F411969

General Info

Members Datasets Scaffolds Average Seq Length
334 229 238 312

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0003876|Ga0501032_0003876_1138_2154
Length 338
Sequence MVDGVLDADAGLPQAGDAPMTADPYGKQERDVRIDICVCTYRRPELEDTLQSIGTLRLPEGATARVIVADNDTEPSARDLVYRTASRLPFHVSYVHCPASNISIARNACLDAATGGLLAFLDDDETVSPDWLIALLRTAGETGADAVLGPVEAVYGDAPGWMKRGDFHSTAPVWVAGEIMTGYTCNVLLHRSSPALAGRRFNLALGRTGGEDTEYFSRLHEAGGKIVFAPDAIVRERVPANRARLSWLARRRFRMGQTHGRLLAEDRNAAARAMQVALAAGKVGYCLAVAAISVFMPVARNRSVLRGIMHSGVIGGLIGFREIRQYGEAPLGAHGNAD

Samples

Sample ID Description Type Environment
1 2509276019 Ensifer aridi TW10 Isolate Nodule
2 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
3 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
4 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
5 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
6 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
7 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
8 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
9 2516143018 Ensifer sp. BR816 Isolate Nodule
10 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
11 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
12 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
13 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
14 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
15 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
16 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
17 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
18 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
19 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
20 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
21 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
22 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
23 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
24 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
25 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
26 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
27 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
28 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
29 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
30 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
31 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
32 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
33 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
34 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
35 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
36 2643221599 Rhizobium sp. Root708 Isolate Unclassified
37 2643221607 Rhizobium sp. Root73 Isolate Unclassified
38 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
39 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
40 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
41 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
42 2643221688 Rhizobium sp. Root482 Isolate Unclassified
43 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
44 2643221718 Rhizobium sp. Root268 Isolate Unclassified
45 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
46 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
47 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
48 2738541293 Rhizobium sp. GV031 Isolate Unclassified
49 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
50 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
51 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
52 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
53 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
54 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
55 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
56 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
57 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
58 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
59 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
60 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
61 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
62 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
63 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
64 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
65 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
66 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
67 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
68 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
69 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
70 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
71 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
72 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
73 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
74 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
75 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
76 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
77 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
78 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
79 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
80 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
81 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
82 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
83 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
84 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
85 2996887358 Rhizobium sp. R711 Isolate Nodule
86 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
87 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
88 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
89 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
90 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
91 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
92 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
93 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
94 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
95 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
96 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
97 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
98 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
99 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
100 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
101 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
102 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
103 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
104 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
105 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
106 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
107 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
108 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
109 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
110 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
111 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
112 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
113 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
114 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
115 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
116 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
117 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
123 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
124 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
125 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
126 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
127 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
128 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
129 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
130 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
131 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
132 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
133 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
134 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
136 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
137 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
138 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
166 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
167 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
172 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
173 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
219 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
220 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
224 8005258706 Rhizobium sp. R693 Isolate Nodule
225 8005321885 Rhizobium sp. R72 Isolate Nodule
226 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
227 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
228 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
229 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.26
Metatranscriptomes 0
Isolates 28.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.67
Nodule 12.28
Rhizoplane 2.1
Rhizosphere 43.41
Stem 0
Stem Tuber 0
Unclassified 27.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000020 3300002704 Bacteria 152963
2 JGI25156J39149_1000021 3300002705 Bacteria 152968
3 JGI25162J39368_1000648 3300002737 Bacteria 24664
4 JGI25154J39366_1000039 3300002738 Bacteria 152972
5 JGI25157J39369_1000019 3300002741 Bacteria 176591
6 JGI25152J39213_1000919 3300002773 Bacteria 14437
7 JGI25152J39213_1000947 3300002773 Bacteria 14240
8 JGI25150J39212_1000024 3300002774 Bacteria 129646
9 JGI25151J46595_10000027 3300003187 Bacteria 208739
10 JGI25151J46595_10005943 3300003187 Bacteria 6222
11 JGI25165J46597_1000018 3300003214 Bacteria 374701
12 JGI25153J46596_10008091 3300003215 Bacteria 5071
13 rootL2_10070040 3300003322 Bacteria 2652
14 JGI25160J50197_1000014 3300003354 Bacteria 259862
15 JGI25161J50226_1000061 3300003374 Bacteria 101391
16 Ga0055526_1012933 3300003771 Bacteria 3580
17 Ga0055526_1013935 3300003771 Bacteria 3353
18 Ga0055524_1024861 3300003775 Bacteria 1888
19 Ga0055528_1018002 3300003790 Bacteria 2417
20 Ga0055540_1027095 3300003792 Bacteria 1376
21 Ga0055543_1000005 3300004625 Bacteria 223621
22 Ga0065165_1000126 3300005262 Bacteria 129946
23 Ga0070668_100150238 3300005347 Bacteria 1883
24 Ga0070671_100002420 3300005355 Bacteria 14422
25 Ga0070663_100057618 3300005455 Bacteria 2788
26 Ga0070665_100251114 3300005548 Bacteria 1769
27 Ga0068855_100246519 3300005563 Bacteria 1994
28 Ga0068856_100011897 3300005614 Bacteria 8426
29 Ga0068862_100290546 3300005844 Bacteria 1501
30 Ga0075365_10006724 3300006038 Bacteria 6360
31 Ga0075365_10017420 3300006038 Bacteria 4395
32 Ga0075365_10053819 3300006038 Bacteria 2667
33 Ga0075370_10021559 3300006353 Bacteria 3530
34 Ga0105251_10009801 3300009011 Bacteria 5616
35 Ga0105240_10000012 3300009093 Bacteria 496639
36 Ga0105237_10001333 3300009545 Bacteria 32755
37 Ga0105249_10223027 3300009553 Bacteria 1856
38 Ga0157370_10000571 3300013104 Bacteria 45989
39 Ga0171463_1009 3300013249 Bacteria 288284
40 Ga0182007_10002748 3300015262 Bacteria 8599
41 Ga0182005_1000879 3300015265 Bacteria 13296
42 Ga0183363_1407 3300015690 Bacteria 3599
43 Ga0214544_1000419 3300021320 Bacteria 76083
44 Ga0214542_1000027 3300021321 Bacteria 175107
45 Ga0214543_1000023 3300021327 Bacteria 240412
46 Ga0214543_1000047 3300021327 Bacteria 150894
47 Ga0209435_100025 3300025206 Bacteria 198776
48 Ga0209437_100022 3300025233 Bacteria 625694
49 Ga0207425_1000043 3300025245 Bacteria 208791
50 Ga0209646_1000083 3300025246 Bacteria 198777
51 Ga0209646_1003245 3300025246 Bacteria 3261
52 Ga0209026_1000078 3300025250 Bacteria 198777
53 Ga0209677_101967 3300025253 Bacteria 8175
54 Ga0209759_1000060 3300025256 Bacteria 198777
55 Ga0209129_1000072 3300025258 Bacteria 208805
56 Ga0209233_1000031 3300025261 Bacteria 624646
57 Ga0209233_1000146 3300025261 Bacteria 187269
58 Ga0209673_1002528 3300025273 Bacteria 12532
59 Ga0209673_1004738 3300025273 Bacteria 7156
60 Ga0209673_1020106 3300025273 Bacteria 2373
61 Ga0209673_1020298 3300025273 Bacteria 2357
62 Ga0209130_1000013 3300025284 Bacteria 412810
63 Ga0209025_1000120 3300025294 Bacteria 208791
64 Ga0209025_1000121 3300025294 Bacteria 208700
65 Ga0209025_1032257 3300025294 Bacteria 2454
66 Ga0209564_1007913 3300025295 Bacteria 5364
67 Ga0209564_1009058 3300025295 Bacteria 4794
68 Ga0209758_1000111 3300025297 Bacteria 208790
69 Ga0209758_1033189 3300025297 Bacteria 2079
70 Ga0209256_1010180 3300025299 Bacteria 3981
71 Ga0209256_1016777 3300025299 Bacteria 2473
72 Ga0207426_1000022 3300025302 Bacteria 547377
73 Ga0207426_1000447 3300025302 Bacteria 66140
74 Ga0209051_1013031 3300025303 Bacteria 3978
75 Ga0207695_10000120 3300025913 Bacteria 234247
76 Ga0207671_10000755 3300025914 Bacteria 41010
77 Ga0207690_10160739 3300025932 Bacteria 1674
78 Ga0207667_10316923 3300025949 Bacteria 1593
79 Ga0207712_10248673 3300025961 Bacteria 1436
80 Ga0207658_10433410 3300025986 Bacteria 1161
81 Ga0207678_10050186 3300026067 Bacteria 3605
82 Ga0207678_10054832 3300026067 Bacteria 3434
83 Ga0207702_10012348 3300026078 Bacteria 7110
84 Ga0207641_10332018 3300026088 Bacteria 1445
85 Ga0209371_1004839 3300027312 Bacteria 5646
86 Ga0268266_10018366 3300028379 Bacteria 5959
87 Ga0307515_10044862 3300028794 Bacteria 6813
88 Ga0268256_1004617 3300030500 Bacteria 5646
89 Ga0307408_100032154 3300031548 Bacteria 3658
90 Ga0307408_100046828 3300031548 Bacteria 3094
91 Ga0307405_10001259 3300031731 Bacteria 10560
92 Ga0307406_10026721 3300031901 Bacteria 3470
93 Ga0307406_10116938 3300031901 Bacteria 1846
94 Ga0307412_10000824 3300031911 Bacteria 17889
95 Ga0307416_100492811 3300032002 Bacteria 1288
96 Ga0307414_10262890 3300032004 Bacteria 1441
97 Ga0439465_0000852 3300041413 Bacteria 9628
98 Ga0439465_0000973 3300041413 Bacteria 9119
99 Ga0439465_0055740 3300041413 Bacteria 1302
100 Ga0439432_057807 3300042006 Bacteria 1200
101 Ga0439449_0040104 3300042007 Bacteria 1741
102 Ga0466970_0008072 3300044765 Bacteria 5286
103 Ga0466958_0071497 3300045836 Bacteria 2124
104 Ga0495662_0008490 3300046476 Bacteria 5053
105 Ga0495610_0000257 3300046512 Bacteria 55903
106 Ga0495620_0133730 3300046515 Bacteria 972
107 Ga0495632_0002993 3300046519 Bacteria 12351
108 Ga0495634_0173104 3300046642 Bacteria 1356
109 Ga0495625_0069197 3300046660 Bacteria 2480
110 Ga0495588_0083819 3300046674 Bacteria 1665
111 Ga0495687_043342 3300047443 Bacteria 1961
112 Ga0495673_0020591 3300047469 Bacteria 3281
113 Ga0495686_0000269 3300047472 Bacteria 92647
114 Ga0495686_0059519 3300047472 Bacteria 2377
115 Ga0496101_0050468 3300048904 Bacteria 2995
116 Ga0496101_0103154 3300048904 Bacteria 2137
117 Ga0496102_0006176 3300048905 Bacteria 10213
118 Ga0496103_0108277 3300048906 Bacteria 1763
119 Ga0496116_0009147 3300048919 Bacteria 8487
120 Ga0496116_0014970 3300048919 Bacteria 6155
121 Ga0496116_0059224 3300048919 Bacteria 2492
122 Ga0496116_0108340 3300048919 Bacteria 1640
123 Ga0496117_0000632 3300048920 Bacteria 56899
124 Ga0496117_0005247 3300048920 Bacteria 13749
125 Ga0496117_0029572 3300048920 Bacteria 4221
126 Ga0496117_0035540 3300048920 Bacteria 3738
127 Ga0496118_0004746 3300048921 Bacteria 15907
128 Ga0496118_0020151 3300048921 Bacteria 5926
129 Ga0496118_0084703 3300048921 Bacteria 2210
130 Ga0496119_0003621 3300048922 Bacteria 15896
131 Ga0496119_0006921 3300048922 Bacteria 10343
132 Ga0496119_0060694 3300048922 Bacteria 2262
133 Ga0496120_0014461 3300048923 Bacteria 5258
134 Ga0496120_0140723 3300048923 Bacteria 1225
135 Ga0496121_0014208 3300048924 Bacteria 8471
136 Ga0496121_0059799 3300048924 Bacteria 3139
137 Ga0496121_0083720 3300048924 Bacteria 2517
138 Ga0496121_0118438 3300048924 Bacteria 2004
139 Ga0496122_0000640 3300048925 Bacteria 71045
140 Ga0496122_0005622 3300048925 Bacteria 14826
141 Ga0496122_0013352 3300048925 Bacteria 8045
142 Ga0496122_0017630 3300048925 Bacteria 6661
143 Ga0496122_0068743 3300048925 Bacteria 2541
144 Ga0496122_0097359 3300048925 Bacteria 1980
145 Ga0496122_0135482 3300048925 Bacteria 1553
146 Ga0496123_0000247 3300048926 Bacteria 109186
147 Ga0496123_0038456 3300048926 Bacteria 3362
148 Ga0496123_0038732 3300048926 Bacteria 3345
149 Ga0496123_0050848 3300048926 Bacteria 2765
150 Ga0496123_0063483 3300048926 Bacteria 2359
151 Ga0496123_0105228 3300048926 Bacteria 1629
152 Ga0496123_0132730 3300048926 Bacteria 1376
153 Ga0496124_0000055 3300048927 Bacteria 251395
154 Ga0496124_0000754 3300048927 Bacteria 53087
155 Ga0496124_0006040 3300048927 Bacteria 13343
156 Ga0496124_0044240 3300048927 Bacteria 3822
157 Ga0496124_0062056 3300048927 Bacteria 3129
158 Ga0496124_0124998 3300048927 Bacteria 2050
159 Ga0496124_0203649 3300048927 Bacteria 1503
160 Ga0496125_0000246 3300048928 Bacteria 111177
161 Ga0496125_0003432 3300048928 Bacteria 19215
162 Ga0496125_0021731 3300048928 Bacteria 5973
163 Ga0496125_0077197 3300048928 Bacteria 2569
164 Ga0496125_0168786 3300048928 Bacteria 1474
165 Ga0496126_0000207 3300048929 Bacteria 131816
166 Ga0496126_0066331 3300048929 Bacteria 3227
167 Ga0496126_0089502 3300048929 Bacteria 2709
168 Ga0495678_043596 3300049459 Bacteria 1780
169 Ga0501031_0047605 3300049568 Bacteria 2795
170 Ga0501031_0073301 3300049568 Bacteria 2229
171 Ga0501031_0125646 3300049568 Bacteria 1676
172 Ga0501032_0003876 3300049569 Bacteria 11357
173 Ga0501032_0043773 3300049569 Bacteria 3031
174 Ga0501032_0050775 3300049569 Bacteria 2797
175 Ga0501032_0052458 3300049569 Bacteria 2748
176 Ga0501033_0001689 3300049570 Bacteria 19321
177 Ga0501033_0006408 3300049570 Bacteria 9216
178 Ga0501033_0029619 3300049570 Bacteria 4114
179 Ga0501033_0037752 3300049570 Bacteria 3614
180 Ga0501033_0103045 3300049570 Bacteria 2081
181 Ga0501034_0075243 3300049571 Bacteria 3384
182 Ga0501034_0115775 3300049571 Bacteria 2669
183 Ga0501034_0156207 3300049571 Bacteria 2255
184 Ga0501036_0052431 3300049572 Bacteria 3455
185 Ga0501036_0143157 3300049572 Bacteria 2017
186 Ga0501037_0000124 3300049573 Bacteria 71522
187 Ga0501037_0043228 3300049573 Bacteria 3312
188 Ga0501038_0044715 3300049574 Bacteria 3846
189 Ga0501038_0068780 3300049574 Bacteria 3010
190 Ga0501038_0080885 3300049574 Bacteria 2738
191 Ga0501038_0103928 3300049574 Bacteria 2362
192 Ga0501038_0164191 3300049574 Bacteria 1803
193 Ga0501039_0064826 3300049575 Bacteria 2833
194 Ga0501043_0000003 3300049579 Bacteria 318844
195 Ga0501043_0212597 3300049579 Bacteria 1499
196 Ga0501046_0296697 3300049580 Bacteria 1181
197 Ga0501047_0002812 3300049581 Bacteria 16523
198 Ga0501047_0016774 3300049581 Bacteria 6999
199 Ga0501047_0048052 3300049581 Bacteria 4122
200 Ga0501047_0092612 3300049581 Bacteria 2901
201 Ga0501047_0164850 3300049581 Bacteria 2087
202 Ga0501047_0257411 3300049581 Bacteria 1593
203 Ga0501048_0127224 3300049582 Bacteria 1801
204 Ga0501067_0012149 3300049583 Bacteria 4774
205 Ga0501069_0000003 3300049585 Bacteria 210301
206 Ga0501069_0081804 3300049585 Bacteria 1819
207 Ga0501070_0000477 3300049586 Bacteria 36435
208 Ga0501070_0001098 3300049586 Bacteria 24293
209 Ga0501070_0074353 3300049586 Bacteria 2813
210 Ga0501071_0039612 3300049587 Bacteria 3371
211 Ga0501071_0056618 3300049587 Bacteria 2832
212 Ga0501074_0000007 3300049590 Bacteria 111136
213 Ga0501080_0001407 3300049742 Bacteria 20159
214 Ga0501080_0071082 3300049742 Bacteria 3237
215 Ga0501080_0415905 3300049742 Bacteria 1208
216 Ga0501083_0000024 3300049744 Bacteria 123029
217 Ga0501083_0204490 3300049744 Bacteria 1288
218 Ga0501035_0000728 3300049822 Bacteria 35692
219 Ga0501035_0001537 3300049822 Bacteria 23475
220 Ga0501035_0002488 3300049822 Bacteria 18002
221 Ga0501035_0002975 3300049822 Bacteria 16299
222 Ga0501035_0005425 3300049822 Bacteria 12056
223 Ga0501035_0063270 3300049822 Bacteria 3291
224 Ga0501035_0081482 3300049822 Bacteria 2856
225 Ga0501035_0135834 3300049822 Bacteria 2141
226 Ga0501044_0000016 3300049823 Bacteria 231626
227 Ga0501044_0018453 3300049823 Bacteria 7474
228 Ga0501044_0084722 3300049823 Bacteria 3203
229 Ga0501044_0086353 3300049823 Bacteria 3169
230 Ga0501044_0090430 3300049823 Bacteria 3088
231 nmdc:mga0yw44_8379_c1 3300050492 Bacteria 2432
232 Ga0495601_0119148 3300053077 Bacteria 1713
233 Ga0500618_002523 3300053125 Bacteria 6834
234 Ga0500618_004536 3300053125 Bacteria 4401
235 Ga0500590_000016 3300053148 Bacteria 47232
236 Ga0500616_0056572 3300053153 Bacteria 2047
237 Ga0501084_0154636 3300054114 Bacteria 1934
238 Ga0501082_0019386 3300060353 Bacteria 5862

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100251114 Ga0070665_1002511142 295
2 3300028379 Ga0268266_10018366 Ga0268266_100183666 295
3 3300048925 Ga0496122_0000640 Ga0496122_0000640_26110_27033 298
4 3300048926 Ga0496123_0000247 Ga0496123_0000247_5431_6354 298
5 3300048928 Ga0496125_0000246 Ga0496125_0000246_92177_93100 298
6 iso_pu_bacteria 2582581304 2585259259 298
7 iso_pu_bacteria 2513237144 2513910539 299
8 iso_pu_bacteria 2513237146 2513927979 299
9 iso_pu_bacteria 2599185170 2599420989 299
10 iso_pu_bacteria 2838035591 2838041350 299
11 iso_pu_bacteria 2933016740 2933018699 299
12 iso_pu_bacteria 3005409236 3005409293 299
13 3300049572 Ga0501036_0052431 Ga0501036_0052431_441_1364 300
14 iso_pu_bacteria 2852387548 2852394447 300
15 iso_pu_bacteria 2551306091 2551726928 301
16 iso_pu_bacteria 2989349275 2989353696 302
17 3300003771 Ga0055526_1012933 Ga0055526_10129332 303
18 3300025273 Ga0209673_1020298 Ga0209673_10202982 303
19 iso_pu_bacteria 2643221637 2644210848 303
20 iso_pu_bacteria 2643221689 2644496872 303
21 iso_pu_bacteria 2643221718 2644654382 303
22 iso_pu_bacteria 2738541317 2738948400 303
23 iso_pu_bacteria 2791355094 2792640342 303
24 iso_pu_bacteria 2891373044 2891374239 303
25 iso_pu_bacteria 2913308742 2913313189 303
26 iso_pu_bacteria 643692032 643823691 303
27 3300048925 Ga0496122_0097359 Ga0496122_0097359_101_1069 304
28 3300049822 Ga0501035_0063270 Ga0501035_0063270_23_949 304
29 iso_pu_bacteria 2510917028 2511183090 304
30 iso_pu_bacteria 2513237088 2513596981 304
31 iso_pu_bacteria 2513237138 2513869780 304
32 iso_pu_bacteria 2516143018 2516206821 304
33 iso_pu_bacteria 2534681796 2535517351 304
34 iso_pu_bacteria 2582581294 2585204566 304
35 iso_pu_bacteria 2582581867 2585402831 304
36 iso_pu_bacteria 2585427590 2585823507 304
37 iso_pu_bacteria 2599185352 2600193603 304
38 iso_pu_bacteria 2643221599 2644003032 304
39 iso_pu_bacteria 2643221643 2644238004 304
40 iso_pu_bacteria 2657244999 2657685061 304
41 iso_pu_bacteria 2690316117 2692319066 304
42 iso_pu_bacteria 2751185821 2753461716 304
43 iso_pu_bacteria 2791355082 2792583625 304
44 iso_pu_bacteria 2791355091 2792621613 304
45 iso_pu_bacteria 2791355092 2792627700 304
46 iso_pu_bacteria 2802429268 2804754894 304
47 iso_pu_bacteria 2838661181 2838665742 304
48 iso_pu_bacteria 2847417321 2847422432 304
49 iso_pu_bacteria 2848992105 2848998160 304
50 iso_pu_bacteria 2850079185 2850085048 304
51 iso_pu_bacteria 2855872281 2855875768 304
52 iso_pu_bacteria 2913295892 2913295931 304
53 iso_pu_bacteria 2920822456 2920826181 304
54 iso_pu_bacteria 2923556063 2923562040 304
55 iso_pu_bacteria 2996887358 2996892640 304
56 iso_pu_bacteria 3005452660 3005455169 304
57 iso_pu_bacteria 8005258706 8005264733 304
58 iso_pu_bacteria 8005321885 8005327167 304
59 iso_pu_bacteria 8005542996 8005546166 304
60 iso_pu_bacteria 2509276019 2509377793 305
61 iso_pu_bacteria 2558860983 2561467848 305
62 iso_pu_bacteria 8054558443 8054562395 305
63 3300002773 JGI25152J39213_1000919 JGI25152J39213_10009197 307
64 3300003187 JGI25151J46595_10005943 JGI25151J46595_100059434 307
65 3300003771 Ga0055526_1013935 Ga0055526_10139352 307
66 3300003775 Ga0055524_1024861 Ga0055524_10248612 307
67 3300003790 Ga0055528_1018002 Ga0055528_10180022 307
68 3300003792 Ga0055540_1027095 Ga0055540_10270952 307
69 3300005347 Ga0070668_100150238 Ga0070668_1001502382 307
70 3300005355 Ga0070671_100002420 Ga0070671_1000024209 307
71 3300005844 Ga0068862_100290546 Ga0068862_1002905462 307
72 3300006038 Ga0075365_10006724 Ga0075365_100067245 307
73 3300009011 Ga0105251_10009801 Ga0105251_100098014 307
74 3300009553 Ga0105249_10223027 Ga0105249_102230272 307
75 3300013249 Ga0171463_1009 Ga0171463_1009119 307
76 3300015690 Ga0183363_1407 Ga0183363_14074 307
77 3300025273 Ga0209673_1002528 Ga0209673_10025282 307
78 3300025273 Ga0209673_1020106 Ga0209673_10201062 307
79 3300025294 Ga0209025_1000121 Ga0209025_100012116 307
80 3300025294 Ga0209025_1032257 Ga0209025_10322572 307
81 3300025295 Ga0209564_1007913 Ga0209564_10079132 307
82 3300025295 Ga0209564_1009058 Ga0209564_10090583 307
83 3300025297 Ga0209758_1033189 Ga0209758_10331892 307
84 3300025299 Ga0209256_1010180 Ga0209256_10101802 307
85 3300025299 Ga0209256_1016777 Ga0209256_10167772 307
86 3300025302 Ga0207426_1000447 Ga0207426_100044725 307
87 3300025303 Ga0209051_1013031 Ga0209051_10130312 307
88 3300025961 Ga0207712_10248673 Ga0207712_102486732 307
89 3300026088 Ga0207641_10332018 Ga0207641_103320181 307
90 3300032004 Ga0307414_10262890 Ga0307414_102628901 307
91 3300042007 Ga0439449_0040104 Ga0439449_0040104_573_1496 307
92 3300046519 Ga0495632_0002993 Ga0495632_0002993_1864_2790 307
93 3300047443 Ga0495687_043342 Ga0495687_043342_884_1810 307
94 3300048920 Ga0496117_0000632 Ga0496117_0000632_15404_16327 307
95 3300048927 Ga0496124_0000055 Ga0496124_0000055_95462_96385 307
96 3300048928 Ga0496125_0077197 Ga0496125_0077197_1397_2320 307
97 3300048929 Ga0496126_0000207 Ga0496126_0000207_8811_9734 307
98 3300049568 Ga0501031_0047605 Ga0501031_0047605_1834_2757 307
99 iso_pu_bacteria 2582581283 2585164885 307
100 iso_pu_bacteria 2582581306 2585265263 307
101 iso_pu_bacteria 2582581865 2585385603 307
102 iso_pu_bacteria 2582581866 2585391852 307
103 iso_pu_bacteria 2643221607 2644047268 307
104 iso_pu_bacteria 2643221636 2644199639 307
105 iso_pu_bacteria 2643221686 2644480057 307
106 iso_pu_bacteria 2643221688 2644495738 307
107 iso_pu_bacteria 2738541293 2738803261 307
108 iso_pu_bacteria 8005658619 8005662565 307
109 3300021320 Ga0214544_1000419 Ga0214544_100041913 308
110 3300021321 Ga0214542_1000027 Ga0214542_1000027123 308
111 3300021327 Ga0214543_1000047 Ga0214543_100004797 308
112 3300041413 Ga0439465_0000973 Ga0439465_0000973_5345_6271 308
113 3300041413 Ga0439465_0055740 Ga0439465_0055740_35_964 308
114 3300042006 Ga0439432_057807 Ga0439432_057807_174_1100 308
115 3300048924 Ga0496121_0059799 Ga0496121_0059799_1081_2007 308
116 3300048925 Ga0496122_0135482 Ga0496122_0135482_509_1435 308
117 3300048926 Ga0496123_0063483 Ga0496123_0063483_1281_2207 308
118 3300048926 Ga0496123_0132730 Ga0496123_0132730_342_1268 308
119 3300048927 Ga0496124_0203649 Ga0496124_0203649_24_950 308
120 3300048929 Ga0496126_0089502 Ga0496126_0089502_940_1866 308
121 3300049569 Ga0501032_0052458 Ga0501032_0052458_1448_2377 308
122 3300049571 Ga0501034_0075243 Ga0501034_0075243_1851_2780 308
123 3300049571 Ga0501034_0115775 Ga0501034_0115775_130_1071 308
124 3300049574 Ga0501038_0044715 Ga0501038_0044715_157_1086 308
125 3300049581 Ga0501047_0164850 Ga0501047_0164850_165_1106 308
126 3300049582 Ga0501048_0127224 Ga0501048_0127224_26_955 308
127 iso_pu_bacteria 2582581308 2585278406 308
128 iso_pu_bacteria 2582581315 2585324750 308
129 iso_pu_bacteria 2582581316 2585332183 308
130 iso_pu_bacteria 2585427527 2585531938 308
131 iso_pu_bacteria 2585427530 2585552297 308
132 iso_pu_bacteria 2615840626 2616307924 308
133 iso_pu_bacteria 2667528174 2671112919 308
134 iso_pu_bacteria 2818991453 2819640181 308
135 iso_pu_bacteria 2838029111 2838033761 308
136 iso_pu_bacteria 2842475841 2842480508 308
137 iso_pu_bacteria 2842482326 2842484081 308
138 iso_pu_bacteria 2842502639 2842507211 308
139 iso_pu_bacteria 2919408235 2919412707 308
140 3300021327 Ga0214543_1000023 Ga0214543_1000023170 309
141 3300049575 Ga0501039_0064826 Ga0501039_0064826_1709_2638 309
142 iso_pu_bacteria 2510917022 2511132947 309
143 iso_pu_bacteria 2524023209 2524457065 309
144 iso_pu_bacteria 2582581307 2585272338 309
145 iso_pu_bacteria 2585427531 2585561598 309
146 iso_pu_bacteria 2585427608 2585899450 309
147 iso_pu_bacteria 2585427609 2585906826 309
148 iso_pu_bacteria 2585428125 2587982247 309
149 iso_pu_bacteria 2842298080 2842299382 309
150 iso_pu_bacteria 2842357229 2842362512 309
151 iso_pu_bacteria 2842509118 2842512282 309
152 iso_pu_bacteria 2920760137 2920766481 309
153 iso_pu_bacteria 2989771324 2989773006 309
154 iso_pu_bacteria 8024486573 8024488928 309
155 3300002773 JGI25152J39213_1000947 JGI25152J39213_10009478 310
156 3300002774 JGI25150J39212_1000024 JGI25150J39212_100002474 310
157 3300003187 JGI25151J46595_10000027 JGI25151J46595_10000027139 310
158 3300003215 JGI25153J46596_10008091 JGI25153J46596_100080912 310
159 3300006038 Ga0075365_10017420 Ga0075365_100174202 310
160 3300006038 Ga0075365_10053819 Ga0075365_100538193 310
161 3300025245 Ga0207425_1000043 Ga0207425_1000043137 310
162 3300025258 Ga0209129_1000072 Ga0209129_100007257 310
163 3300025273 Ga0209673_1004738 Ga0209673_10047385 310
164 3300025294 Ga0209025_1000120 Ga0209025_100012057 310
165 3300025297 Ga0209758_1000111 Ga0209758_100011157 310
166 3300026067 Ga0207678_10054832 Ga0207678_100548322 310
167 3300028794 Ga0307515_10044862 Ga0307515_100448623 310
168 3300031548 Ga0307408_100032154 Ga0307408_1000321543 310
169 3300031731 Ga0307405_10001259 Ga0307405_100012596 310
170 3300031901 Ga0307406_10026721 Ga0307406_100267212 310
171 3300031901 Ga0307406_10116938 Ga0307406_101169382 310
172 3300031911 Ga0307412_10000824 Ga0307412_100008244 310
173 3300041413 Ga0439465_0000852 Ga0439465_0000852_95_1030 310
174 3300046512 Ga0495610_0000257 Ga0495610_0000257_36388_37329 310
175 3300046515 Ga0495620_0133730 Ga0495620_0133730_17_958 310
176 3300046660 Ga0495625_0069197 Ga0495625_0069197_209_1144 310
177 3300047469 Ga0495673_0020591 Ga0495673_0020591_878_1819 310
178 3300047472 Ga0495686_0000269 Ga0495686_0000269_68819_69763 310
179 3300048904 Ga0496101_0050468 Ga0496101_0050468_1318_2253 310
180 3300048919 Ga0496116_0009147 Ga0496116_0009147_6715_7650 310
181 3300048919 Ga0496116_0014970 Ga0496116_0014970_4875_5831 310
182 3300048919 Ga0496116_0108340 Ga0496116_0108340_51_1007 310
183 3300048920 Ga0496117_0029572 Ga0496117_0029572_2278_3213 310
184 3300048920 Ga0496117_0035540 Ga0496117_0035540_2321_3277 310
185 3300048921 Ga0496118_0020151 Ga0496118_0020151_3266_4201 310
186 3300048921 Ga0496118_0084703 Ga0496118_0084703_223_1179 310
187 3300048924 Ga0496121_0014208 Ga0496121_0014208_6716_7672 310
188 3300048924 Ga0496121_0118438 Ga0496121_0118438_948_1904 310
189 3300048925 Ga0496122_0017630 Ga0496122_0017630_3385_4341 310
190 3300048925 Ga0496122_0068743 Ga0496122_0068743_669_1604 310
191 3300048926 Ga0496123_0038456 Ga0496123_0038456_61_1017 310
192 3300048926 Ga0496123_0050848 Ga0496123_0050848_1010_1966 310
193 3300048926 Ga0496123_0105228 Ga0496123_0105228_166_1101 310
194 3300048927 Ga0496124_0000754 Ga0496124_0000754_9888_10823 310
195 3300048927 Ga0496124_0062056 Ga0496124_0062056_1137_2093 310
196 3300048927 Ga0496124_0124998 Ga0496124_0124998_999_1955 310
197 3300048928 Ga0496125_0021731 Ga0496125_0021731_1666_2622 310
198 3300048928 Ga0496125_0168786 Ga0496125_0168786_474_1409 310
199 3300049459 Ga0495678_043596 Ga0495678_043596_249_1190 310
200 3300049568 Ga0501031_0125646 Ga0501031_0125646_645_1601 310
201 3300049569 Ga0501032_0050775 Ga0501032_0050775_1301_2257 310
202 3300049570 Ga0501033_0103045 Ga0501033_0103045_872_1828 310
203 3300049571 Ga0501034_0156207 Ga0501034_0156207_990_1946 310
204 3300049574 Ga0501038_0103928 Ga0501038_0103928_878_1834 310
205 3300049580 Ga0501046_0296697 Ga0501046_0296697_122_1078 310
206 3300049586 Ga0501070_0074353 Ga0501070_0074353_1382_2338 310
207 3300049744 Ga0501083_0204490 Ga0501083_0204490_92_1048 310
208 3300049822 Ga0501035_0135834 Ga0501035_0135834_12_968 310
209 3300049823 Ga0501044_0090430 Ga0501044_0090430_69_1025 310
210 3300050492 nmdc:mga0yw44_8379_c1 nmdc:mga0yw44_8379_c1_258_1208 310
211 3300053125 Ga0500618_002523 Ga0500618_002523_3042_3986 310
212 iso_pu_bacteria 2513237138 2513871556 310
213 iso_pu_bacteria 2513237159 2513996816 310
214 iso_pu_bacteria 2585427594 2585847530 310
215 iso_pu_bacteria 2842521101 2842521746 310
216 iso_pu_bacteria 2899803654 2899808437 310
217 iso_pu_bacteria 2996310559 2996312853 310
218 iso_pu_bacteria 3003930520 3003935358 310
219 3300049568 Ga0501031_0073301 Ga0501031_0073301_414_1373 311
220 3300049569 Ga0501032_0003876 Ga0501032_0003876_1138_2154 311
221 3300049570 Ga0501033_0001689 Ga0501033_0001689_5197_6213 311
222 3300049572 Ga0501036_0143157 Ga0501036_0143157_723_1682 311
223 3300049573 Ga0501037_0000124 Ga0501037_0000124_22355_23371 311
224 3300049574 Ga0501038_0068780 Ga0501038_0068780_349_1365 311
225 3300049579 Ga0501043_0000003 Ga0501043_0000003_74678_75694 311
226 3300049581 Ga0501047_0092612 Ga0501047_0092612_906_1922 311
227 3300049583 Ga0501067_0012149 Ga0501067_0012149_1051_2067 311
228 3300049585 Ga0501069_0000003 Ga0501069_0000003_90253_91269 311
229 3300049586 Ga0501070_0000477 Ga0501070_0000477_32229_33245 311
230 3300049587 Ga0501071_0056618 Ga0501071_0056618_666_1682 311
231 3300049590 Ga0501074_0000007 Ga0501074_0000007_31177_32193 311
232 3300049742 Ga0501080_0001407 Ga0501080_0001407_17850_18866 311
233 3300049744 Ga0501083_0000024 Ga0501083_0000024_38209_39225 311
234 3300049822 Ga0501035_0001537 Ga0501035_0001537_7180_8196 311
235 3300049823 Ga0501044_0000016 Ga0501044_0000016_90245_91261 311
236 3300060353 Ga0501082_0019386 Ga0501082_0019386_3478_4494 311
237 3300002704 JGI25155J39150_1000020 JGI25155J39150_100002095 312
238 3300002705 JGI25156J39149_1000021 JGI25156J39149_100002155 312
239 3300002737 JGI25162J39368_1000648 JGI25162J39368_100064815 312
240 3300002738 JGI25154J39366_1000039 JGI25154J39366_100003995 312
241 3300002741 JGI25157J39369_1000019 JGI25157J39369_100001955 312
242 3300003214 JGI25165J46597_1000018 JGI25165J46597_1000018306 312
243 3300003322 rootL2_10070040 rootL2_100700403 312
244 3300003354 JGI25160J50197_1000014 JGI25160J50197_100001483 312
245 3300003374 JGI25161J50226_1000061 JGI25161J50226_100006183 312
246 3300004625 Ga0055543_1000005 Ga0055543_1000005150 312
247 3300005262 Ga0065165_1000126 Ga0065165_100012662 312
248 3300005455 Ga0070663_100057618 Ga0070663_1000576181 312
249 3300005563 Ga0068855_100246519 Ga0068855_1002465192 312
250 3300005614 Ga0068856_100011897 Ga0068856_1000118974 312
251 3300006353 Ga0075370_10021559 Ga0075370_100215593 312
252 3300009093 Ga0105240_10000012 Ga0105240_1000001288 312
253 3300009545 Ga0105237_10001333 Ga0105237_1000133311 312
254 3300013104 Ga0157370_10000571 Ga0157370_100005714 312
255 3300015262 Ga0182007_10002748 Ga0182007_100027483 312
256 3300015265 Ga0182005_1000879 Ga0182005_100087913 312
257 3300025206 Ga0209435_100025 Ga0209435_100025116 312
258 3300025233 Ga0209437_100022 Ga0209437_100022367 312
259 3300025246 Ga0209646_1000083 Ga0209646_1000083116 312
260 3300025246 Ga0209646_1003245 Ga0209646_10032453 312
261 3300025250 Ga0209026_1000078 Ga0209026_1000078116 312
262 3300025253 Ga0209677_101967 Ga0209677_1019677 312
263 3300025256 Ga0209759_1000060 Ga0209759_1000060116 312
264 3300025261 Ga0209233_1000031 Ga0209233_1000031367 312
265 3300025261 Ga0209233_1000146 Ga0209233_1000146124 312
266 3300025284 Ga0209130_1000013 Ga0209130_1000013234 312
267 3300025302 Ga0207426_1000022 Ga0207426_1000022147 312
268 3300025913 Ga0207695_10000120 Ga0207695_10000120126 312
269 3300025914 Ga0207671_10000755 Ga0207671_1000075511 312
270 3300025932 Ga0207690_10160739 Ga0207690_101607392 312
271 3300025949 Ga0207667_10316923 Ga0207667_103169232 312
272 3300025986 Ga0207658_10433410 Ga0207658_104334102 312
273 3300026067 Ga0207678_10050186 Ga0207678_100501862 312
274 3300026078 Ga0207702_10012348 Ga0207702_100123484 312
275 3300027312 Ga0209371_1004839 Ga0209371_10048392 312
276 3300030500 Ga0268256_1004617 Ga0268256_10046175 312
277 3300031548 Ga0307408_100046828 Ga0307408_1000468283 312
278 3300032002 Ga0307416_100492811 Ga0307416_1004928112 312
279 3300044765 Ga0466970_0008072 Ga0466970_0008072_4079_5017 312
280 3300045836 Ga0466958_0071497 Ga0466958_0071497_971_1909 312
281 3300046476 Ga0495662_0008490 Ga0495662_0008490_1695_2636 312
282 3300046642 Ga0495634_0173104 Ga0495634_0173104_154_1095 312
283 3300046674 Ga0495588_0083819 Ga0495588_0083819_562_1503 312
284 3300047472 Ga0495686_0059519 Ga0495686_0059519_1314_2321 312
285 3300048904 Ga0496101_0103154 Ga0496101_0103154_298_1236 312
286 3300048905 Ga0496102_0006176 Ga0496102_0006176_8594_9532 312
287 3300048906 Ga0496103_0108277 Ga0496103_0108277_115_1053 312
288 3300048919 Ga0496116_0059224 Ga0496116_0059224_1493_2431 312
289 3300048920 Ga0496117_0005247 Ga0496117_0005247_7632_8570 312
290 3300048921 Ga0496118_0004746 Ga0496118_0004746_9790_10728 312
291 3300048922 Ga0496119_0003621 Ga0496119_0003621_12502_13440 312
292 3300048922 Ga0496119_0006921 Ga0496119_0006921_6869_7807 312
293 3300048922 Ga0496119_0060694 Ga0496119_0060694_300_1241 312
294 3300048923 Ga0496120_0014461 Ga0496120_0014461_1784_2722 312
295 3300048923 Ga0496120_0140723 Ga0496120_0140723_147_1085 312
296 3300048924 Ga0496121_0083720 Ga0496121_0083720_480_1421 312
297 3300048925 Ga0496122_0005622 Ga0496122_0005622_6251_7189 312
298 3300048925 Ga0496122_0013352 Ga0496122_0013352_3887_4825 312
299 3300048926 Ga0496123_0038732 Ga0496123_0038732_1734_2672 312
300 3300048927 Ga0496124_0006040 Ga0496124_0006040_3741_4679 312
301 3300048927 Ga0496124_0044240 Ga0496124_0044240_1676_2614 312
302 3300048928 Ga0496125_0003432 Ga0496125_0003432_14048_14986 312
303 3300048929 Ga0496126_0066331 Ga0496126_0066331_183_1121 312
304 3300049569 Ga0501032_0043773 Ga0501032_0043773_97_1059 312
305 3300049570 Ga0501033_0006408 Ga0501033_0006408_1353_2315 312
306 3300049570 Ga0501033_0029619 Ga0501033_0029619_2081_3043 312
307 3300049570 Ga0501033_0037752 Ga0501033_0037752_2260_3222 312
308 3300049573 Ga0501037_0043228 Ga0501037_0043228_1221_2183 312
309 3300049574 Ga0501038_0080885 Ga0501038_0080885_1129_2091 312
310 3300049574 Ga0501038_0164191 Ga0501038_0164191_70_1032 312
311 3300049579 Ga0501043_0212597 Ga0501043_0212597_59_1021 312
312 3300049581 Ga0501047_0002812 Ga0501047_0002812_15217_16179 312
313 3300049581 Ga0501047_0016774 Ga0501047_0016774_1886_2848 312
314 3300049581 Ga0501047_0048052 Ga0501047_0048052_1839_2801 312
315 3300049581 Ga0501047_0257411 Ga0501047_0257411_343_1305 312
316 3300049585 Ga0501069_0081804 Ga0501069_0081804_808_1770 312
317 3300049586 Ga0501070_0001098 Ga0501070_0001098_8530_9492 312
318 3300049587 Ga0501071_0039612 Ga0501071_0039612_487_1449 312
319 3300049742 Ga0501080_0071082 Ga0501080_0071082_1640_2602 312
320 3300049742 Ga0501080_0415905 Ga0501080_0415905_198_1160 312
321 3300049822 Ga0501035_0000728 Ga0501035_0000728_11689_12651 312
322 3300049822 Ga0501035_0002488 Ga0501035_0002488_2312_3274 312
323 3300049822 Ga0501035_0002975 Ga0501035_0002975_13482_14444 312
324 3300049822 Ga0501035_0005425 Ga0501035_0005425_8610_9572 312
325 3300049822 Ga0501035_0081482 Ga0501035_0081482_1568_2530 312
326 3300049823 Ga0501044_0018453 Ga0501044_0018453_1915_2877 312
327 3300049823 Ga0501044_0084722 Ga0501044_0084722_1580_2542 312
328 3300049823 Ga0501044_0086353 Ga0501044_0086353_1768_2730 312
329 3300053077 Ga0495601_0119148 Ga0495601_0119148_255_1196 312
330 3300053125 Ga0500618_004536 Ga0500618_004536_514_1455 312
331 3300053148 Ga0500590_000016 Ga0500590_000016_18170_19111 312
332 3300053153 Ga0500616_0056572 Ga0500616_0056572_971_1933 312
333 3300054114 Ga0501084_0154636 Ga0501084_0154636_912_1874 312
334 iso_pu_bacteria 2757320392 2757570627 312

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

35

201

0.92

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

32

258

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.8154 8 216
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.8075 8 216
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7894 8 217
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7818 8 217
2z87-assembly3.cif.gz_B crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-galnac and udp 0.7746 11 219
ID Description Score Start End Superfamily
af_A0A2R8QCE8_89_340_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8259 8 120 3.90.550.10
af_P9WMX1_74_289_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.818 11 217 3.90.550.10
af_Q8CE94_12_391_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8104 216 295 1.20.1250.20
af_P75905_64_287_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8067 8 217 3.90.550.10
af_A0A1D6HKA0_92_329_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7885 9 217 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A529LPJ1-F1-model_v4 Glycosyltransferase family 2 protein 0.982 6 99 GO:0016740
AF-A0A3G8LYS5-F1-model_v4 Glycosyltransferase family 2 protein 0.9716 9 304 GO:0016020
GO:0016757
AF-A0A317FYG1-F1-model_v4 Glycosyl transferase family A 0.9712 9 304 GO:0016740
AF-A0A1M4MYX7-F1-model_v4 Succinoglycan biosynthesis protein ExoM (EC 2.4.-.-) 0.9692 9 306 GO:0016757
AF-A0A3G8LYS5-F1-model_v4 Glycosyltransferase family 2 protein 0.9684 9 304 GO:0016020
GO:0016757

Feature Viewer

pLDDT pTM Quality
90.07 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map