria | 1066 |
| 213 | Ga0451855_0648019 | 3300041511 | Bacteria | 1056 |
| 214 | Ga0451853_1231575 | 3300041512 | Bacteria | 603 |
| 215 | Ga0453684_0431866 | 3300044712 | Bacteria | 1469 |
| 216 | Ga0451576_0000393 | 3300045051 | Bacteria | 101814 |
| 217 | Ga0495627_000278 | 3300046453 | Bacteria | 51546 |
| 218 | Ga0495650_0019051 | 3300046471 | Bacteria | 3391 |
| 219 | Ga0495607_0007897 | 3300046501 | Bacteria | 7319 |
| 220 | Ga0495583_0141245 | 3300046506 | Bacteria | 1002 |
| 221 | Ga0495583_0217848 | 3300046506 | Bacteria | 772 |
| 222 | Ga0495606_0020711 | 3300046507 | Bacteria | 4839 |
| 223 | Ga0495610_0000022 | 3300046512 | Bacteria | 317107 |
| 224 | Ga0495610_0000116 | 3300046512 | Bacteria | 90702 |
| 225 | Ga0495620_0007739 | 3300046515 | Bacteria | 5804 |
| 226 | Ga0495620_0104710 | 3300046515 | Bacteria | 1125 |
| 227 | Ga0495632_0001423 | 3300046519 | Bacteria | 19923 |
| 228 | Ga0495632_0099806 | 3300046519 | Bacteria | 1369 |
| 229 | Ga0495637_0075598 | 3300046520 | Bacteria | 1351 |
| 230 | Ga0495643_0000048 | 3300046522 | Bacteria | 212788 |
| 231 | Ga0495643_0010895 | 3300046522 | Bacteria | 5569 |
| 232 | Ga0495643_0045605 | 3300046522 | Bacteria | 2379 |
| 233 | Ga0495654_0019330 | 3300046530 | Bacteria | 3563 |
| 234 | Ga0495609_0009557 | 3300046538 | Bacteria | 4689 |
| 235 | Ga0495609_0286232 | 3300046538 | Bacteria | 673 |
| 236 | Ga0495597_0209340 | 3300046542 | Bacteria | 778 |
| 237 | Ga0495633_0236865 | 3300046558 | Bacteria | 834 |
| 238 | Ga0495668_0147933 | 3300046616 | Bacteria | 1286 |
| 239 | Ga0495668_0390408 | 3300046616 | Bacteria | 765 |
| 240 | Ga0495611_0278768 | 3300046648 | Bacteria | 772 |
| 241 | Ga0495625_0036497 | 3300046660 | Bacteria | 3612 |
| 242 | Ga0495669_0044136 | 3300046684 | Bacteria | 1985 |
| 243 | Ga0495671_0111545 | 3300046692 | Bacteria | 1335 |
| 244 | Ga0495673_0020031 | 3300047469 | Bacteria | 3338 |
| 245 | Ga0495681_0000974 | 3300047470 | Bacteria | 21885 |
| 246 | Ga0495686_0001246 | 3300047472 | Bacteria | 29040 |
| 247 | Ga0496102_0265930 | 3300048905 | Bacteria | 1617 |
| 248 | Ga0496103_0057430 | 3300048906 | Bacteria | 2416 |
| 249 | Ga0496104_0006304 | 3300048907 | Bacteria | 10433 |
| 250 | Ga0496105_0000786 | 3300048908 | Bacteria | 21442 |
| 251 | Ga0496106_0401950 | 3300048909 | Bacteria | 1101 |
| 252 | Ga0496116_0190261 | 3300048919 | Bacteria | 1087 |
| 253 | Ga0496117_0041107 | 3300048920 | Bacteria | 3392 |
| 254 | Ga0496117_0061697 | 3300048920 | Bacteria | 2575 |
| 255 | Ga0496118_0036083 | 3300048921 | Bacteria | 4003 |
| 256 | Ga0496118_0100461 | 3300048921 | Bacteria | 1957 |
| 257 | Ga0496118_0330382 | 3300048921 | Bacteria | 822 |
| 258 | Ga0496119_0036762 | 3300048922 | Bacteria | 3191 |
| 259 | Ga0496119_0094685 | 3300048922 | Bacteria | 1689 |
| 260 | Ga0496119_0188591 | 3300048922 | Bacteria | 1076 |
| 261 | Ga0496120_0067501 | 3300048923 | Bacteria | 1975 |
| 262 | Ga0496120_0099033 | 3300048923 | Bacteria | 1544 |
| 263 | Ga0496120_0511092 | 3300048923 | Bacteria | 515 |
| 264 | Ga0496121_0000274 | 3300048924 | Bacteria | 107140 |
| 265 | Ga0496121_0001542 | 3300048924 | Bacteria | 38556 |
| 266 | Ga0496121_0026104 | 3300048924 | Bacteria | 5518 |
| 267 | Ga0496122_0300540 | 3300048925 | Bacteria | 866 |
| 268 | Ga0496123_0237656 | 3300048926 | Bacteria | 907 |
| 269 | Ga0496124_0004428 | 3300048927 | Bacteria | 16380 |
| 270 | Ga0496124_0670130 | 3300048927 | Bacteria | 662 |
| 271 | Ga0496125_0066493 | 3300048928 | Bacteria | 2847 |
| 272 | Ga0496125_0327713 | 3300048928 | Bacteria | 925 |
| 273 | Ga0496126_0024094 | 3300048929 | Bacteria | 5880 |
| 274 | Ga0496126_0188805 | 3300048929 | Bacteria | 1746 |
| 275 | Ga0496126_0523696 | 3300048929 | Bacteria | 944 |
| 276 | Ga0501033_0483360 | 3300049570 | Bacteria | 858 |
| 277 | Ga0501034_0086244 | 3300049571 | Bacteria | 3141 |
| 278 | Ga0501037_0933054 | 3300049573 | Bacteria | 568 |
| 279 | Ga0501042_0879000 | 3300049578 | Bacteria | 653 |
| 280 | Ga0501043_0647596 | 3300049579 | Bacteria | 776 |
| 281 | Ga0501047_0310052 | 3300049581 | Bacteria | 1419 |
| 282 | Ga0501073_0498586 | 3300049589 | Bacteria | 842 |
| 283 | Ga0501074_0313712 | 3300049590 | Bacteria | 1114 |
| 284 | Ga0501080_0097493 | 3300049742 | Bacteria | 2730 |
| 285 | Ga0501035_1133225 | 3300049822 | Bacteria | 610 |
| 286 | Ga0501044_0443805 | 3300049823 | Bacteria | 1205 |
| 287 | Ga0501044_0537103 | 3300049823 | Bacteria | 1068 |
| 288 | nmdc:mga03683_393_c1 | 3300050489 | Bacteria | 12561 |
| 289 | nmdc:mga03683_54_c1 | 3300050489 | Bacteria | 47475 |
| 290 | nmdc:mga03n38_17905_c1 | 3300050490 | Bacteria | 2784 |
| 291 | nmdc:mga00v17_26625_c1 | 3300050491 | Bacteria | 3372 |
| 292 | nmdc:mga00v17_50992_c1 | 3300050491 | Bacteria | 2516 |
| 293 | nmdc:mga00v17_86123_c1 | 3300050491 | Bacteria | 1969 |
| 294 | nmdc:mga0yw44_75993_c1 | 3300050492 | Bacteria | 2096 |
| 295 | nmdc:mga0k408_144648_c1 | 3300050493 | Bacteria | 1415 |
| 296 | nmdc:mga0k408_288125_c1 | 3300050493 | Bacteria | 980 |
| 297 | nmdc:mga0k408_30_c1 | 3300050493 | Bacteria | 89511 |
| 298 | nmdc:mga0k408_9440_c1 | 3300050493 | Bacteria | 5257 |
| 299 | nmdc:mga06z11_12161_c1 | 3300050494 | Bacteria | 3736 |
| 300 | nmdc:mga06z11_8750_c1 | 3300050494 | Bacteria | 4239 |
| 301 | nmdc:mga04h51_73_c1 | 3300050495 | Bacteria | 32039 |
| 302 | nmdc:mga07m45_14_c1 | 3300050496 | Bacteria | 154035 |
| 303 | nmdc:mga07m45_356356_c1 | 3300050496 | Bacteria | 850 |
| 304 | nmdc:mga07m45_5_c2 | 3300050496 | Bacteria | 297012 |
| 305 | nmdc:mga08y16_1185242_c1 | 3300050511 | Bacteria | 735 |
| 306 | nmdc:mga08x19_590237_c1 | 3300050514 | Bacteria | 787 |
| 307 | nmdc:mga0sz30_209_c1 | 3300050516 | Bacteria | 21984 |
| 308 | nmdc:mga0sz30_26143_c1 | 3300050516 | Bacteria | 2391 |
| 309 | nmdc:mga0sz30_285_c1 | 3300050516 | Bacteria | 19408 |
| 310 | Ga0500647_0056076 | 3300053091 | Bacteria | 1895 |
| 311 | Ga0500651_0045361 | 3300053093 | Bacteria | 2765 |
| 312 | Ga0500641_0217791 | 3300053096 | Bacteria | 810 |
| 313 | Ga0500556_0224086 | 3300053104 | Bacteria | 742 |
| 314 | Ga0500592_009899 | 3300053116 | Bacteria | 1517 |
| 315 | Ga0500592_016440 | 3300053116 | Bacteria | 1187 |
| 316 | Ga0500618_002176 | 3300053125 | Bacteria | 7686 |
| 317 | Ga0500642_0002658 | 3300053130 | Bacteria | 5279 |
| 318 | Ga0500642_0281237 | 3300053130 | Bacteria | 756 |
| 319 | Ga0500655_000247 | 3300053133 | Bacteria | 12687 |
| 320 | Ga0500559_0172601 | 3300053136 | Bacteria | 1017 |
| 321 | Ga0500559_0570247 | 3300053136 | Bacteria | 515 |
| 322 | Ga0500568_0030918 | 3300053139 | Bacteria | 2214 |
| 323 | Ga0500590_003221 | 3300053148 | Bacteria | 7468 |
| 324 | Ga0500590_043015 | 3300053148 | Bacteria | 2318 |
| 325 | Ga0500622_0013951 | 3300053156 | Bacteria | 4322 |
| 326 | Ga0500639_122391 | 3300053163 | Bacteria | 1247 |
| 327 | Ga0500636_0387351 | 3300053177 | Bacteria | 653 |
| 328 | Ga0500570_021671 | 3300053724 | Bacteria | 3574 |
| 329 | Ga0500645_027564 | 3300053730 | Bacteria | 1722 |
| 330 | Ga0500645_079964 | 3300053730 | Bacteria | 933 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2818991438 | 2819552220 | 110 |
| 2 | iso_pu_bacteria | 2896184354 | 2896186634 | 110 |
| 3 | iso_pu_bacteria | 2896253425 | 2896254401 | 110 |
| 4 | iso_pu_bacteria | 2919138771 | 2919139211 | 110 |
| 5 | 3300001979 | JGI24740J21852_10007723 | JGI24740J21852_100077232 | 112 |
| 6 | 3300001989 | JGI24739J22299_10006039 | JGI24739J22299_100060395 | 112 |
| 7 | 3300001989 | JGI24739J22299_10015785 | JGI24739J22299_100157854 | 112 |
| 8 | 3300001990 | JGI24737J22298_10018925 | JGI24737J22298_100189252 | 112 |
| 9 | 3300005339 | Ga0070660_100051814 | Ga0070660_1000518144 | 112 |
| 10 | 3300005457 | Ga0070662_100031601 | Ga0070662_1000316012 | 112 |
| 11 | 3300005539 | Ga0068853_100016030 | Ga0068853_1000160302 | 112 |
| 12 | 3300005577 | Ga0068857_100130170 | Ga0068857_1001301702 | 112 |
| 13 | 3300005578 | Ga0068854_100046755 | Ga0068854_1000467552 | 112 |
| 14 | 3300005616 | Ga0068852_100373413 | Ga0068852_1003734132 | 112 |
| 15 | 3300009551 | Ga0105238_10187296 | Ga0105238_101872962 | 112 |
| 16 | 3300025924 | Ga0207694_10176241 | Ga0207694_101762413 | 112 |
| 17 | 3300025933 | Ga0207706_10040385 | Ga0207706_100403854 | 112 |
| 18 | 3300025981 | Ga0207640_10027132 | Ga0207640_100271322 | 112 |
| 19 | 3300026041 | Ga0207639_10028642 | Ga0207639_100286424 | 112 |
| 20 | 3300026116 | Ga0207674_10648300 | Ga0207674_106483002 | 112 |
| 21 | 3300026142 | Ga0207698_10492629 | Ga0207698_104926292 | 112 |
| 22 | 3300031548 | Ga0307408_100102864 | Ga0307408_1001028642 | 112 |
| 23 | 3300031731 | Ga0307405_10139980 | Ga0307405_101399802 | 112 |
| 24 | 3300031901 | Ga0307406_10134319 | Ga0307406_101343192 | 112 |
| 25 | 3300031911 | Ga0307412_10009408 | Ga0307412_100094087 | 112 |
| 26 | 3300032002 | Ga0307416_100401395 | Ga0307416_1004013952 | 112 |
| 27 | 3300032005 | Ga0307411_11391375 | Ga0307411_113913751 | 112 |
| 28 | 3300035171 | Ga0373946_0072817 | Ga0373946_0072817_450_788 | 112 |
| 29 | 3300037068 | Ga0373925_0815504 | Ga0373925_0815504_79_417 | 112 |
| 30 | 3300037418 | Ga0395900_1503880 | Ga0395900_1503880_136_474 | 112 |
| 31 | 3300037471 | Ga0395905_0368918 | Ga0395905_0368918_466_804 | 112 |
| 32 | 3300038443 | Ga0395901_0540749 | Ga0395901_0540749_658_996 | 112 |
| 33 | 3300046506 | Ga0495583_0217848 | Ga0495583_0217848_205_543 | 112 |
| 34 | 3300046519 | Ga0495632_0099806 | Ga0495632_0099806_47_385 | 112 |
| 35 | 3300046520 | Ga0495637_0075598 | Ga0495637_0075598_465_803 | 112 |
| 36 | 3300046538 | Ga0495609_0286232 | Ga0495609_0286232_301_639 | 112 |
| 37 | 3300046542 | Ga0495597_0209340 | Ga0495597_0209340_224_562 | 112 |
| 38 | 3300046616 | Ga0495668_0147933 | Ga0495668_0147933_463_801 | 112 |
| 39 | 3300046616 | Ga0495668_0390408 | Ga0495668_0390408_398_736 | 112 |
| 40 | 3300046684 | Ga0495669_0044136 | Ga0495669_0044136_421_759 | 112 |
| 41 | 3300047469 | Ga0495673_0020031 | Ga0495673_0020031_2727_3065 | 112 |
| 42 | 3300047472 | Ga0495686_0001246 | Ga0495686_0001246_15301_15639 | 112 |
| 43 | 3300048922 | Ga0496119_0036762 | Ga0496119_0036762_2432_2770 | 112 |
| 44 | 3300048923 | Ga0496120_0511092 | Ga0496120_0511092_167_505 | 112 |
| 45 | 3300048926 | Ga0496123_0237656 | Ga0496123_0237656_113_451 | 112 |
| 46 | 3300048928 | Ga0496125_0327713 | Ga0496125_0327713_401_739 | 112 |
| 47 | 3300053091 | Ga0500647_0056076 | Ga0500647_0056076_292_630 | 112 |
| 48 | 3300053093 | Ga0500651_0045361 | Ga0500651_0045361_602_940 | 112 |
| 49 | 3300053104 | Ga0500556_0224086 | Ga0500556_0224086_311_649 | 112 |
| 50 | 3300053116 | Ga0500592_016440 | Ga0500592_016440_511_849 | 112 |
| 51 | 3300053130 | Ga0500642_0002658 | Ga0500642_0002658_558_896 | 112 |
| 52 | 3300053133 | Ga0500655_000247 | Ga0500655_000247_2337_2675 | 112 |
| 53 | 3300053136 | Ga0500559_0172601 | Ga0500559_0172601_405_743 | 112 |
| 54 | 3300053148 | Ga0500590_003221 | Ga0500590_003221_2259_2597 | 112 |
| 55 | 3300053156 | Ga0500622_0013951 | Ga0500622_0013951_143_481 | 112 |
| 56 | 3300053163 | Ga0500639_122391 | Ga0500639_122391_610_948 | 112 |
| 57 | 3300053177 | Ga0500636_0387351 | Ga0500636_0387351_217_555 | 112 |
| 58 | 3300053724 | Ga0500570_021671 | Ga0500570_021671_431_769 | 112 |
| 59 | 3300053730 | Ga0500645_079964 | Ga0500645_079964_340_678 | 112 |
| 60 | 3300002459 | JGI24751J29686_10093544 | JGI24751J29686_100935442 | 113 |
| 61 | 3300005295 | Ga0065707_10483252 | Ga0065707_104832522 | 113 |
| 62 | 3300005353 | Ga0070669_100580750 | Ga0070669_1005807502 | 113 |
| 63 | 3300005467 | Ga0070706_100525396 | Ga0070706_1005253963 | 113 |
| 64 | 3300005468 | Ga0070707_100625153 | Ga0070707_1006251532 | 113 |
| 65 | 3300005617 | Ga0068859_100489480 | Ga0068859_1004894803 | 113 |
| 66 | 3300005841 | Ga0068863_100829113 | Ga0068863_1008291132 | 113 |
| 67 | 3300006931 | Ga0097620_100489490 | Ga0097620_1004894903 | 113 |
| 68 | 3300009553 | Ga0105249_10491709 | Ga0105249_104917093 | 113 |
| 69 | 3300025922 | Ga0207646_10523053 | Ga0207646_105230532 | 113 |
| 70 | 3300025923 | Ga0207681_10904732 | Ga0207681_109047322 | 113 |
| 71 | 3300025961 | Ga0207712_10857301 | Ga0207712_108573012 | 113 |
| 72 | 3300026088 | Ga0207641_10440177 | Ga0207641_104401772 | 113 |
| 73 | 2162886007 | SwRhRL2b_contig_2139679 | SwRhRL2b_0810.00002180 | 114 |
| 74 | 3300005289 | Ga0065704_10070184 | Ga0065704_1007018419 | 114 |
| 75 | 3300005289 | Ga0065704_10091329 | Ga0065704_100913292 | 114 |
| 76 | 3300005295 | Ga0065707_10095751 | Ga0065707_100957512 | 114 |
| 77 | 3300005331 | Ga0070670_100230570 | Ga0070670_1002305702 | 114 |
| 78 | 3300005331 | Ga0070670_100594498 | Ga0070670_1005944982 | 114 |
| 79 | 3300005335 | Ga0070666_10362584 | Ga0070666_103625842 | 114 |
| 80 | 3300005339 | Ga0070660_101163637 | Ga0070660_1011636371 | 114 |
| 81 | 3300005347 | Ga0070668_100004671 | Ga0070668_1000046719 | 114 |
| 82 | 3300005347 | Ga0070668_100007677 | Ga0070668_1000076774 | 114 |
| 83 | 3300005347 | Ga0070668_100035236 | Ga0070668_1000352364 | 114 |
| 84 | 3300005347 | Ga0070668_100839402 | Ga0070668_1008394022 | 114 |
| 85 | 3300005347 | Ga0070668_101486562 | Ga0070668_1014865622 | 114 |
| 86 | 3300005353 | Ga0070669_100000470 | Ga0070669_10000047029 | 114 |
| 87 | 3300005353 | Ga0070669_100054642 | Ga0070669_1000546423 | 114 |
| 88 | 3300005355 | Ga0070671_100027935 | Ga0070671_1000279351 | 114 |
| 89 | 3300005355 | Ga0070671_100847291 | Ga0070671_1008472911 | 114 |
| 90 | 3300005367 | Ga0070667_100000361 | Ga0070667_10000036124 | 114 |
| 91 | 3300005367 | Ga0070667_100004988 | Ga0070667_10000498813 | 114 |
| 92 | 3300005367 | Ga0070667_100074931 | Ga0070667_1000749312 | 114 |
| 93 | 3300005367 | Ga0070667_101855598 | Ga0070667_1018555982 | 114 |
| 94 | 3300005367 | Ga0070667_101941361 | Ga0070667_1019413611 | 114 |
| 95 | 3300005455 | Ga0070663_100274868 | Ga0070663_1002748682 | 114 |
| 96 | 3300005548 | Ga0070665_100000079 | Ga0070665_10000007982 | 114 |
| 97 | 3300005548 | Ga0070665_100002115 | Ga0070665_10000211518 | 114 |
| 98 | 3300005563 | Ga0068855_100135496 | Ga0068855_1001354964 | 114 |
| 99 | 3300005563 | Ga0068855_100689714 | Ga0068855_1006897142 | 114 |
| 100 | 3300005563 | Ga0068855_101218939 | Ga0068855_1012189392 | 114 |
| 101 | 3300005577 | Ga0068857_100302289 | Ga0068857_1003022892 | 114 |
| 102 | 3300005577 | Ga0068857_100406839 | Ga0068857_1004068393 | 114 |
| 103 | 3300005577 | Ga0068857_100574969 | Ga0068857_1005749691 | 114 |
| 104 | 3300005578 | Ga0068854_100002482 | Ga0068854_1000024822 | 114 |
| 105 | 3300005578 | Ga0068854_100302054 | Ga0068854_1003020541 | 114 |
| 106 | 3300005614 | Ga0068856_100584502 | Ga0068856_1005845022 | 114 |
| 107 | 3300005616 | Ga0068852_100048891 | Ga0068852_1000488914 | 114 |
| 108 | 3300005616 | Ga0068852_100461561 | Ga0068852_1004615612 | 114 |
| 109 | 3300005616 | Ga0068852_100738676 | Ga0068852_1007386761 | 114 |
| 110 | 3300005616 | Ga0068852_101331214 | Ga0068852_1013312142 | 114 |
| 111 | 3300005618 | Ga0068864_100083785 | Ga0068864_1000837855 | 114 |
| 112 | 3300005841 | Ga0068863_100000052 | Ga0068863_10000005252 | 114 |
| 113 | 3300005841 | Ga0068863_100031745 | Ga0068863_1000317456 | 114 |
| 114 | 3300005842 | Ga0068858_100013942 | Ga0068858_1000139422 | 114 |
| 115 | 3300005843 | Ga0068860_100000007 | Ga0068860_100000007364 | 114 |
| 116 | 3300005843 | Ga0068860_100026003 | Ga0068860_1000260037 | 114 |
| 117 | 3300005843 | Ga0068860_100187933 | Ga0068860_1001879333 | 114 |
| 118 | 3300005844 | Ga0068862_100004597 | Ga0068862_10000459712 | 114 |
| 119 | 3300005844 | Ga0068862_100020390 | Ga0068862_1000203905 | 114 |
| 120 | 3300005844 | Ga0068862_100111124 | Ga0068862_1001111245 | 114 |
| 121 | 3300006038 | Ga0075365_10180159 | Ga0075365_101801593 | 114 |
| 122 | 3300006042 | Ga0075368_10005996 | Ga0075368_100059963 | 114 |
| 123 | 3300006048 | Ga0075363_100061212 | Ga0075363_1000612123 | 114 |
| 124 | 3300006051 | Ga0075364_10010170 | Ga0075364_100101702 | 114 |
| 125 | 3300006051 | Ga0075364_10025657 | Ga0075364_100256576 | 114 |
| 126 | 3300006051 | Ga0075364_10152530 | Ga0075364_101525302 | 114 |
| 127 | 3300006051 | Ga0075364_10153695 | Ga0075364_101536953 | 114 |
| 128 | 3300006058 | Ga0075432_10002998 | Ga0075432_100029985 | 114 |
| 129 | 3300006058 | Ga0075432_10090532 | Ga0075432_100905322 | 114 |
| 130 | 3300006177 | Ga0075362_10000026 | Ga0075362_1000002648 | 114 |
| 131 | 3300006177 | Ga0075362_10001144 | Ga0075362_100011444 | 114 |
| 132 | 3300006178 | Ga0075367_10002649 | Ga0075367_100026492 | 114 |
| 133 | 3300006178 | Ga0075367_10325390 | Ga0075367_103253902 | 114 |
| 134 | 3300006186 | Ga0075369_10000639 | Ga0075369_100006392 | 114 |
| 135 | 3300006186 | Ga0075369_10006377 | Ga0075369_100063775 | 114 |
| 136 | 3300006186 | Ga0075369_10027164 | Ga0075369_100271643 | 114 |
| 137 | 3300006195 | Ga0075366_10000156 | Ga0075366_100001567 | 114 |
| 138 | 3300006195 | Ga0075366_10011959 | Ga0075366_100119594 | 114 |
| 139 | 3300006195 | Ga0075366_10150292 | Ga0075366_101502922 | 114 |
| 140 | 3300006353 | Ga0075370_10000033 | Ga0075370_1000003314 | 114 |
| 141 | 3300006353 | Ga0075370_10262124 | Ga0075370_102621241 | 114 |
| 142 | 3300006353 | Ga0075370_10360354 | Ga0075370_103603542 | 114 |
| 143 | 3300006914 | Ga0075436_100681779 | Ga0075436_1006817792 | 114 |
| 144 | 3300009011 | Ga0105251_10000232 | Ga0105251_1000023221 | 114 |
| 145 | 3300009011 | Ga0105251_10208613 | Ga0105251_102086132 | 114 |
| 146 | 3300009094 | Ga0111539_10945551 | Ga0111539_109455512 | 114 |
| 147 | 3300009101 | Ga0105247_10335487 | Ga0105247_103354872 | 114 |
| 148 | 3300009177 | Ga0105248_10129158 | Ga0105248_101291582 | 114 |
| 149 | 3300009177 | Ga0105248_10265393 | Ga0105248_102653933 | 114 |
| 150 | 3300013102 | Ga0157371_10029643 | Ga0157371_100296434 | 114 |
| 151 | 3300013102 | Ga0157371_10536584 | Ga0157371_105365842 | 114 |
| 152 | 3300013105 | Ga0157369_10443195 | Ga0157369_104431953 | 114 |
| 153 | 3300013306 | Ga0163162_10780183 | Ga0163162_107801832 | 114 |
| 154 | 3300013307 | Ga0157372_10224794 | Ga0157372_102247942 | 114 |
| 155 | 3300013308 | Ga0157375_10348721 | Ga0157375_103487212 | 114 |
| 156 | 3300017792 | Ga0163161_10005548 | Ga0163161_100055488 | 114 |
| 157 | 3300025735 | Ga0207713_1022603 | Ga0207713_10226031 | 114 |
| 158 | 3300025900 | Ga0207710_10750217 | Ga0207710_107502172 | 114 |
| 159 | 3300025903 | Ga0207680_10084120 | Ga0207680_100841201 | 114 |
| 160 | 3300025909 | Ga0207705_10002600 | Ga0207705_1000260015 | 114 |
| 161 | 3300025909 | Ga0207705_10128424 | Ga0207705_101284241 | 114 |
| 162 | 3300025909 | Ga0207705_10274557 | Ga0207705_102745573 | 114 |
| 163 | 3300025919 | Ga0207657_10631220 | Ga0207657_106312201 | 114 |
| 164 | 3300025919 | Ga0207657_10988840 | Ga0207657_109888402 | 114 |
| 165 | 3300025923 | Ga0207681_10001640 | Ga0207681_1000164016 | 114 |
| 166 | 3300025923 | Ga0207681_10374132 | Ga0207681_103741323 | 114 |
| 167 | 3300025925 | Ga0207650_10414828 | Ga0207650_104148282 | 114 |
| 168 | 3300025925 | Ga0207650_10426786 | Ga0207650_104267862 | 114 |
| 169 | 3300025931 | Ga0207644_10000301 | Ga0207644_1000030121 | 114 |
| 170 | 3300025931 | Ga0207644_10007717 | Ga0207644_100077174 | 114 |
| 171 | 3300025941 | Ga0207711_10003527 | Ga0207711_1000352713 | 114 |
| 172 | 3300025941 | Ga0207711_10603000 | Ga0207711_106030002 | 114 |
| 173 | 3300025945 | Ga0207679_10329728 | Ga0207679_103297282 | 114 |
| 174 | 3300025949 | Ga0207667_10167283 | Ga0207667_101672832 | 114 |
| 175 | 3300025949 | Ga0207667_11030557 | Ga0207667_110305572 | 114 |
| 176 | 3300025972 | Ga0207668_10005163 | Ga0207668_1000516310 | 114 |
| 177 | 3300025972 | Ga0207668_11759465 | Ga0207668_117594652 | 114 |
| 178 | 3300025981 | Ga0207640_10001764 | Ga0207640_100017642 | 114 |
| 179 | 3300025981 | Ga0207640_10258502 | Ga0207640_102585023 | 114 |
| 180 | 3300025986 | Ga0207658_10002164 | Ga0207658_100021646 | 114 |
| 181 | 3300025986 | Ga0207658_10002795 | Ga0207658_1000279511 | 114 |
| 182 | 3300025986 | Ga0207658_10006034 | Ga0207658_100060346 | 114 |
| 183 | 3300025986 | Ga0207658_11893773 | Ga0207658_118937731 | 114 |
| 184 | 3300026035 | Ga0207703_10009721 | Ga0207703_1000972111 | 114 |
| 185 | 3300026035 | Ga0207703_10036151 | Ga0207703_100361513 | 114 |
| 186 | 3300026041 | Ga0207639_11499786 | Ga0207639_114997861 | 114 |
| 187 | 3300026067 | Ga0207678_10169745 | Ga0207678_101697453 | 114 |
| 188 | 3300026078 | Ga0207702_10264385 | Ga0207702_102643852 | 114 |
| 189 | 3300026088 | Ga0207641_10000042 | Ga0207641_1000004252 | 114 |
| 190 | 3300026088 | Ga0207641_10002483 | Ga0207641_1000248315 | 114 |
| 191 | 3300026088 | Ga0207641_10009181 | Ga0207641_100091816 | 114 |
| 192 | 3300026095 | Ga0207676_10003074 | Ga0207676_100030744 | 114 |
| 193 | 3300026116 | Ga0207674_10275696 | Ga0207674_102756961 | 114 |
| 194 | 3300026116 | Ga0207674_10347554 | Ga0207674_103475543 | 114 |
| 195 | 3300026142 | Ga0207698_10091494 | Ga0207698_100914942 | 114 |
| 196 | 3300026142 | Ga0207698_10537869 | Ga0207698_105378692 | 114 |
| 197 | 3300026142 | Ga0207698_10859098 | Ga0207698_108590981 | 114 |
| 198 | 3300026142 | Ga0207698_11273778 | Ga0207698_112737782 | 114 |
| 199 | 3300027312 | Ga0209371_1018849 | Ga0209371_10188492 | 114 |
| 200 | 3300027665 | Ga0209983_1033705 | Ga0209983_10337052 | 114 |
| 201 | 3300027866 | Ga0209813_10000060 | Ga0209813_1000006030 | 114 |
| 202 | 3300027876 | Ga0209974_10017694 | Ga0209974_100176942 | 114 |
| 203 | 3300027907 | Ga0207428_10208715 | Ga0207428_102087152 | 114 |
| 204 | 3300028379 | Ga0268266_10000175 | Ga0268266_1000017575 | 114 |
| 205 | 3300028379 | Ga0268266_10123791 | Ga0268266_101237912 | 114 |
| 206 | 3300028380 | Ga0268265_10001670 | Ga0268265_100016709 | 114 |
| 207 | 3300028380 | Ga0268265_10023931 | Ga0268265_100239314 | 114 |
| 208 | 3300028380 | Ga0268265_10081784 | Ga0268265_100817842 | 114 |
| 209 | 3300028381 | Ga0268264_10000134 | Ga0268264_1000013451 | 114 |
| 210 | 3300028381 | Ga0268264_10001327 | Ga0268264_1000132722 | 114 |
| 211 | 3300030500 | Ga0268256_1021114 | Ga0268256_10211143 | 114 |
| 212 | 3300031548 | Ga0307408_100521979 | Ga0307408_1005219792 | 114 |
| 213 | 3300031548 | Ga0307408_100526141 | Ga0307408_1005261412 | 114 |
| 214 | 3300031616 | Ga0307508_10006626 | Ga0307508_1000662610 | 114 |
| 215 | 3300031691 | Ga0316579_10029677 | Ga0316579_100296772 | 114 |
| 216 | 3300031824 | Ga0307413_10964327 | Ga0307413_109643271 | 114 |
| 217 | 3300031852 | Ga0307410_10064487 | Ga0307410_100644873 | 114 |
| 218 | 3300031852 | Ga0307410_10144217 | Ga0307410_101442172 | 114 |
| 219 | 3300031901 | Ga0307406_10440824 | Ga0307406_104408243 | 114 |
| 220 | 3300031901 | Ga0307406_10557700 | Ga0307406_105577001 | 114 |
| 221 | 3300031901 | Ga0307406_11008351 | Ga0307406_110083513 | 114 |
| 222 | 3300031901 | Ga0307406_11237320 | Ga0307406_112373201 | 114 |
| 223 | 3300031903 | Ga0307407_10432047 | Ga0307407_104320471 | 114 |
| 224 | 3300031903 | Ga0307407_11482502 | Ga0307407_114825021 | 114 |
| 225 | 3300031911 | Ga0307412_10363307 | Ga0307412_103633073 | 114 |
| 226 | 3300031995 | Ga0307409_100121099 | Ga0307409_1001210992 | 114 |
| 227 | 3300031995 | Ga0307409_100477402 | Ga0307409_1004774021 | 114 |
| 228 | 3300031995 | Ga0307409_101506201 | Ga0307409_1015062011 | 114 |
| 229 | 3300032004 | Ga0307414_10021612 | Ga0307414_100216123 | 114 |
| 230 | 3300032004 | Ga0307414_10243909 | Ga0307414_102439093 | 114 |
| 231 | 3300032004 | Ga0307414_10983919 | Ga0307414_109839192 | 114 |
| 232 | 3300032005 | Ga0307411_10026273 | Ga0307411_100262732 | 114 |
| 233 | 3300032005 | Ga0307411_10174709 | Ga0307411_101747092 | 114 |
| 234 | 3300032005 | Ga0307411_10278336 | Ga0307411_102783361 | 114 |
| 235 | 3300034817 | Ga0373948_0024597 | Ga0373948_0024597_459_803 | 114 |
| 236 | 3300035091 | Ga0373951_0026572 | Ga0373951_0026572_391_735 | 114 |
| 237 | 3300035112 | Ga0373932_0028330 | Ga0373932_0028330_1081_1425 | 114 |
| 238 | 3300035112 | Ga0373932_0078030 | Ga0373932_0078030_70_414 | 114 |
| 239 | 3300035691 | Ga0373931_0009733 | Ga0373931_0009733_815_1159 | 114 |
| 240 | 3300036647 | Ga0316582_0001804 | Ga0316582_0001804_8469_8813 | 114 |
| 241 | 3300037588 | Ga0316581_0119451 | Ga0316581_0119451_291_635 | 114 |
| 242 | 3300041498 | Ga0451841_1261334 | Ga0451841_1261334_209_553 | 114 |
| 243 | 3300041503 | Ga0451847_0054085 | Ga0451847_0054085_273_617 | 114 |
| 244 | 3300041511 | Ga0451855_0648019 | Ga0451855_0648019_46_390 | 114 |
| 245 | 3300041512 | Ga0451853_1231575 | Ga0451853_1231575_204_548 | 114 |
| 246 | 3300044712 | Ga0453684_0431866 | Ga0453684_0431866_126_470 | 114 |
| 247 | 3300045051 | Ga0451576_0000393 | Ga0451576_0000393_19255_19599 | 114 |
| 248 | 3300046453 | Ga0495627_000278 | Ga0495627_000278_33545_33889 | 114 |
| 249 | 3300046471 | Ga0495650_0019051 | Ga0495650_0019051_760_1104 | 114 |
| 250 | 3300046501 | Ga0495607_0007897 | Ga0495607_0007897_1088_1432 | 114 |
| 251 | 3300046506 | Ga0495583_0141245 | Ga0495583_0141245_93_437 | 114 |
| 252 | 3300046507 | Ga0495606_0020711 | Ga0495606_0020711_3668_4012 | 114 |
| 253 | 3300046512 | Ga0495610_0000022 | Ga0495610_0000022_48041_48385 | 114 |
| 254 | 3300046512 | Ga0495610_0000116 | Ga0495610_0000116_69563_69907 | 114 |
| 255 | 3300046515 | Ga0495620_0007739 | Ga0495620_0007739_1576_1920 | 114 |
| 256 | 3300046515 | Ga0495620_0104710 | Ga0495620_0104710_380_724 | 114 |
| 257 | 3300046519 | Ga0495632_0001423 | Ga0495632_0001423_15264_15608 | 114 |
| 258 | 3300046522 | Ga0495643_0000048 | Ga0495643_0000048_26742_27086 | 114 |
| 259 | 3300046522 | Ga0495643_0010895 | Ga0495643_0010895_1559_1903 | 114 |
| 260 | 3300046522 | Ga0495643_0045605 | Ga0495643_0045605_448_792 | 114 |
| 261 | 3300046530 | Ga0495654_0019330 | Ga0495654_0019330_2837_3181 | 114 |
| 262 | 3300046538 | Ga0495609_0009557 | Ga0495609_0009557_764_1108 | 114 |
| 263 | 3300046558 | Ga0495633_0236865 | Ga0495633_0236865_347_691 | 114 |
| 264 | 3300046648 | Ga0495611_0278768 | Ga0495611_0278768_95_439 | 114 |
| 265 | 3300046660 | Ga0495625_0036497 | Ga0495625_0036497_2463_2807 | 114 |
| 266 | 3300046692 | Ga0495671_0111545 | Ga0495671_0111545_836_1180 | 114 |
| 267 | 3300047470 | Ga0495681_0000974 | Ga0495681_0000974_4295_4639 | 114 |
| 268 | 3300048905 | Ga0496102_0265930 | Ga0496102_0265930_599_943 | 114 |
| 269 | 3300048906 | Ga0496103_0057430 | Ga0496103_0057430_181_525 | 114 |
| 270 | 3300048907 | Ga0496104_0006304 | Ga0496104_0006304_7418_7762 | 114 |
| 271 | 3300048908 | Ga0496105_0000786 | Ga0496105_0000786_13506_13850 | 114 |
| 272 | 3300048909 | Ga0496106_0401950 | Ga0496106_0401950_275_619 | 114 |
| 273 | 3300048919 | Ga0496116_0190261 | Ga0496116_0190261_672_1016 | 114 |
| 274 | 3300048920 | Ga0496117_0041107 | Ga0496117_0041107_1502_1846 | 114 |
| 275 | 3300048920 | Ga0496117_0061697 | Ga0496117_0061697_2008_2352 | 114 |
| 276 | 3300048921 | Ga0496118_0036083 | Ga0496118_0036083_207_551 | 114 |
| 277 | 3300048921 | Ga0496118_0100461 | Ga0496118_0100461_882_1226 | 114 |
| 278 | 3300048921 | Ga0496118_0330382 | Ga0496118_0330382_277_621 | 114 |
| 279 | 3300048922 | Ga0496119_0094685 | Ga0496119_0094685_958_1302 | 114 |
| 280 | 3300048922 | Ga0496119_0188591 | Ga0496119_0188591_581_925 | 114 |
| 281 | 3300048923 | Ga0496120_0067501 | Ga0496120_0067501_19_363 | 114 |
| 282 | 3300048923 | Ga0496120_0099033 | Ga0496120_0099033_510_854 | 114 |
| 283 | 3300048924 | Ga0496121_0000274 | Ga0496121_0000274_32221_32565 | 114 |
| 284 | 3300048924 | Ga0496121_0001542 | Ga0496121_0001542_16832_17176 | 114 |
| 285 | 3300048924 | Ga0496121_0026104 | Ga0496121_0026104_1587_1931 | 114 |
| 286 | 3300048925 | Ga0496122_0300540 | Ga0496122_0300540_482_826 | 114 |
| 287 | 3300048927 | Ga0496124_0004428 | Ga0496124_0004428_6666_7010 | 114 |
| 288 | 3300048927 | Ga0496124_0670130 | Ga0496124_0670130_182_526 | 114 |
| 289 | 3300048928 | Ga0496125_0066493 | Ga0496125_0066493_654_998 | 114 |
| 290 | 3300048929 | Ga0496126_0024094 | Ga0496126_0024094_1595_1996 | 114 |
| 291 | 3300048929 | Ga0496126_0188805 | Ga0496126_0188805_839_1183 | 114 |
| 292 | 3300048929 | Ga0496126_0523696 | Ga0496126_0523696_164_508 | 114 |
| 293 | 3300049570 | Ga0501033_0483360 | Ga0501033_0483360_297_641 | 114 |
| 294 | 3300049571 | Ga0501034_0086244 | Ga0501034_0086244_784_1128 | 114 |
| 295 | 3300049573 | Ga0501037_0933054 | Ga0501037_0933054_104_448 | 114 |
| 296 | 3300049578 | Ga0501042_0879000 | Ga0501042_0879000_76_444 | 114 |
| 297 | 3300049579 | Ga0501043_0647596 | Ga0501043_0647596_178_522 | 114 |
| 298 | 3300049581 | Ga0501047_0310052 | Ga0501047_0310052_262_606 | 114 |
| 299 | 3300049589 | Ga0501073_0498586 | Ga0501073_0498586_434_778 | 114 |
| 300 | 3300049590 | Ga0501074_0313712 | Ga0501074_0313712_687_1031 | 114 |
| 301 | 3300049742 | Ga0501080_0097493 | Ga0501080_0097493_1798_2142 | 114 |
| 302 | 3300049822 | Ga0501035_1133225 | Ga0501035_1133225_31_375 | 114 |
| 303 | 3300049823 | Ga0501044_0443805 | Ga0501044_0443805_295_639 | 114 |
| 304 | 3300049823 | Ga0501044_0537103 | Ga0501044_0537103_76_420 | 114 |
| 305 | 3300050489 | nmdc:mga03683_393_c1 | nmdc:mga03683_393_c1_2055_2399 | 114 |
| 306 | 3300050489 | nmdc:mga03683_54_c1 | nmdc:mga03683_54_c1_10535_10879 | 114 |
| 307 | 3300050490 | nmdc:mga03n38_17905_c1 | nmdc:mga03n38_17905_c1_1362_1706 | 114 |
| 308 | 3300050491 | nmdc:mga00v17_26625_c1 | nmdc:mga00v17_26625_c1_2816_3184 | 114 |
| 309 | 3300050491 | nmdc:mga00v17_50992_c1 | nmdc:mga00v17_50992_c1_1384_1728 | 114 |
| 310 | 3300050491 | nmdc:mga00v17_86123_c1 | nmdc:mga00v17_86123_c1_1588_1932 | 114 |
| 311 | 3300050492 | nmdc:mga0yw44_75993_c1 | nmdc:mga0yw44_75993_c1_1715_2059 | 114 |
| 312 | 3300050493 | nmdc:mga0k408_144648_c1 | nmdc:mga0k408_144648_c1_105_449 | 114 |
| 313 | 3300050493 | nmdc:mga0k408_288125_c1 | nmdc:mga0k408_288125_c1_151_495 | 114 |
| 314 | 3300050493 | nmdc:mga0k408_30_c1 | nmdc:mga0k408_30_c1_78747_79091 | 114 |
| 315 | 3300050493 | nmdc:mga0k408_9440_c1 | nmdc:mga0k408_9440_c1_2302_2646 | 114 |
| 316 | 3300050494 | nmdc:mga06z11_12161_c1 | nmdc:mga06z11_12161_c1_77_421 | 114 |
| 317 | 3300050494 | nmdc:mga06z11_8750_c1 | nmdc:mga06z11_8750_c1_1711_2055 | 114 |
| 318 | 3300050495 | nmdc:mga04h51_73_c1 | nmdc:mga04h51_73_c1_28690_29034 | 114 |
| 319 | 3300050496 | nmdc:mga07m45_14_c1 | nmdc:mga07m45_14_c1_141903_142247 | 114 |
| 320 | 3300050496 | nmdc:mga07m45_356356_c1 | nmdc:mga07m45_356356_c1_491_835 | 114 |
| 321 | 3300050496 | nmdc:mga07m45_5_c2 | nmdc:mga07m45_5_c2_230479_230823 | 114 |
| 322 | 3300050511 | nmdc:mga08y16_1185242_c1 | nmdc:mga08y16_1185242_c1_332_676 | 114 |
| 323 | 3300050514 | nmdc:mga08x19_590237_c1 | nmdc:mga08x19_590237_c1_227_571 | 114 |
| 324 | 3300050516 | nmdc:mga0sz30_209_c1 | nmdc:mga0sz30_209_c1_1115_1459 | 114 |
| 325 | 3300050516 | nmdc:mga0sz30_26143_c1 | nmdc:mga0sz30_26143_c1_913_1281 | 114 |
| 326 | 3300050516 | nmdc:mga0sz30_285_c1 | nmdc:mga0sz30_285_c1_8523_8867 | 114 |
| 327 | 3300053096 | Ga0500641_0217791 | Ga0500641_0217791_114_458 | 114 |
| 328 | 3300053116 | Ga0500592_009899 | Ga0500592_009899_507_851 | 114 |
| 329 | 3300053125 | Ga0500618_002176 | Ga0500618_002176_1079_1423 | 114 |
| 330 | 3300053130 | Ga0500642_0281237 | Ga0500642_0281237_302_646 | 114 |
| 331 | 3300053136 | Ga0500559_0570247 | Ga0500559_0570247_117_461 | 114 |
| 332 | 3300053139 | Ga0500568_0030918 | Ga0500568_0030918_1423_1767 | 114 |
| 333 | 3300053148 | Ga0500590_043015 | Ga0500590_043015_433_777 | 114 |
| 334 | 3300053730 | Ga0500645_027564 | Ga0500645_027564_546_890 | 114 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s3d-assembly1.cif.gz_A | arsenate reductase r60a mutant from e. coli | 0.9316 | 3 | 114 |
| 1s3c-assembly1.cif.gz_A | arsenate reductase c12s mutant from e. coli | 0.9307 | 3 | 114 |
| 1i9d-assembly1.cif.gz_A | arsenate reductase from e. coli | 0.9303 | 3 | 114 |
| 1sd8-assembly1.cif.gz_A | arsenate reductase r60k mutant from e. coli | 0.9301 | 3 | 114 |
| 3f0i-assembly2.cif.gz_B | arsenate reductase from vibrio cholerae. | 0.9217 | 1 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1j9bA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9207 | 3 | 114 | 3.40.30.10 |
| 3rdwB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9053 | 3 | 113 | 3.40.30.10 |
| 1j9bA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8977 | 3 | 114 | 3.40.30.10 |
| 3gkxA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8356 | 3 | 111 | 3.40.30.10 |
| 3fz4A00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8233 | 4 | 98 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Z0BWA4-F1-model_v4 | Arsenate reductase (EC 1.20.4.1) | 1.004 | 1 | 114 |
GO:0008794
GO:0046685 |
| AF-A0A844X9V8-F1-model_v4 | Arsenate reductase (EC 1.20.4.1) | 1.004 | 1 | 114 |
GO:0008794
GO:0046685 |
| AF-F6IK14-F1-model_v4 | Arsenate reductase (EC 1.20.4.1) | 1.003 | 1 | 114 |
GO:0008794
GO:0046685 |
| AF-A0A5B8S250-F1-model_v4 | Arsenate reductase (EC 1.20.4.1) | 1.002 | 1 | 114 |
GO:0008794
GO:0046685 |
| AF-A0A418NQR2-F1-model_v4 | Arsenate reductase (EC 1.20.4.1) | 1.001 | 1 | 114 |
GO:0008794
GO:0046685 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar