F411967

General Info

Members Datasets Scaffolds Average Seq Length
334 200 330 114

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0024094|Ga0496126_0024094_1595_1996
Length 133
Sequence LRKNFAALERWRNLTVEQGMKATIWHNPNCGTSRKTLAILQETPGVDVTVVEYLKNPPSADKLAQLYRDAGLTPQQGLRTRGTDAVERALPDADDATVLAAMAAEPILIERPLVETDKGVRLCRPQEKVHEIL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
3 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
4 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
5 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
89 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
97 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
109 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
110 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
120 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
121 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
128 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
132 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
133 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
136 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
137 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
144 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
145 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
175 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
178 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
185 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
186 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
187 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
188 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
189 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
190 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
191 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
192 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
193 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
194 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
195 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
196 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
197 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
198 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
199 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
200 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.56
Nodule 0
Rhizoplane 1.5
Rhizosphere 70.96
Stem 0
Stem Tuber 0
Unclassified 8.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2139679 2162886007 Bacteria 32324
2 JGI24740J21852_10007723 3300001979 Bacteria 4349
3 JGI24739J22299_10006039 3300001989 Bacteria 4584
4 JGI24739J22299_10015785 3300001989 Bacteria 2743
5 JGI24737J22298_10018925 3300001990 Bacteria 2204
6 JGI24751J29686_10093544 3300002459 Bacteria 626
7 Ga0065704_10070184 3300005289 Bacteria 119655
8 Ga0065704_10091329 3300005289 Bacteria 2724
9 Ga0065707_10095751 3300005295 Bacteria 3342
10 Ga0065707_10483252 3300005295 Bacteria 772
11 Ga0070670_100230570 3300005331 Bacteria 1611
12 Ga0070670_100594498 3300005331 Bacteria 990
13 Ga0070666_10362584 3300005335 Bacteria 1038
14 Ga0070660_100051814 3300005339 Bacteria 3162
15 Ga0070660_101163637 3300005339 Bacteria 653
16 Ga0070668_100004671 3300005347 Bacteria 10151
17 Ga0070668_100007677 3300005347 Bacteria 8005
18 Ga0070668_100035236 3300005347 Bacteria 3816
19 Ga0070668_100839402 3300005347 Bacteria 818
20 Ga0070668_101486562 3300005347 Bacteria 619
21 Ga0070669_100000470 3300005353 Bacteria 30618
22 Ga0070669_100054642 3300005353 Bacteria 2925
23 Ga0070669_100580750 3300005353 Bacteria 937
24 Ga0070671_100027935 3300005355 Bacteria 4645
25 Ga0070671_100847291 3300005355 Bacteria 797
26 Ga0070667_100000361 3300005367 Bacteria 49412
27 Ga0070667_100004988 3300005367 Bacteria 11124
28 Ga0070667_100074931 3300005367 Bacteria 2888
29 Ga0070667_101855598 3300005367 Bacteria 567
30 Ga0070667_101941361 3300005367 Bacteria 554
31 Ga0070663_100274868 3300005455 Bacteria 1340
32 Ga0070662_100031601 3300005457 Bacteria 3717
33 Ga0070706_100525396 3300005467 Bacteria 1101
34 Ga0070707_100625153 3300005468 Bacteria 1039
35 Ga0068853_100016030 3300005539 Bacteria 6161
36 Ga0070665_100000079 3300005548 Bacteria 186925
37 Ga0070665_100002115 3300005548 Bacteria 22199
38 Ga0068855_100135496 3300005563 Bacteria 2810
39 Ga0068855_100689714 3300005563 Bacteria 1094
40 Ga0068855_101218939 3300005563 Bacteria 782
41 Ga0068857_100130170 3300005577 Bacteria 2269
42 Ga0068857_100302289 3300005577 Bacteria 1475
43 Ga0068857_100406839 3300005577 Bacteria 1267
44 Ga0068857_100574969 3300005577 Bacteria 1063
45 Ga0068854_100002482 3300005578 Bacteria 11417
46 Ga0068854_100046755 3300005578 Bacteria 3082
47 Ga0068854_100302054 3300005578 Bacteria 1295
48 Ga0068856_100584502 3300005614 Bacteria 1138
49 Ga0068852_100048891 3300005616 Bacteria 3616
50 Ga0068852_100373413 3300005616 Bacteria 1397
51 Ga0068852_100461561 3300005616 Bacteria 1259
52 Ga0068852_100738676 3300005616 Bacteria 996
53 Ga0068852_101331214 3300005616 Bacteria 740
54 Ga0068859_100489480 3300005617 Bacteria 1325
55 Ga0068864_100083785 3300005618 Bacteria 2800
56 Ga0068863_100000052 3300005841 Bacteria 125430
57 Ga0068863_100031745 3300005841 Bacteria 5040
58 Ga0068863_100829113 3300005841 Bacteria 923
59 Ga0068858_100013942 3300005842 Bacteria 7582
60 Ga0068860_100000007 3300005843 Bacteria 429329
61 Ga0068860_100026003 3300005843 Bacteria 5646
62 Ga0068860_100187933 3300005843 Bacteria 1998
63 Ga0068862_100004597 3300005844 Bacteria 11629
64 Ga0068862_100020390 3300005844 Bacteria 5538
65 Ga0068862_100111124 3300005844 Bacteria 2405
66 Ga0075365_10180159 3300006038 Bacteria 1477
67 Ga0075368_10005996 3300006042 Bacteria 4216
68 Ga0075363_100061212 3300006048 Bacteria 2028
69 Ga0075364_10010170 3300006051 Bacteria 5674
70 Ga0075364_10025657 3300006051 Bacteria 3753
71 Ga0075364_10152530 3300006051 Bacteria 1557
72 Ga0075364_10153695 3300006051 Bacteria 1551
73 Ga0075432_10002998 3300006058 Bacteria 5686
74 Ga0075432_10090532 3300006058 Bacteria 1119
75 Ga0075362_10000026 3300006177 Bacteria 58544
76 Ga0075362_10001144 3300006177 Bacteria 8286
77 Ga0075367_10002649 3300006178 Bacteria 8240
78 Ga0075367_10325390 3300006178 Bacteria 969
79 Ga0075369_10000639 3300006186 Bacteria 11123
80 Ga0075369_10006377 3300006186 Bacteria 4459
81 Ga0075369_10027164 3300006186 Bacteria 2391
82 Ga0075366_10000156 3300006195 Bacteria 28915
83 Ga0075366_10011959 3300006195 Bacteria 4915
84 Ga0075366_10150292 3300006195 Bacteria 1410
85 Ga0075370_10000033 3300006353 Bacteria 44344
86 Ga0075370_10262124 3300006353 Bacteria 1025
87 Ga0075370_10360354 3300006353 Bacteria 869
88 Ga0075436_100681779 3300006914 Bacteria 761
89 Ga0097620_100489490 3300006931 Bacteria 1325
90 Ga0105251_10000232 3300009011 Bacteria 56006
91 Ga0105251_10208613 3300009011 Bacteria 880
92 Ga0111539_10945551 3300009094 Bacteria 1002
93 Ga0105247_10335487 3300009101 Bacteria 1059
94 Ga0105248_10129158 3300009177 Bacteria 2851
95 Ga0105248_10265393 3300009177 Bacteria 1933
96 Ga0105238_10187296 3300009551 Bacteria 2046
97 Ga0105249_10491709 3300009553 Bacteria 1271
98 Ga0157371_10029643 3300013102 Bacteria 3954
99 Ga0157371_10536584 3300013102 Bacteria 866
100 Ga0157369_10443195 3300013105 Bacteria 1345
101 Ga0163162_10780183 3300013306 Bacteria 1074
102 Ga0157372_10224794 3300013307 Bacteria 2176
103 Ga0157375_10348721 3300013308 Bacteria 1646
104 Ga0163161_10005548 3300017792 Bacteria 8740
105 Ga0207713_1022603 3300025735 Bacteria 2980
106 Ga0207710_10750217 3300025900 Bacteria 513
107 Ga0207680_10084120 3300025903 Bacteria 2007
108 Ga0207705_10002600 3300025909 Bacteria 13873
109 Ga0207705_10128424 3300025909 Bacteria 1885
110 Ga0207705_10274557 3300025909 Bacteria 1289
111 Ga0207657_10631220 3300025919 Bacteria 835
112 Ga0207657_10988840 3300025919 Bacteria 646
113 Ga0207646_10523053 3300025922 Bacteria 1068
114 Ga0207681_10001640 3300025923 Bacteria 14420
115 Ga0207681_10374132 3300025923 Bacteria 1145
116 Ga0207681_10904732 3300025923 Bacteria 739
117 Ga0207694_10176241 3300025924 Bacteria 1732
118 Ga0207650_10414828 3300025925 Bacteria 1116
119 Ga0207650_10426786 3300025925 Bacteria 1101
120 Ga0207644_10000301 3300025931 Bacteria 32173
121 Ga0207644_10007717 3300025931 Bacteria 7022
122 Ga0207706_10040385 3300025933 Bacteria 4135
123 Ga0207711_10003527 3300025941 Bacteria 13542
124 Ga0207711_10603000 3300025941 Bacteria 1024
125 Ga0207679_10329728 3300025945 Bacteria 1324
126 Ga0207667_10167283 3300025949 Bacteria 2260
127 Ga0207667_11030557 3300025949 Bacteria 809
128 Ga0207712_10857301 3300025961 Bacteria 801
129 Ga0207668_10005163 3300025972 Bacteria 7682
130 Ga0207668_11759465 3300025972 Bacteria 559
131 Ga0207640_10001764 3300025981 Bacteria 11618
132 Ga0207640_10027132 3300025981 Bacteria 3487
133 Ga0207640_10258502 3300025981 Bacteria 1356
134 Ga0207658_10002164 3300025986 Bacteria 14602
135 Ga0207658_10002795 3300025986 Bacteria 12557
136 Ga0207658_10006034 3300025986 Bacteria 8273
137 Ga0207658_11893773 3300025986 Bacteria 543
138 Ga0207703_10009721 3300026035 Bacteria 7547
139 Ga0207703_10036151 3300026035 Bacteria 3929
140 Ga0207639_10028642 3300026041 Bacteria 4069
141 Ga0207639_11499786 3300026041 Bacteria 633
142 Ga0207678_10169745 3300026067 Bacteria 1863
143 Ga0207702_10264385 3300026078 Bacteria 1621
144 Ga0207641_10000042 3300026088 Bacteria 186384
145 Ga0207641_10002483 3300026088 Bacteria 17018
146 Ga0207641_10009181 3300026088 Bacteria 8162
147 Ga0207641_10440177 3300026088 Bacteria 1258
148 Ga0207676_10003074 3300026095 Bacteria 11910
149 Ga0207674_10275696 3300026116 Bacteria 1630
150 Ga0207674_10347554 3300026116 Bacteria 1434
151 Ga0207674_10648300 3300026116 Bacteria 1020
152 Ga0207698_10091494 3300026142 Bacteria 2490
153 Ga0207698_10492629 3300026142 Bacteria 1191
154 Ga0207698_10537869 3300026142 Bacteria 1143
155 Ga0207698_10859098 3300026142 Bacteria 913
156 Ga0207698_11273778 3300026142 Bacteria 750
157 Ga0209371_1018849 3300027312 Bacteria 1740
158 Ga0209983_1033705 3300027665 Bacteria 1096
159 Ga0209813_10000060 3300027866 Bacteria 44068
160 Ga0209974_10017694 3300027876 Bacteria 2363
161 Ga0207428_10208715 3300027907 Bacteria 1468
162 Ga0268266_10000175 3300028379 Bacteria 115897
163 Ga0268266_10123791 3300028379 Bacteria 2304
164 Ga0268265_10001670 3300028380 Bacteria 18127
165 Ga0268265_10023931 3300028380 Bacteria 4313
166 Ga0268265_10081784 3300028380 Bacteria 2551
167 Ga0268264_10000134 3300028381 Bacteria 179475
168 Ga0268264_10001327 3300028381 Bacteria 23270
169 Ga0268256_1021114 3300030500 Bacteria 1740
170 Ga0307408_100102864 3300031548 Bacteria 2179
171 Ga0307408_100521979 3300031548 Bacteria 1043
172 Ga0307408_100526141 3300031548 Bacteria 1039
173 Ga0307508_10006626 3300031616 Bacteria 10875
174 Ga0316579_10029677 3300031691 Bacteria 2496
175 Ga0307405_10139980 3300031731 Bacteria 1685
176 Ga0307413_10964327 3300031824 Bacteria 728
177 Ga0307410_10064487 3300031852 Bacteria 2517
178 Ga0307410_10144217 3300031852 Bacteria 1765
179 Ga0307406_10134319 3300031901 Bacteria 1741
180 Ga0307406_10440824 3300031901 Bacteria 1042
181 Ga0307406_10557700 3300031901 Bacteria 938
182 Ga0307406_11008351 3300031901 Bacteria 715
183 Ga0307406_11237320 3300031901 Bacteria 649
184 Ga0307407_10432047 3300031903 Bacteria 952
185 Ga0307407_11482502 3300031903 Bacteria 536
186 Ga0307412_10009408 3300031911 Bacteria 5606
187 Ga0307412_10363307 3300031911 Bacteria 1166
188 Ga0307409_100121099 3300031995 Bacteria 2216
189 Ga0307409_100477402 3300031995 Bacteria 1209
190 Ga0307409_101506201 3300031995 Bacteria 700
191 Ga0307416_100401395 3300032002 Bacteria 1408
192 Ga0307414_10021612 3300032004 Bacteria 4043
193 Ga0307414_10243909 3300032004 Bacteria 1489
194 Ga0307414_10983919 3300032004 Bacteria 776
195 Ga0307411_10026273 3300032005 Bacteria 3504
196 Ga0307411_10174709 3300032005 Bacteria 1624
197 Ga0307411_10278336 3300032005 Bacteria 1330
198 Ga0307411_11391375 3300032005 Bacteria 642
199 Ga0373948_0024597 3300034817 Bacteria 1176
200 Ga0373951_0026572 3300035091 Bacteria 1349
201 Ga0373932_0028330 3300035112 Bacteria 1539
202 Ga0373932_0078030 3300035112 Bacteria 1041
203 Ga0373946_0072817 3300035171 Bacteria 1488
204 Ga0373931_0009733 3300035691 Bacteria 4602
205 Ga0316582_0001804 3300036647 Bacteria 9669
206 Ga0373925_0815504 3300037068 Bacteria 769
207 Ga0395900_1503880 3300037418 Bacteria 585
208 Ga0395905_0368918 3300037471 Bacteria 1329
209 Ga0316581_0119451 3300037588 Bacteria 812
210 Ga0395901_0540749 3300038443 Bacteria 1182
211 Ga0451841_1261334 3300041498 Bacteria 732
212 Ga0451847_0054085 3300041503 Bacteria 1066
213 Ga0451855_0648019 3300041511 Bacteria 1056
214 Ga0451853_1231575 3300041512 Bacteria 603
215 Ga0453684_0431866 3300044712 Bacteria 1469
216 Ga0451576_0000393 3300045051 Bacteria 101814
217 Ga0495627_000278 3300046453 Bacteria 51546
218 Ga0495650_0019051 3300046471 Bacteria 3391
219 Ga0495607_0007897 3300046501 Bacteria 7319
220 Ga0495583_0141245 3300046506 Bacteria 1002
221 Ga0495583_0217848 3300046506 Bacteria 772
222 Ga0495606_0020711 3300046507 Bacteria 4839
223 Ga0495610_0000022 3300046512 Bacteria 317107
224 Ga0495610_0000116 3300046512 Bacteria 90702
225 Ga0495620_0007739 3300046515 Bacteria 5804
226 Ga0495620_0104710 3300046515 Bacteria 1125
227 Ga0495632_0001423 3300046519 Bacteria 19923
228 Ga0495632_0099806 3300046519 Bacteria 1369
229 Ga0495637_0075598 3300046520 Bacteria 1351
230 Ga0495643_0000048 3300046522 Bacteria 212788
231 Ga0495643_0010895 3300046522 Bacteria 5569
232 Ga0495643_0045605 3300046522 Bacteria 2379
233 Ga0495654_0019330 3300046530 Bacteria 3563
234 Ga0495609_0009557 3300046538 Bacteria 4689
235 Ga0495609_0286232 3300046538 Bacteria 673
236 Ga0495597_0209340 3300046542 Bacteria 778
237 Ga0495633_0236865 3300046558 Bacteria 834
238 Ga0495668_0147933 3300046616 Bacteria 1286
239 Ga0495668_0390408 3300046616 Bacteria 765
240 Ga0495611_0278768 3300046648 Bacteria 772
241 Ga0495625_0036497 3300046660 Bacteria 3612
242 Ga0495669_0044136 3300046684 Bacteria 1985
243 Ga0495671_0111545 3300046692 Bacteria 1335
244 Ga0495673_0020031 3300047469 Bacteria 3338
245 Ga0495681_0000974 3300047470 Bacteria 21885
246 Ga0495686_0001246 3300047472 Bacteria 29040
247 Ga0496102_0265930 3300048905 Bacteria 1617
248 Ga0496103_0057430 3300048906 Bacteria 2416
249 Ga0496104_0006304 3300048907 Bacteria 10433
250 Ga0496105_0000786 3300048908 Bacteria 21442
251 Ga0496106_0401950 3300048909 Bacteria 1101
252 Ga0496116_0190261 3300048919 Bacteria 1087
253 Ga0496117_0041107 3300048920 Bacteria 3392
254 Ga0496117_0061697 3300048920 Bacteria 2575
255 Ga0496118_0036083 3300048921 Bacteria 4003
256 Ga0496118_0100461 3300048921 Bacteria 1957
257 Ga0496118_0330382 3300048921 Bacteria 822
258 Ga0496119_0036762 3300048922 Bacteria 3191
259 Ga0496119_0094685 3300048922 Bacteria 1689
260 Ga0496119_0188591 3300048922 Bacteria 1076
261 Ga0496120_0067501 3300048923 Bacteria 1975
262 Ga0496120_0099033 3300048923 Bacteria 1544
263 Ga0496120_0511092 3300048923 Bacteria 515
264 Ga0496121_0000274 3300048924 Bacteria 107140
265 Ga0496121_0001542 3300048924 Bacteria 38556
266 Ga0496121_0026104 3300048924 Bacteria 5518
267 Ga0496122_0300540 3300048925 Bacteria 866
268 Ga0496123_0237656 3300048926 Bacteria 907
269 Ga0496124_0004428 3300048927 Bacteria 16380
270 Ga0496124_0670130 3300048927 Bacteria 662
271 Ga0496125_0066493 3300048928 Bacteria 2847
272 Ga0496125_0327713 3300048928 Bacteria 925
273 Ga0496126_0024094 3300048929 Bacteria 5880
274 Ga0496126_0188805 3300048929 Bacteria 1746
275 Ga0496126_0523696 3300048929 Bacteria 944
276 Ga0501033_0483360 3300049570 Bacteria 858
277 Ga0501034_0086244 3300049571 Bacteria 3141
278 Ga0501037_0933054 3300049573 Bacteria 568
279 Ga0501042_0879000 3300049578 Bacteria 653
280 Ga0501043_0647596 3300049579 Bacteria 776
281 Ga0501047_0310052 3300049581 Bacteria 1419
282 Ga0501073_0498586 3300049589 Bacteria 842
283 Ga0501074_0313712 3300049590 Bacteria 1114
284 Ga0501080_0097493 3300049742 Bacteria 2730
285 Ga0501035_1133225 3300049822 Bacteria 610
286 Ga0501044_0443805 3300049823 Bacteria 1205
287 Ga0501044_0537103 3300049823 Bacteria 1068
288 nmdc:mga03683_393_c1 3300050489 Bacteria 12561
289 nmdc:mga03683_54_c1 3300050489 Bacteria 47475
290 nmdc:mga03n38_17905_c1 3300050490 Bacteria 2784
291 nmdc:mga00v17_26625_c1 3300050491 Bacteria 3372
292 nmdc:mga00v17_50992_c1 3300050491 Bacteria 2516
293 nmdc:mga00v17_86123_c1 3300050491 Bacteria 1969
294 nmdc:mga0yw44_75993_c1 3300050492 Bacteria 2096
295 nmdc:mga0k408_144648_c1 3300050493 Bacteria 1415
296 nmdc:mga0k408_288125_c1 3300050493 Bacteria 980
297 nmdc:mga0k408_30_c1 3300050493 Bacteria 89511
298 nmdc:mga0k408_9440_c1 3300050493 Bacteria 5257
299 nmdc:mga06z11_12161_c1 3300050494 Bacteria 3736
300 nmdc:mga06z11_8750_c1 3300050494 Bacteria 4239
301 nmdc:mga04h51_73_c1 3300050495 Bacteria 32039
302 nmdc:mga07m45_14_c1 3300050496 Bacteria 154035
303 nmdc:mga07m45_356356_c1 3300050496 Bacteria 850
304 nmdc:mga07m45_5_c2 3300050496 Bacteria 297012
305 nmdc:mga08y16_1185242_c1 3300050511 Bacteria 735
306 nmdc:mga08x19_590237_c1 3300050514 Bacteria 787
307 nmdc:mga0sz30_209_c1 3300050516 Bacteria 21984
308 nmdc:mga0sz30_26143_c1 3300050516 Bacteria 2391
309 nmdc:mga0sz30_285_c1 3300050516 Bacteria 19408
310 Ga0500647_0056076 3300053091 Bacteria 1895
311 Ga0500651_0045361 3300053093 Bacteria 2765
312 Ga0500641_0217791 3300053096 Bacteria 810
313 Ga0500556_0224086 3300053104 Bacteria 742
314 Ga0500592_009899 3300053116 Bacteria 1517
315 Ga0500592_016440 3300053116 Bacteria 1187
316 Ga0500618_002176 3300053125 Bacteria 7686
317 Ga0500642_0002658 3300053130 Bacteria 5279
318 Ga0500642_0281237 3300053130 Bacteria 756
319 Ga0500655_000247 3300053133 Bacteria 12687
320 Ga0500559_0172601 3300053136 Bacteria 1017
321 Ga0500559_0570247 3300053136 Bacteria 515
322 Ga0500568_0030918 3300053139 Bacteria 2214
323 Ga0500590_003221 3300053148 Bacteria 7468
324 Ga0500590_043015 3300053148 Bacteria 2318
325 Ga0500622_0013951 3300053156 Bacteria 4322
326 Ga0500639_122391 3300053163 Bacteria 1247
327 Ga0500636_0387351 3300053177 Bacteria 653
328 Ga0500570_021671 3300053724 Bacteria 3574
329 Ga0500645_027564 3300053730 Bacteria 1722
330 Ga0500645_079964 3300053730 Bacteria 933

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2818991438 2819552220 110
2 iso_pu_bacteria 2896184354 2896186634 110
3 iso_pu_bacteria 2896253425 2896254401 110
4 iso_pu_bacteria 2919138771 2919139211 110
5 3300001979 JGI24740J21852_10007723 JGI24740J21852_100077232 112
6 3300001989 JGI24739J22299_10006039 JGI24739J22299_100060395 112
7 3300001989 JGI24739J22299_10015785 JGI24739J22299_100157854 112
8 3300001990 JGI24737J22298_10018925 JGI24737J22298_100189252 112
9 3300005339 Ga0070660_100051814 Ga0070660_1000518144 112
10 3300005457 Ga0070662_100031601 Ga0070662_1000316012 112
11 3300005539 Ga0068853_100016030 Ga0068853_1000160302 112
12 3300005577 Ga0068857_100130170 Ga0068857_1001301702 112
13 3300005578 Ga0068854_100046755 Ga0068854_1000467552 112
14 3300005616 Ga0068852_100373413 Ga0068852_1003734132 112
15 3300009551 Ga0105238_10187296 Ga0105238_101872962 112
16 3300025924 Ga0207694_10176241 Ga0207694_101762413 112
17 3300025933 Ga0207706_10040385 Ga0207706_100403854 112
18 3300025981 Ga0207640_10027132 Ga0207640_100271322 112
19 3300026041 Ga0207639_10028642 Ga0207639_100286424 112
20 3300026116 Ga0207674_10648300 Ga0207674_106483002 112
21 3300026142 Ga0207698_10492629 Ga0207698_104926292 112
22 3300031548 Ga0307408_100102864 Ga0307408_1001028642 112
23 3300031731 Ga0307405_10139980 Ga0307405_101399802 112
24 3300031901 Ga0307406_10134319 Ga0307406_101343192 112
25 3300031911 Ga0307412_10009408 Ga0307412_100094087 112
26 3300032002 Ga0307416_100401395 Ga0307416_1004013952 112
27 3300032005 Ga0307411_11391375 Ga0307411_113913751 112
28 3300035171 Ga0373946_0072817 Ga0373946_0072817_450_788 112
29 3300037068 Ga0373925_0815504 Ga0373925_0815504_79_417 112
30 3300037418 Ga0395900_1503880 Ga0395900_1503880_136_474 112
31 3300037471 Ga0395905_0368918 Ga0395905_0368918_466_804 112
32 3300038443 Ga0395901_0540749 Ga0395901_0540749_658_996 112
33 3300046506 Ga0495583_0217848 Ga0495583_0217848_205_543 112
34 3300046519 Ga0495632_0099806 Ga0495632_0099806_47_385 112
35 3300046520 Ga0495637_0075598 Ga0495637_0075598_465_803 112
36 3300046538 Ga0495609_0286232 Ga0495609_0286232_301_639 112
37 3300046542 Ga0495597_0209340 Ga0495597_0209340_224_562 112
38 3300046616 Ga0495668_0147933 Ga0495668_0147933_463_801 112
39 3300046616 Ga0495668_0390408 Ga0495668_0390408_398_736 112
40 3300046684 Ga0495669_0044136 Ga0495669_0044136_421_759 112
41 3300047469 Ga0495673_0020031 Ga0495673_0020031_2727_3065 112
42 3300047472 Ga0495686_0001246 Ga0495686_0001246_15301_15639 112
43 3300048922 Ga0496119_0036762 Ga0496119_0036762_2432_2770 112
44 3300048923 Ga0496120_0511092 Ga0496120_0511092_167_505 112
45 3300048926 Ga0496123_0237656 Ga0496123_0237656_113_451 112
46 3300048928 Ga0496125_0327713 Ga0496125_0327713_401_739 112
47 3300053091 Ga0500647_0056076 Ga0500647_0056076_292_630 112
48 3300053093 Ga0500651_0045361 Ga0500651_0045361_602_940 112
49 3300053104 Ga0500556_0224086 Ga0500556_0224086_311_649 112
50 3300053116 Ga0500592_016440 Ga0500592_016440_511_849 112
51 3300053130 Ga0500642_0002658 Ga0500642_0002658_558_896 112
52 3300053133 Ga0500655_000247 Ga0500655_000247_2337_2675 112
53 3300053136 Ga0500559_0172601 Ga0500559_0172601_405_743 112
54 3300053148 Ga0500590_003221 Ga0500590_003221_2259_2597 112
55 3300053156 Ga0500622_0013951 Ga0500622_0013951_143_481 112
56 3300053163 Ga0500639_122391 Ga0500639_122391_610_948 112
57 3300053177 Ga0500636_0387351 Ga0500636_0387351_217_555 112
58 3300053724 Ga0500570_021671 Ga0500570_021671_431_769 112
59 3300053730 Ga0500645_079964 Ga0500645_079964_340_678 112
60 3300002459 JGI24751J29686_10093544 JGI24751J29686_100935442 113
61 3300005295 Ga0065707_10483252 Ga0065707_104832522 113
62 3300005353 Ga0070669_100580750 Ga0070669_1005807502 113
63 3300005467 Ga0070706_100525396 Ga0070706_1005253963 113
64 3300005468 Ga0070707_100625153 Ga0070707_1006251532 113
65 3300005617 Ga0068859_100489480 Ga0068859_1004894803 113
66 3300005841 Ga0068863_100829113 Ga0068863_1008291132 113
67 3300006931 Ga0097620_100489490 Ga0097620_1004894903 113
68 3300009553 Ga0105249_10491709 Ga0105249_104917093 113
69 3300025922 Ga0207646_10523053 Ga0207646_105230532 113
70 3300025923 Ga0207681_10904732 Ga0207681_109047322 113
71 3300025961 Ga0207712_10857301 Ga0207712_108573012 113
72 3300026088 Ga0207641_10440177 Ga0207641_104401772 113
73 2162886007 SwRhRL2b_contig_2139679 SwRhRL2b_0810.00002180 114
74 3300005289 Ga0065704_10070184 Ga0065704_1007018419 114
75 3300005289 Ga0065704_10091329 Ga0065704_100913292 114
76 3300005295 Ga0065707_10095751 Ga0065707_100957512 114
77 3300005331 Ga0070670_100230570 Ga0070670_1002305702 114
78 3300005331 Ga0070670_100594498 Ga0070670_1005944982 114
79 3300005335 Ga0070666_10362584 Ga0070666_103625842 114
80 3300005339 Ga0070660_101163637 Ga0070660_1011636371 114
81 3300005347 Ga0070668_100004671 Ga0070668_1000046719 114
82 3300005347 Ga0070668_100007677 Ga0070668_1000076774 114
83 3300005347 Ga0070668_100035236 Ga0070668_1000352364 114
84 3300005347 Ga0070668_100839402 Ga0070668_1008394022 114
85 3300005347 Ga0070668_101486562 Ga0070668_1014865622 114
86 3300005353 Ga0070669_100000470 Ga0070669_10000047029 114
87 3300005353 Ga0070669_100054642 Ga0070669_1000546423 114
88 3300005355 Ga0070671_100027935 Ga0070671_1000279351 114
89 3300005355 Ga0070671_100847291 Ga0070671_1008472911 114
90 3300005367 Ga0070667_100000361 Ga0070667_10000036124 114
91 3300005367 Ga0070667_100004988 Ga0070667_10000498813 114
92 3300005367 Ga0070667_100074931 Ga0070667_1000749312 114
93 3300005367 Ga0070667_101855598 Ga0070667_1018555982 114
94 3300005367 Ga0070667_101941361 Ga0070667_1019413611 114
95 3300005455 Ga0070663_100274868 Ga0070663_1002748682 114
96 3300005548 Ga0070665_100000079 Ga0070665_10000007982 114
97 3300005548 Ga0070665_100002115 Ga0070665_10000211518 114
98 3300005563 Ga0068855_100135496 Ga0068855_1001354964 114
99 3300005563 Ga0068855_100689714 Ga0068855_1006897142 114
100 3300005563 Ga0068855_101218939 Ga0068855_1012189392 114
101 3300005577 Ga0068857_100302289 Ga0068857_1003022892 114
102 3300005577 Ga0068857_100406839 Ga0068857_1004068393 114
103 3300005577 Ga0068857_100574969 Ga0068857_1005749691 114
104 3300005578 Ga0068854_100002482 Ga0068854_1000024822 114
105 3300005578 Ga0068854_100302054 Ga0068854_1003020541 114
106 3300005614 Ga0068856_100584502 Ga0068856_1005845022 114
107 3300005616 Ga0068852_100048891 Ga0068852_1000488914 114
108 3300005616 Ga0068852_100461561 Ga0068852_1004615612 114
109 3300005616 Ga0068852_100738676 Ga0068852_1007386761 114
110 3300005616 Ga0068852_101331214 Ga0068852_1013312142 114
111 3300005618 Ga0068864_100083785 Ga0068864_1000837855 114
112 3300005841 Ga0068863_100000052 Ga0068863_10000005252 114
113 3300005841 Ga0068863_100031745 Ga0068863_1000317456 114
114 3300005842 Ga0068858_100013942 Ga0068858_1000139422 114
115 3300005843 Ga0068860_100000007 Ga0068860_100000007364 114
116 3300005843 Ga0068860_100026003 Ga0068860_1000260037 114
117 3300005843 Ga0068860_100187933 Ga0068860_1001879333 114
118 3300005844 Ga0068862_100004597 Ga0068862_10000459712 114
119 3300005844 Ga0068862_100020390 Ga0068862_1000203905 114
120 3300005844 Ga0068862_100111124 Ga0068862_1001111245 114
121 3300006038 Ga0075365_10180159 Ga0075365_101801593 114
122 3300006042 Ga0075368_10005996 Ga0075368_100059963 114
123 3300006048 Ga0075363_100061212 Ga0075363_1000612123 114
124 3300006051 Ga0075364_10010170 Ga0075364_100101702 114
125 3300006051 Ga0075364_10025657 Ga0075364_100256576 114
126 3300006051 Ga0075364_10152530 Ga0075364_101525302 114
127 3300006051 Ga0075364_10153695 Ga0075364_101536953 114
128 3300006058 Ga0075432_10002998 Ga0075432_100029985 114
129 3300006058 Ga0075432_10090532 Ga0075432_100905322 114
130 3300006177 Ga0075362_10000026 Ga0075362_1000002648 114
131 3300006177 Ga0075362_10001144 Ga0075362_100011444 114
132 3300006178 Ga0075367_10002649 Ga0075367_100026492 114
133 3300006178 Ga0075367_10325390 Ga0075367_103253902 114
134 3300006186 Ga0075369_10000639 Ga0075369_100006392 114
135 3300006186 Ga0075369_10006377 Ga0075369_100063775 114
136 3300006186 Ga0075369_10027164 Ga0075369_100271643 114
137 3300006195 Ga0075366_10000156 Ga0075366_100001567 114
138 3300006195 Ga0075366_10011959 Ga0075366_100119594 114
139 3300006195 Ga0075366_10150292 Ga0075366_101502922 114
140 3300006353 Ga0075370_10000033 Ga0075370_1000003314 114
141 3300006353 Ga0075370_10262124 Ga0075370_102621241 114
142 3300006353 Ga0075370_10360354 Ga0075370_103603542 114
143 3300006914 Ga0075436_100681779 Ga0075436_1006817792 114
144 3300009011 Ga0105251_10000232 Ga0105251_1000023221 114
145 3300009011 Ga0105251_10208613 Ga0105251_102086132 114
146 3300009094 Ga0111539_10945551 Ga0111539_109455512 114
147 3300009101 Ga0105247_10335487 Ga0105247_103354872 114
148 3300009177 Ga0105248_10129158 Ga0105248_101291582 114
149 3300009177 Ga0105248_10265393 Ga0105248_102653933 114
150 3300013102 Ga0157371_10029643 Ga0157371_100296434 114
151 3300013102 Ga0157371_10536584 Ga0157371_105365842 114
152 3300013105 Ga0157369_10443195 Ga0157369_104431953 114
153 3300013306 Ga0163162_10780183 Ga0163162_107801832 114
154 3300013307 Ga0157372_10224794 Ga0157372_102247942 114
155 3300013308 Ga0157375_10348721 Ga0157375_103487212 114
156 3300017792 Ga0163161_10005548 Ga0163161_100055488 114
157 3300025735 Ga0207713_1022603 Ga0207713_10226031 114
158 3300025900 Ga0207710_10750217 Ga0207710_107502172 114
159 3300025903 Ga0207680_10084120 Ga0207680_100841201 114
160 3300025909 Ga0207705_10002600 Ga0207705_1000260015 114
161 3300025909 Ga0207705_10128424 Ga0207705_101284241 114
162 3300025909 Ga0207705_10274557 Ga0207705_102745573 114
163 3300025919 Ga0207657_10631220 Ga0207657_106312201 114
164 3300025919 Ga0207657_10988840 Ga0207657_109888402 114
165 3300025923 Ga0207681_10001640 Ga0207681_1000164016 114
166 3300025923 Ga0207681_10374132 Ga0207681_103741323 114
167 3300025925 Ga0207650_10414828 Ga0207650_104148282 114
168 3300025925 Ga0207650_10426786 Ga0207650_104267862 114
169 3300025931 Ga0207644_10000301 Ga0207644_1000030121 114
170 3300025931 Ga0207644_10007717 Ga0207644_100077174 114
171 3300025941 Ga0207711_10003527 Ga0207711_1000352713 114
172 3300025941 Ga0207711_10603000 Ga0207711_106030002 114
173 3300025945 Ga0207679_10329728 Ga0207679_103297282 114
174 3300025949 Ga0207667_10167283 Ga0207667_101672832 114
175 3300025949 Ga0207667_11030557 Ga0207667_110305572 114
176 3300025972 Ga0207668_10005163 Ga0207668_1000516310 114
177 3300025972 Ga0207668_11759465 Ga0207668_117594652 114
178 3300025981 Ga0207640_10001764 Ga0207640_100017642 114
179 3300025981 Ga0207640_10258502 Ga0207640_102585023 114
180 3300025986 Ga0207658_10002164 Ga0207658_100021646 114
181 3300025986 Ga0207658_10002795 Ga0207658_1000279511 114
182 3300025986 Ga0207658_10006034 Ga0207658_100060346 114
183 3300025986 Ga0207658_11893773 Ga0207658_118937731 114
184 3300026035 Ga0207703_10009721 Ga0207703_1000972111 114
185 3300026035 Ga0207703_10036151 Ga0207703_100361513 114
186 3300026041 Ga0207639_11499786 Ga0207639_114997861 114
187 3300026067 Ga0207678_10169745 Ga0207678_101697453 114
188 3300026078 Ga0207702_10264385 Ga0207702_102643852 114
189 3300026088 Ga0207641_10000042 Ga0207641_1000004252 114
190 3300026088 Ga0207641_10002483 Ga0207641_1000248315 114
191 3300026088 Ga0207641_10009181 Ga0207641_100091816 114
192 3300026095 Ga0207676_10003074 Ga0207676_100030744 114
193 3300026116 Ga0207674_10275696 Ga0207674_102756961 114
194 3300026116 Ga0207674_10347554 Ga0207674_103475543 114
195 3300026142 Ga0207698_10091494 Ga0207698_100914942 114
196 3300026142 Ga0207698_10537869 Ga0207698_105378692 114
197 3300026142 Ga0207698_10859098 Ga0207698_108590981 114
198 3300026142 Ga0207698_11273778 Ga0207698_112737782 114
199 3300027312 Ga0209371_1018849 Ga0209371_10188492 114
200 3300027665 Ga0209983_1033705 Ga0209983_10337052 114
201 3300027866 Ga0209813_10000060 Ga0209813_1000006030 114
202 3300027876 Ga0209974_10017694 Ga0209974_100176942 114
203 3300027907 Ga0207428_10208715 Ga0207428_102087152 114
204 3300028379 Ga0268266_10000175 Ga0268266_1000017575 114
205 3300028379 Ga0268266_10123791 Ga0268266_101237912 114
206 3300028380 Ga0268265_10001670 Ga0268265_100016709 114
207 3300028380 Ga0268265_10023931 Ga0268265_100239314 114
208 3300028380 Ga0268265_10081784 Ga0268265_100817842 114
209 3300028381 Ga0268264_10000134 Ga0268264_1000013451 114
210 3300028381 Ga0268264_10001327 Ga0268264_1000132722 114
211 3300030500 Ga0268256_1021114 Ga0268256_10211143 114
212 3300031548 Ga0307408_100521979 Ga0307408_1005219792 114
213 3300031548 Ga0307408_100526141 Ga0307408_1005261412 114
214 3300031616 Ga0307508_10006626 Ga0307508_1000662610 114
215 3300031691 Ga0316579_10029677 Ga0316579_100296772 114
216 3300031824 Ga0307413_10964327 Ga0307413_109643271 114
217 3300031852 Ga0307410_10064487 Ga0307410_100644873 114
218 3300031852 Ga0307410_10144217 Ga0307410_101442172 114
219 3300031901 Ga0307406_10440824 Ga0307406_104408243 114
220 3300031901 Ga0307406_10557700 Ga0307406_105577001 114
221 3300031901 Ga0307406_11008351 Ga0307406_110083513 114
222 3300031901 Ga0307406_11237320 Ga0307406_112373201 114
223 3300031903 Ga0307407_10432047 Ga0307407_104320471 114
224 3300031903 Ga0307407_11482502 Ga0307407_114825021 114
225 3300031911 Ga0307412_10363307 Ga0307412_103633073 114
226 3300031995 Ga0307409_100121099 Ga0307409_1001210992 114
227 3300031995 Ga0307409_100477402 Ga0307409_1004774021 114
228 3300031995 Ga0307409_101506201 Ga0307409_1015062011 114
229 3300032004 Ga0307414_10021612 Ga0307414_100216123 114
230 3300032004 Ga0307414_10243909 Ga0307414_102439093 114
231 3300032004 Ga0307414_10983919 Ga0307414_109839192 114
232 3300032005 Ga0307411_10026273 Ga0307411_100262732 114
233 3300032005 Ga0307411_10174709 Ga0307411_101747092 114
234 3300032005 Ga0307411_10278336 Ga0307411_102783361 114
235 3300034817 Ga0373948_0024597 Ga0373948_0024597_459_803 114
236 3300035091 Ga0373951_0026572 Ga0373951_0026572_391_735 114
237 3300035112 Ga0373932_0028330 Ga0373932_0028330_1081_1425 114
238 3300035112 Ga0373932_0078030 Ga0373932_0078030_70_414 114
239 3300035691 Ga0373931_0009733 Ga0373931_0009733_815_1159 114
240 3300036647 Ga0316582_0001804 Ga0316582_0001804_8469_8813 114
241 3300037588 Ga0316581_0119451 Ga0316581_0119451_291_635 114
242 3300041498 Ga0451841_1261334 Ga0451841_1261334_209_553 114
243 3300041503 Ga0451847_0054085 Ga0451847_0054085_273_617 114
244 3300041511 Ga0451855_0648019 Ga0451855_0648019_46_390 114
245 3300041512 Ga0451853_1231575 Ga0451853_1231575_204_548 114
246 3300044712 Ga0453684_0431866 Ga0453684_0431866_126_470 114
247 3300045051 Ga0451576_0000393 Ga0451576_0000393_19255_19599 114
248 3300046453 Ga0495627_000278 Ga0495627_000278_33545_33889 114
249 3300046471 Ga0495650_0019051 Ga0495650_0019051_760_1104 114
250 3300046501 Ga0495607_0007897 Ga0495607_0007897_1088_1432 114
251 3300046506 Ga0495583_0141245 Ga0495583_0141245_93_437 114
252 3300046507 Ga0495606_0020711 Ga0495606_0020711_3668_4012 114
253 3300046512 Ga0495610_0000022 Ga0495610_0000022_48041_48385 114
254 3300046512 Ga0495610_0000116 Ga0495610_0000116_69563_69907 114
255 3300046515 Ga0495620_0007739 Ga0495620_0007739_1576_1920 114
256 3300046515 Ga0495620_0104710 Ga0495620_0104710_380_724 114
257 3300046519 Ga0495632_0001423 Ga0495632_0001423_15264_15608 114
258 3300046522 Ga0495643_0000048 Ga0495643_0000048_26742_27086 114
259 3300046522 Ga0495643_0010895 Ga0495643_0010895_1559_1903 114
260 3300046522 Ga0495643_0045605 Ga0495643_0045605_448_792 114
261 3300046530 Ga0495654_0019330 Ga0495654_0019330_2837_3181 114
262 3300046538 Ga0495609_0009557 Ga0495609_0009557_764_1108 114
263 3300046558 Ga0495633_0236865 Ga0495633_0236865_347_691 114
264 3300046648 Ga0495611_0278768 Ga0495611_0278768_95_439 114
265 3300046660 Ga0495625_0036497 Ga0495625_0036497_2463_2807 114
266 3300046692 Ga0495671_0111545 Ga0495671_0111545_836_1180 114
267 3300047470 Ga0495681_0000974 Ga0495681_0000974_4295_4639 114
268 3300048905 Ga0496102_0265930 Ga0496102_0265930_599_943 114
269 3300048906 Ga0496103_0057430 Ga0496103_0057430_181_525 114
270 3300048907 Ga0496104_0006304 Ga0496104_0006304_7418_7762 114
271 3300048908 Ga0496105_0000786 Ga0496105_0000786_13506_13850 114
272 3300048909 Ga0496106_0401950 Ga0496106_0401950_275_619 114
273 3300048919 Ga0496116_0190261 Ga0496116_0190261_672_1016 114
274 3300048920 Ga0496117_0041107 Ga0496117_0041107_1502_1846 114
275 3300048920 Ga0496117_0061697 Ga0496117_0061697_2008_2352 114
276 3300048921 Ga0496118_0036083 Ga0496118_0036083_207_551 114
277 3300048921 Ga0496118_0100461 Ga0496118_0100461_882_1226 114
278 3300048921 Ga0496118_0330382 Ga0496118_0330382_277_621 114
279 3300048922 Ga0496119_0094685 Ga0496119_0094685_958_1302 114
280 3300048922 Ga0496119_0188591 Ga0496119_0188591_581_925 114
281 3300048923 Ga0496120_0067501 Ga0496120_0067501_19_363 114
282 3300048923 Ga0496120_0099033 Ga0496120_0099033_510_854 114
283 3300048924 Ga0496121_0000274 Ga0496121_0000274_32221_32565 114
284 3300048924 Ga0496121_0001542 Ga0496121_0001542_16832_17176 114
285 3300048924 Ga0496121_0026104 Ga0496121_0026104_1587_1931 114
286 3300048925 Ga0496122_0300540 Ga0496122_0300540_482_826 114
287 3300048927 Ga0496124_0004428 Ga0496124_0004428_6666_7010 114
288 3300048927 Ga0496124_0670130 Ga0496124_0670130_182_526 114
289 3300048928 Ga0496125_0066493 Ga0496125_0066493_654_998 114
290 3300048929 Ga0496126_0024094 Ga0496126_0024094_1595_1996 114
291 3300048929 Ga0496126_0188805 Ga0496126_0188805_839_1183 114
292 3300048929 Ga0496126_0523696 Ga0496126_0523696_164_508 114
293 3300049570 Ga0501033_0483360 Ga0501033_0483360_297_641 114
294 3300049571 Ga0501034_0086244 Ga0501034_0086244_784_1128 114
295 3300049573 Ga0501037_0933054 Ga0501037_0933054_104_448 114
296 3300049578 Ga0501042_0879000 Ga0501042_0879000_76_444 114
297 3300049579 Ga0501043_0647596 Ga0501043_0647596_178_522 114
298 3300049581 Ga0501047_0310052 Ga0501047_0310052_262_606 114
299 3300049589 Ga0501073_0498586 Ga0501073_0498586_434_778 114
300 3300049590 Ga0501074_0313712 Ga0501074_0313712_687_1031 114
301 3300049742 Ga0501080_0097493 Ga0501080_0097493_1798_2142 114
302 3300049822 Ga0501035_1133225 Ga0501035_1133225_31_375 114
303 3300049823 Ga0501044_0443805 Ga0501044_0443805_295_639 114
304 3300049823 Ga0501044_0537103 Ga0501044_0537103_76_420 114
305 3300050489 nmdc:mga03683_393_c1 nmdc:mga03683_393_c1_2055_2399 114
306 3300050489 nmdc:mga03683_54_c1 nmdc:mga03683_54_c1_10535_10879 114
307 3300050490 nmdc:mga03n38_17905_c1 nmdc:mga03n38_17905_c1_1362_1706 114
308 3300050491 nmdc:mga00v17_26625_c1 nmdc:mga00v17_26625_c1_2816_3184 114
309 3300050491 nmdc:mga00v17_50992_c1 nmdc:mga00v17_50992_c1_1384_1728 114
310 3300050491 nmdc:mga00v17_86123_c1 nmdc:mga00v17_86123_c1_1588_1932 114
311 3300050492 nmdc:mga0yw44_75993_c1 nmdc:mga0yw44_75993_c1_1715_2059 114
312 3300050493 nmdc:mga0k408_144648_c1 nmdc:mga0k408_144648_c1_105_449 114
313 3300050493 nmdc:mga0k408_288125_c1 nmdc:mga0k408_288125_c1_151_495 114
314 3300050493 nmdc:mga0k408_30_c1 nmdc:mga0k408_30_c1_78747_79091 114
315 3300050493 nmdc:mga0k408_9440_c1 nmdc:mga0k408_9440_c1_2302_2646 114
316 3300050494 nmdc:mga06z11_12161_c1 nmdc:mga06z11_12161_c1_77_421 114
317 3300050494 nmdc:mga06z11_8750_c1 nmdc:mga06z11_8750_c1_1711_2055 114
318 3300050495 nmdc:mga04h51_73_c1 nmdc:mga04h51_73_c1_28690_29034 114
319 3300050496 nmdc:mga07m45_14_c1 nmdc:mga07m45_14_c1_141903_142247 114
320 3300050496 nmdc:mga07m45_356356_c1 nmdc:mga07m45_356356_c1_491_835 114
321 3300050496 nmdc:mga07m45_5_c2 nmdc:mga07m45_5_c2_230479_230823 114
322 3300050511 nmdc:mga08y16_1185242_c1 nmdc:mga08y16_1185242_c1_332_676 114
323 3300050514 nmdc:mga08x19_590237_c1 nmdc:mga08x19_590237_c1_227_571 114
324 3300050516 nmdc:mga0sz30_209_c1 nmdc:mga0sz30_209_c1_1115_1459 114
325 3300050516 nmdc:mga0sz30_26143_c1 nmdc:mga0sz30_26143_c1_913_1281 114
326 3300050516 nmdc:mga0sz30_285_c1 nmdc:mga0sz30_285_c1_8523_8867 114
327 3300053096 Ga0500641_0217791 Ga0500641_0217791_114_458 114
328 3300053116 Ga0500592_009899 Ga0500592_009899_507_851 114
329 3300053125 Ga0500618_002176 Ga0500618_002176_1079_1423 114
330 3300053130 Ga0500642_0281237 Ga0500642_0281237_302_646 114
331 3300053136 Ga0500559_0570247 Ga0500559_0570247_117_461 114
332 3300053139 Ga0500568_0030918 Ga0500568_0030918_1423_1767 114
333 3300053148 Ga0500590_043015 Ga0500590_043015_433_777 114
334 3300053730 Ga0500645_027564 Ga0500645_027564_546_890 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

25

132

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s3d-assembly1.cif.gz_A arsenate reductase r60a mutant from e. coli 0.9316 3 114
1s3c-assembly1.cif.gz_A arsenate reductase c12s mutant from e. coli 0.9307 3 114
1i9d-assembly1.cif.gz_A arsenate reductase from e. coli 0.9303 3 114
1sd8-assembly1.cif.gz_A arsenate reductase r60k mutant from e. coli 0.9301 3 114
3f0i-assembly2.cif.gz_B arsenate reductase from vibrio cholerae. 0.9217 1 114
ID Description Score Start End Superfamily
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9207 3 114 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9053 3 113 3.40.30.10
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8977 3 114 3.40.30.10
3gkxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8356 3 111 3.40.30.10
3fz4A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8233 4 98 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7Z0BWA4-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.004 1 114 GO:0008794
GO:0046685
AF-A0A844X9V8-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.004 1 114 GO:0008794
GO:0046685
AF-F6IK14-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.003 1 114 GO:0008794
GO:0046685
AF-A0A5B8S250-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.002 1 114 GO:0008794
GO:0046685
AF-A0A418NQR2-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.001 1 114 GO:0008794
GO:0046685

Feature Viewer

pLDDT pTM Quality
97.57 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map