F412043

General Info

Members Datasets Scaffolds Average Seq Length
334 171 668 272

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8057798959|8057805174
Length 297
Sequence RRHLAGNRWGCTHYLSSSLNFMNTISVTPIEGREAWQVPAMETLLWQGRQHPWCVVIPVINEGQRIKDLLKKMQSQKISEIADIIIVDGGSKDGSLELEALKQVGVSSLIEKKGPGKLSAQLRCAYAFALEQGYEGIVTIDGNNKDDPEAIPRFISALKDGVDFVQASRFISGGIAENTPKSRDFAIRFIHAPCLSLASGFKWTDTTQGFRAYSRKMLLDPKISIFRDIFSKYELLAYLSYRVPKLGYKCVELPAIRKYPIDEVPTKITAFRGNLDVLKTLFSSCLKKYNPEEKQLK

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
3 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
10 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
11 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
12 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
13 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
14 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
15 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
16 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
17 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
18 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
19 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
22 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
23 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
24 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
25 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
26 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
27 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
29 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
35 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
36 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
37 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
38 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
39 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
40 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
41 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
42 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
43 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
44 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
45 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
46 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
47 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
48 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
49 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
50 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
51 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
52 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
53 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
54 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
55 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
56 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
57 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
58 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
59 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
60 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
61 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
62 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
63 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
64 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
65 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
66 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
67 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
68 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
69 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
70 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
71 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
72 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
73 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
74 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
75 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
76 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
77 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
78 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
79 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
80 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
81 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
82 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
83 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
84 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
87 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
90 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
91 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
92 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
93 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
96 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
97 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
98 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
101 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
102 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
103 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
104 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
105 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
106 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
107 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
108 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
111 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
114 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
115 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
116 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
117 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
118 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
122 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
123 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
124 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
138 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
139 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
140 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
141 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
142 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
143 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere
144 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
145 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
146 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
147 2511231020 Pseudomonas sp. GM74 Isolate Nodule
148 2511231022 Pseudomonas sp. GM79 Isolate Nodule
149 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
150 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
151 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
152 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
153 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
154 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
155 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
156 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
157 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
158 2643221638 Duganella sp. Root336D2 Isolate Unclassified
159 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
160 2784132063 Pseudomonas sp. 424 Isolate Unclassified
161 2816332133 Acidovorax radicis 2721A Isolate Unclassified
162 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
163 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
164 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
165 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
166 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
167 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
168 639633007 Azoarcus olearius BH72 Isolate Unclassified
169 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
170 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
171 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.02
Metatranscriptomes 0.3
Isolates 8.68

Biome Distribution

Category Percentage (%)
Aerial Root 0.6
Bulb 0
Endosphere 7.49
Nodule 0.9
Rhizoplane 2.99
Rhizosphere 75.45
Stem 0
Stem Tuber 0
Unclassified 1.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10275864 3300003322 Bacteria 1989
2 Ga0055533_1000124 3300003756 Bacteria 87900
3 Ga0055525_1002684 3300003759 Bacteria 1731
4 Ga0055526_1002209 3300003771 Bacteria 13339
5 Ga0055537_1001860 3300003773 Bacteria 7614
6 Ga0055528_1012818 3300003790 Bacteria 3226
7 Ga0055530_10000283 3300003791 Bacteria 46150
8 Ga0070705_100068328 3300005440 Bacteria 2138
9 Ga0070686_100118088 3300005544 Bacteria 1817
10 Ga0105251_10004073 3300009011 Bacteria 10255
11 Ga0105251_10007045 3300009011 Bacteria 7012
12 Ga0105244_10029797 3300009036 Bacteria 2910
13 Ga0105250_10003450 3300009092 Bacteria 7488
14 Ga0105250_10034637 3300009092 Bacteria 2026
15 Ga0157373_10000759 3300013100 Bacteria 25031
16 Ga0157370_10002586 3300013104 Bacteria 21745
17 Ga0157369_10004895 3300013105 Bacteria 15706
18 Ga0157369_10216302 3300013105 Bacteria 2007
19 Ga0182008_10001249 3300014497 Bacteria 17458
20 Ga0182006_1000707 3300015261 Bacteria 23141
21 Ga0182005_1000014 3300015265 Bacteria 389763
22 Ga0182005_1000319 3300015265 Bacteria 28646
23 Ga0182005_1000325 3300015265 Bacteria 28280
24 Ga0182005_1000529 3300015265 Bacteria 19383
25 Ga0209566_110707 3300025225 Bacteria 918
26 Ga0209674_100005 3300025226 Bacteria 1708125
27 Ga0209563_100360 3300025230 Bacteria 16852
28 Ga0207427_100394 3300025231 Bacteria 25938
29 Ga0209233_1000016 3300025261 Bacteria 907830
30 Ga0209565_1000348 3300025263 Bacteria 40662
31 Ga0209565_1000439 3300025263 Bacteria 33341
32 Ga0209565_1001005 3300025263 Bacteria 14486
33 Ga0209673_1002992 3300025273 Bacteria 10520
34 Ga0209564_1001062 3300025295 Bacteria 33341
35 Ga0209050_1000271 3300025298 Bacteria 110802
36 Ga0209050_1000904 3300025298 Bacteria 39210
37 Ga0209256_1005349 3300025299 Bacteria 7437
38 Ga0209256_1037648 3300025299 Bacteria 1259
39 Ga0209051_1048449 3300025303 Bacteria 1441
40 Ga0207696_1005870 3300025711 Bacteria 5036
41 Ga0207655_1001579 3300025728 Bacteria 20452
42 Ga0207655_1006962 3300025728 Bacteria 7413
43 Ga0207655_1021551 3300025728 Bacteria 3266
44 Ga0207655_1053072 3300025728 Bacteria 1624
45 Ga0207713_1000001 3300025735 Bacteria 2295391
46 Ga0207713_1000073 3300025735 Bacteria 181519
47 Ga0207713_1000614 3300025735 Bacteria 35058
48 Ga0207713_1002635 3300025735 Bacteria 12899
49 Ga0209371_1002174 3300027312 Bacteria 11470
50 Ga0209371_1021180 3300027312 Bacteria 1582
51 Ga0307515_10089332 3300028794 Bacteria 3881
52 Ga0268256_1001911 3300030500 Bacteria 11470
53 Ga0268256_1025984 3300030500 Bacteria 1479
54 Ga0265325_10152689 3300031241 Unclassified 1091
55 Ga0307408_100002453 3300031548 Bacteria 13008
56 Ga0307412_10008850 3300031911 Bacteria 5764
57 Ga0307411_10010999 3300032005 Bacteria 4857
58 Ga0307411_10376706 3300032005 Bacteria 1166
59 Ga0439438_017264 3300041405 Bacteria 2081
60 Ga0439432_000099 3300042006 Bacteria 27419
61 Ga0450911_000103 3300042115 Bacteria 34739
62 Ga0451577_0000278 3300042876 Bacteria 99268
63 Ga0453684_0000273 3300044712 Bacteria 222658
64 Ga0453684_0000901 3300044712 Bacteria 99151
65 Ga0495617_000086 3300046452 Bacteria 67731
66 Ga0495617_017982 3300046452 Bacteria 2390
67 Ga0495627_004515 3300046453 Bacteria 5804
68 Ga0495603_0000188 3300046455 Bacteria 32204
69 Ga0495603_0000224 3300046455 Bacteria 29469
70 Ga0495590_0021055 3300046457 Bacteria 2314
71 Ga0495591_002361 3300046458 Bacteria 10614
72 Ga0495591_006365 3300046458 Bacteria 5235
73 Ga0495629_0009792 3300046459 Bacteria 6994
74 Ga0495629_0036244 3300046459 Bacteria 3483
75 Ga0495638_0000868 3300046460 Bacteria 31437
76 Ga0495651_0015145 3300046462 Bacteria 5959
77 Ga0495653_0007878 3300046463 Bacteria 8720
78 Ga0495653_0030966 3300046463 Bacteria 4255
79 Ga0495650_0000015 3300046471 Bacteria 557595
80 Ga0495650_0007680 3300046471 Bacteria 6429
81 Ga0495650_0007927 3300046471 Bacteria 6294
82 Ga0495580_0003355 3300046472 Bacteria 13684
83 Ga0495580_0006844 3300046472 Bacteria 9229
84 Ga0495580_0038922 3300046472 Bacteria 3403
85 Ga0495582_0026758 3300046473 Bacteria 3162
86 Ga0495582_0100230 3300046473 Bacteria 1621
87 Ga0495605_0000484 3300046474 Bacteria 34548
88 Ga0495605_0001027 3300046474 Bacteria 18778
89 Ga0495605_0053306 3300046474 Bacteria 1962
90 Ga0495605_0106166 3300046474 Bacteria 1286
91 Ga0495605_0139575 3300046474 Unclassified 1088
92 Ga0495662_0154061 3300046476 Bacteria 1132
93 Ga0495662_0196623 3300046476 Bacteria 994
94 Ga0495664_0018759 3300046477 Bacteria 3969
95 Ga0495584_0007196 3300046491 Bacteria 5811
96 Ga0495585_0000671 3300046492 Bacteria 31409
97 Ga0495585_0000992 3300046492 Bacteria 23785
98 Ga0495585_0001976 3300046492 Bacteria 15273
99 Ga0495585_0004263 3300046492 Bacteria 9314
100 Ga0495594_0046349 3300046499 Bacteria 2387
101 Ga0495596_0000283 3300046500 Bacteria 33843
102 Ga0495596_0000781 3300046500 Bacteria 19375
103 Ga0495596_0002336 3300046500 Bacteria 10283
104 Ga0495607_0000882 3300046501 Bacteria 27974
105 Ga0495607_0023687 3300046501 Bacteria 3839
106 Ga0495607_0181751 3300046501 Bacteria 1054
107 Ga0495583_0000867 3300046506 Bacteria 36740
108 Ga0495583_0001402 3300046506 Bacteria 24561
109 Ga0495583_0002001 3300046506 Bacteria 18656
110 Ga0495583_0106614 3300046506 Bacteria 1191
111 Ga0495606_0000722 3300046507 Bacteria 51115
112 Ga0495606_0002756 3300046507 Bacteria 19703
113 Ga0495610_0022145 3300046512 Bacteria 3480
114 Ga0495616_0022570 3300046513 Bacteria 3398
115 Ga0495616_0040686 3300046513 Bacteria 2373
116 Ga0495618_0004644 3300046514 Bacteria 8411
117 Ga0495618_0046130 3300046514 Bacteria 2750
118 Ga0495620_0000025 3300046515 Bacteria 125369
119 Ga0495620_0052334 3300046515 Bacteria 1734
120 Ga0495628_0002727 3300046516 Bacteria 15792
121 Ga0495628_0016797 3300046516 Bacteria 6097
122 Ga0495628_0203140 3300046516 Bacteria 1492
123 Ga0495630_0005244 3300046517 Bacteria 9138
124 Ga0495631_0000299 3300046518 Bacteria 34689
125 Ga0495631_0001870 3300046518 Bacteria 12427
126 Ga0495631_0003654 3300046518 Bacteria 8399
127 Ga0495631_0013984 3300046518 Bacteria 3881
128 Ga0495632_0003475 3300046519 Bacteria 11144
129 Ga0495632_0013362 3300046519 Bacteria 4688
130 Ga0495637_0000064 3300046520 Bacteria 92793
131 Ga0495637_0003599 3300046520 Bacteria 8206
132 Ga0495643_0000897 3300046522 Bacteria 31700
133 Ga0495643_0078204 3300046522 Bacteria 1727
134 Ga0495643_0083044 3300046522 Bacteria 1663
135 Ga0495644_0004951 3300046523 Bacteria 5227
136 Ga0495644_0039028 3300046523 Bacteria 1790
137 Ga0495648_0028142 3300046524 Bacteria 3747
138 Ga0495648_0035042 3300046524 Bacteria 3257
139 Ga0495666_0000650 3300046526 Bacteria 15630
140 Ga0495666_0010571 3300046526 Bacteria 4599
141 Ga0495666_0019879 3300046526 Bacteria 3331
142 Ga0495666_0127234 3300046526 Bacteria 1191
143 Ga0495652_0002143 3300046529 Bacteria 20798
144 Ga0495652_0019319 3300046529 Bacteria 6071
145 Ga0495654_0000487 3300046530 Bacteria 32718
146 Ga0495654_0001495 3300046530 Bacteria 15987
147 Ga0495654_0015556 3300046530 Bacteria 4037
148 Ga0495665_0001588 3300046531 Bacteria 12155
149 Ga0495665_0013629 3300046531 Bacteria 4394
150 Ga0495640_0030164 3300046533 Bacteria 3885
151 Ga0495586_0000504 3300046535 Bacteria 23022
152 Ga0495587_0000318 3300046536 Bacteria 34260
153 Ga0495609_0000073 3300046538 Bacteria 124227
154 Ga0495609_0000161 3300046538 Bacteria 69842
155 Ga0495609_0000262 3300046538 Bacteria 49441
156 Ga0495609_0005620 3300046538 Bacteria 6538
157 Ga0495597_0000305 3300046542 Bacteria 44060
158 Ga0495645_0022372 3300046543 Bacteria 4573
159 Ga0495622_0052398 3300046557 Bacteria 1893
160 Ga0495633_0000078 3300046558 Bacteria 128668
161 Ga0495633_0001202 3300046558 Bacteria 20822
162 Ga0495634_0028798 3300046642 Bacteria 3851
163 Ga0495611_0000395 3300046648 Bacteria 27443
164 Ga0495611_0029437 3300046648 Bacteria 2408
165 Ga0495625_0000194 3300046660 Bacteria 96964
166 Ga0495635_0000131 3300046663 Bacteria 45264
167 Ga0495635_0001553 3300046663 Bacteria 15411
168 Ga0495635_0077563 3300046663 Bacteria 2276
169 Ga0495661_0000087 3300046665 Bacteria 112658
170 Ga0495661_0000233 3300046665 Bacteria 64169
171 Ga0495661_0002189 3300046665 Bacteria 15270
172 Ga0495661_0002251 3300046665 Bacteria 14952
173 Ga0495661_0032908 3300046665 Bacteria 3274
174 Ga0495599_0023308 3300046678 Bacteria 3869
175 Ga0495599_0162617 3300046678 Bacteria 1379
176 Ga0495623_0001154 3300046679 Bacteria 17868
177 Ga0495623_0024707 3300046679 Bacteria 3869
178 Ga0495623_0200001 3300046679 Bacteria 1149
179 Ga0495646_0000526 3300046680 Bacteria 20513
180 Ga0495646_0002594 3300046680 Bacteria 11134
181 Ga0495646_0019612 3300046680 Bacteria 4277
182 Ga0495613_0003463 3300046689 Bacteria 11802
183 Ga0495613_0117480 3300046689 Bacteria 1912
184 Ga0495613_0203457 3300046689 Bacteria 1395
185 Ga0495624_0002978 3300046690 Bacteria 12664
186 Ga0495624_0004754 3300046690 Bacteria 9880
187 Ga0495624_0053544 3300046690 Bacteria 2547
188 Ga0495670_0000159 3300046691 Bacteria 29368
189 Ga0495670_0092863 3300046691 Unclassified 1546
190 Ga0495671_0001364 3300046692 Bacteria 16559
191 Ga0495671_0052792 3300046692 Bacteria 2019
192 Ga0495671_0079371 3300046692 Bacteria 1608
193 Ga0495671_0104552 3300046692 Bacteria 1383
194 Ga0495649_0006060 3300046694 Bacteria 7560
195 Ga0495649_0099044 3300046694 Bacteria 1550
196 Ga0495589_0000525 3300046794 Bacteria 26868
197 Ga0495589_0000809 3300046794 Bacteria 19813
198 Ga0495589_0034056 3300046794 Bacteria 2557
199 Ga0495600_0053002 3300046809 Bacteria 2649
200 Ga0495600_0054414 3300046809 Bacteria 2614
201 Ga0495600_0097465 3300046809 Bacteria 1917
202 Ga0495660_0027232 3300046810 Bacteria 3234
203 Ga0495660_0027233 3300046810 Bacteria 3234
204 Ga0495660_0036272 3300046810 Bacteria 2750
205 Ga0495660_0077652 3300046810 Unclassified 1747
206 Ga0495660_0086778 3300046810 Bacteria 1633
207 Ga0495581_0057555 3300047315 Bacteria 2243
208 Ga0495604_0000827 3300047317 Bacteria 25855
209 Ga0495604_0046214 3300047317 Bacteria 3395
210 Ga0495604_0065969 3300047317 Bacteria 2754
211 Ga0495674_0004354 3300047319 Bacteria 13608
212 Ga0495674_0013121 3300047319 Bacteria 7792
213 Ga0495674_0098156 3300047319 Bacteria 2494
214 Ga0495674_0402003 3300047319 Bacteria 1105
215 Ga0495672_0047521 3300047320 Bacteria 2551
216 Ga0495672_0052509 3300047320 Bacteria 2394
217 Ga0495676_0000052 3300047321 Bacteria 97049
218 Ga0495676_0041812 3300047321 Bacteria 3769
219 Ga0495676_0079878 3300047321 Bacteria 2485
220 Ga0495676_0111653 3300047321 Bacteria 2004
221 Ga0495680_0000664 3300047322 Bacteria 38534
222 Ga0495680_0003077 3300047322 Bacteria 16613
223 Ga0495680_0005574 3300047322 Bacteria 11816
224 Ga0495680_0017875 3300047322 Bacteria 6035
225 Ga0495683_0000619 3300047323 Bacteria 26557
226 Ga0495683_0000991 3300047323 Bacteria 19870
227 Ga0495683_0001295 3300047323 Bacteria 16901
228 Ga0495683_0001332 3300047323 Bacteria 16524
229 Ga0495683_0004148 3300047323 Bacteria 8290
230 Ga0495683_0038988 3300047323 Bacteria 2402
231 Ga0495687_010083 3300047443 Bacteria 5213
232 Ga0495675_0002573 3300047444 Bacteria 10869
233 Ga0495679_000136 3300047446 Bacteria 65848
234 Ga0495679_000326 3300047446 Bacteria 37937
235 Ga0495679_000812 3300047446 Bacteria 19836
236 Ga0495679_001561 3300047446 Bacteria 12929
237 Ga0495679_004275 3300047446 Bacteria 6630
238 Ga0495679_029204 3300047446 Bacteria 1800
239 Ga0495673_0000903 3300047469 Bacteria 27211
240 Ga0495673_0007363 3300047469 Bacteria 6342
241 Ga0495673_0007586 3300047469 Bacteria 6210
242 Ga0495673_0009998 3300047469 Bacteria 5195
243 Ga0495673_0026722 3300047469 Bacteria 2755
244 Ga0495673_0056966 3300047469 Unclassified 1688
245 Ga0495681_0004449 3300047470 Bacteria 9560
246 Ga0495681_0004815 3300047470 Bacteria 9144
247 Ga0495681_0016909 3300047470 Bacteria 4068
248 Ga0495684_0249667 3300047471 Bacteria 1291
249 Ga0495686_0019308 3300047472 Bacteria 4555
250 Ga0495593_0000168 3300047673 Bacteria 33647
251 Ga0495593_0014920 3300047673 Bacteria 4413
252 Ga0495593_0025267 3300047673 Bacteria 3287
253 Ga0495602_0002520 3300048088 Bacteria 18667
254 Ga0495602_0027973 3300048088 Bacteria 5407
255 Ga0495614_0004449 3300048089 Bacteria 6320
256 Ga0495614_0010303 3300048089 Bacteria 4122
257 Ga0495614_0022552 3300048089 Bacteria 2717
258 Ga0495626_0000126 3300048091 Bacteria 99054
259 Ga0495626_0000621 3300048091 Bacteria 34549
260 Ga0495626_0017704 3300048091 Bacteria 3593
261 Ga0496112_0361247 3300048915 Bacteria 1394
262 Ga0496116_0001011 3300048919 Bacteria 34292
263 Ga0496116_0004915 3300048919 Bacteria 12594
264 Ga0496116_0011933 3300048919 Bacteria 7139
265 Ga0496117_0000009 3300048920 Bacteria 613759
266 Ga0496117_0001649 3300048920 Bacteria 31378
267 Ga0496117_0001908 3300048920 Bacteria 27982
268 Ga0496118_0000017 3300048921 Bacteria 549445
269 Ga0496118_0001895 3300048921 Bacteria 29825
270 Ga0496118_0030613 3300048921 Bacteria 4486
271 Ga0496119_0001204 3300048922 Bacteria 32316
272 Ga0496120_0001293 3300048923 Bacteria 31131
273 Ga0496121_0001685 3300048924 Bacteria 36349
274 Ga0496121_0002045 3300048924 Bacteria 31934
275 Ga0496121_0004065 3300048924 Bacteria 20095
276 Ga0496121_0026500 3300048924 Bacteria 5460
277 Ga0496122_0000088 3300048925 Bacteria 207600
278 Ga0496122_0000434 3300048925 Bacteria 87536
279 Ga0496122_0000847 3300048925 Bacteria 57788
280 Ga0496122_0003083 3300048925 Bacteria 22432
281 Ga0496122_0040483 3300048925 Bacteria 3702
282 Ga0496122_0041179 3300048925 Bacteria 3657
283 Ga0496123_0000139 3300048926 Bacteria 151469
284 Ga0496123_0000318 3300048926 Bacteria 91911
285 Ga0496123_0000811 3300048926 Bacteria 50435
286 Ga0496123_0013321 3300048926 Bacteria 6918
287 Ga0496123_0016191 3300048926 Bacteria 6070
288 Ga0496123_0022133 3300048926 Bacteria 4910
289 Ga0496123_0033459 3300048926 Bacteria 3699
290 Ga0496124_0007001 3300048927 Bacteria 12086
291 Ga0496124_0011728 3300048927 Bacteria 8743
292 Ga0496124_0012068 3300048927 Bacteria 8576
293 Ga0496125_0006871 3300048928 Bacteria 12192
294 Ga0501310_005139 3300049130 Bacteria 1337
295 Ga0495678_000073 3300049459 Bacteria 126095
296 Ga0495678_026067 3300049459 Bacteria 2501
297 Ga0495682_0000080 3300049460 Bacteria 84736
298 Ga0495682_0000466 3300049460 Bacteria 27939
299 Ga0495682_0000723 3300049460 Bacteria 21436
300 Ga0495682_0112238 3300049460 Bacteria 977
301 Ga0501249_000818 3300049679 Bacteria 6926
302 Ga0500618_002755 3300053125 Bacteria 6391
303 Ga0500618_002927 3300053125 Bacteria 6110
304 Ga0500621_000036 3300053126 Bacteria 25015
305 Ga0500636_0001254 3300053177 Bacteria 13752
306 8057805174 8057798959 Bacteria 6713499
307 2510281213 2510065053 Bacteria 5005518
308 2510294507 2510065055 Bacteria 5037935
309 2510309361 2510065058 Bacteria 5005894
310 2511349715 2511231020 Bacteria 6115223
311 2511362940 2511231022 Bacteria 6719296
312 2599358269 2599185160 Bacteria 6844013
313 2599383434 2599185164 Bacteria 6841688
314 2599389881 2599185165 Bacteria 6843250
315 2599465084 2599185181 Bacteria 6844519
316 2599494001 2599185186 Bacteria 6831633
317 2599904360 2599185292 Bacteria 6290804
318 2600217817 2599185356 Bacteria 6843884
319 2601777984 2600255313 Bacteria 6842543
320 2609909859 2609459761 Bacteria 5513740
321 2644216681 2643221638 Bacteria 6579467
322 2774131768 2773857672 Bacteria 4993178
323 2784263274 2784132063 Bacteria 6262788
324 2816475877 2816332133 Bacteria 7249298
325 2885083337 2885080285 Bacteria 6355622
326 2917834784 2917832318 Bacteria 5346010
327 2919128909 2919125081 Bacteria 5385106
328 2974300881 2974298342 Bacteria 4840922
329 2984503353 2984499530 Bacteria 5020881
330 2984508170 2984504281 Bacteria 5262371
331 639788755 639633007 Bacteria 4376040
332 8016729633 8016728285 Bacteria 5263933
333 8055266556 8055266321 Bacteria 7999742
334 8056155069 8056155041 Bacteria 6486948
335 rootL2_10275864
336 Ga0055533_1000124
337 Ga0055525_1002684
338 Ga0055526_1002209
339 Ga0055537_1001860
340 Ga0055528_1012818
341 Ga0055530_10000283
342 Ga0070705_100068328
343 Ga0070686_100118088
344 Ga0105251_10004073
345 Ga0105251_10007045
346 Ga0105244_10029797
347 Ga0105250_10003450
348 Ga0105250_10034637
349 Ga0157373_10000759
350 Ga0157370_10002586
351 Ga0157369_10004895
352 Ga0157369_10216302
353 Ga0182008_10001249
354 Ga0182006_1000707
355 Ga0182005_1000014
356 Ga0182005_1000319
357 Ga0182005_1000325
358 Ga0182005_1000529
359 Ga0209566_110707
360 Ga0209674_100005
361 Ga0209563_100360
362 Ga0207427_100394
363 Ga0209233_1000016
364 Ga0209565_1000348
365 Ga0209565_1000439
366 Ga0209565_1001005
367 Ga0209673_1002992
368 Ga0209564_1001062
369 Ga0209050_1000271
370 Ga0209050_1000904
371 Ga0209256_1005349
372 Ga0209256_1037648
373 Ga0209051_1048449
374 Ga0207696_1005870
375 Ga0207655_1001579
376 Ga0207655_1006962
377 Ga0207655_1021551
378 Ga0207655_1053072
379 Ga0207713_1000001
380 Ga0207713_1000073
381 Ga0207713_1000614
382 Ga0207713_1002635
383 Ga0209371_1002174
384 Ga0209371_1021180
385 Ga0307515_10089332
386 Ga0268256_1001911
387 Ga0268256_1025984
388 Ga0265325_10152689
389 Ga0307408_100002453
390 Ga0307412_10008850
391 Ga0307411_10010999
392 Ga0307411_10376706
393 Ga0439438_017264
394 Ga0439432_000099
395 Ga0450911_000103
396 Ga0451577_0000278
397 Ga0453684_0000273
398 Ga0453684_0000901
399 Ga0495617_000086
400 Ga0495617_017982
401 Ga0495627_004515
402 Ga0495603_0000188
403 Ga0495603_0000224
404 Ga0495590_0021055
405 Ga0495591_002361
406 Ga0495591_006365
407 Ga0495629_0009792
408 Ga0495629_0036244
409 Ga0495638_0000868
410 Ga0495651_0015145
411 Ga0495653_0007878
412 Ga0495653_0030966
413 Ga0495650_0000015
414 Ga0495650_0007680
415 Ga0495650_0007927
416 Ga0495580_0003355
417 Ga0495580_0006844
418 Ga0495580_0038922
419 Ga0495582_0026758
420 Ga0495582_0100230
421 Ga0495605_0000484
422 Ga0495605_0001027
423 Ga0495605_0053306
424 Ga0495605_0106166
425 Ga0495605_0139575
426 Ga0495662_0154061
427 Ga0495662_0196623
428 Ga0495664_0018759
429 Ga0495584_0007196
430 Ga0495585_0000671
431 Ga0495585_0000992
432 Ga0495585_0001976
433 Ga0495585_0004263
434 Ga0495594_0046349
435 Ga0495596_0000283
436 Ga0495596_0000781
437 Ga0495596_0002336
438 Ga0495607_0000882
439 Ga0495607_0023687
440 Ga0495607_0181751
441 Ga0495583_0000867
442 Ga0495583_0001402
443 Ga0495583_0002001
444 Ga0495583_0106614
445 Ga0495606_0000722
446 Ga0495606_0002756
447 Ga0495610_0022145
448 Ga0495616_0022570
449 Ga0495616_0040686
450 Ga0495618_0004644
451 Ga0495618_0046130
452 Ga0495620_0000025
453 Ga0495620_0052334
454 Ga0495628_0002727
455 Ga0495628_0016797
456 Ga0495628_0203140
457 Ga0495630_0005244
458 Ga0495631_0000299
459 Ga0495631_0001870
460 Ga0495631_0003654
461 Ga0495631_0013984
462 Ga0495632_0003475
463 Ga0495632_0013362
464 Ga0495637_0000064
465 Ga0495637_0003599
466 Ga0495643_0000897
467 Ga0495643_0078204
468 Ga0495643_0083044
469 Ga0495644_0004951
470 Ga0495644_0039028
471 Ga0495648_0028142
472 Ga0495648_0035042
473 Ga0495666_0000650
474 Ga0495666_0010571
475 Ga0495666_0019879
476 Ga0495666_0127234
477 Ga0495652_0002143
478 Ga0495652_0019319
479 Ga0495654_0000487
480 Ga0495654_0001495
481 Ga0495654_0015556
482 Ga0495665_0001588
483 Ga0495665_0013629
484 Ga0495640_0030164
485 Ga0495586_0000504
486 Ga0495587_0000318
487 Ga0495609_0000073
488 Ga0495609_0000161
489 Ga0495609_0000262
490 Ga0495609_0005620
491 Ga0495597_0000305
492 Ga0495645_0022372
493 Ga0495622_0052398
494 Ga0495633_0000078
495 Ga0495633_0001202
496 Ga0495634_0028798
497 Ga0495611_0000395
498 Ga0495611_0029437
499 Ga0495625_0000194
500 Ga0495635_0000131
501 Ga0495635_0001553
502 Ga0495635_0077563
503 Ga0495661_0000087
504 Ga0495661_0000233
505 Ga0495661_0002189
506 Ga0495661_0002251
507 Ga0495661_0032908
508 Ga0495599_0023308
509 Ga0495599_0162617
510 Ga0495623_0001154
511 Ga0495623_0024707
512 Ga0495623_0200001
513 Ga0495646_0000526
514 Ga0495646_0002594
515 Ga0495646_0019612
516 Ga0495613_0003463
517 Ga0495613_0117480
518 Ga0495613_0203457
519 Ga0495624_0002978
520 Ga0495624_0004754
521 Ga0495624_0053544
522 Ga0495670_0000159
523 Ga0495670_0092863
524 Ga0495671_0001364
525 Ga0495671_0052792
526 Ga0495671_0079371
527 Ga0495671_0104552
528 Ga0495649_0006060
529 Ga0495649_0099044
530 Ga0495589_0000525
531 Ga0495589_0000809
532 Ga0495589_0034056
533 Ga0495600_0053002
534 Ga0495600_0054414
535 Ga0495600_0097465
536 Ga0495660_0027232
537 Ga0495660_0027233
538 Ga0495660_0036272
539 Ga0495660_0077652
540 Ga0495660_0086778
541 Ga0495581_0057555
542 Ga0495604_0000827
543 Ga0495604_0046214
544 Ga0495604_0065969
545 Ga0495674_0004354
546 Ga0495674_0013121
547 Ga0495674_0098156
548 Ga0495674_0402003
549 Ga0495672_0047521
550 Ga0495672_0052509
551 Ga0495676_0000052
552 Ga0495676_0041812
553 Ga0495676_0079878
554 Ga0495676_0111653
555 Ga0495680_0000664
556 Ga0495680_0003077
557 Ga0495680_0005574
558 Ga0495680_0017875
559 Ga0495683_0000619
560 Ga0495683_0000991
561 Ga0495683_0001295
562 Ga0495683_0001332
563 Ga0495683_0004148
564 Ga0495683_0038988
565 Ga0495687_010083
566 Ga0495675_0002573
567 Ga0495679_000136
568 Ga0495679_000326
569 Ga0495679_000812
570 Ga0495679_001561
571 Ga0495679_004275
572 Ga0495679_029204
573 Ga0495673_0000903
574 Ga0495673_0007363
575 Ga0495673_0007586
576 Ga0495673_0009998
577 Ga0495673_0026722
578 Ga0495673_0056966
579 Ga0495681_0004449
580 Ga0495681_0004815
581 Ga0495681_0016909
582 Ga0495684_0249667
583 Ga0495686_0019308
584 Ga0495593_0000168
585 Ga0495593_0014920
586 Ga0495593_0025267
587 Ga0495602_0002520
588 Ga0495602_0027973
589 Ga0495614_0004449
590 Ga0495614_0010303
591 Ga0495614_0022552
592 Ga0495626_0000126
593 Ga0495626_0000621
594 Ga0495626_0017704
595 Ga0496112_0361247
596 Ga0496116_0001011
597 Ga0496116_0004915
598 Ga0496116_0011933
599 Ga0496117_0000009
600 Ga0496117_0001649
601 Ga0496117_0001908
602 Ga0496118_0000017
603 Ga0496118_0001895
604 Ga0496118_0030613
605 Ga0496119_0001204
606 Ga0496120_0001293
607 Ga0496121_0001685
608 Ga0496121_0002045
609 Ga0496121_0004065
610 Ga0496121_0026500
611 Ga0496122_0000088
612 Ga0496122_0000434
613 Ga0496122_0000847
614 Ga0496122_0003083
615 Ga0496122_0040483
616 Ga0496122_0041179
617 Ga0496123_0000139
618 Ga0496123_0000318
619 Ga0496123_0000811
620 Ga0496123_0013321
621 Ga0496123_0016191
622 Ga0496123_0022133
623 Ga0496123_0033459
624 Ga0496124_0007001
625 Ga0496124_0011728
626 Ga0496124_0012068
627 Ga0496125_0006871
628 Ga0501310_005139
629 Ga0495678_000073
630 Ga0495678_026067
631 Ga0495682_0000080
632 Ga0495682_0000466
633 Ga0495682_0000723
634 Ga0495682_0112238
635 Ga0501249_000818
636 Ga0500618_002755
637 Ga0500618_002927
638 Ga0500621_000036
639 Ga0500636_0001254
640 8057805174
641 2510281213
642 2510294507
643 2510309361
644 2511349715
645 2511362940
646 2599358269
647 2599383434
648 2599389881
649 2599465084
650 2599494001
651 2599904360
652 2600217817
653 2601777984
654 2609909859
655 2644216681
656 2774131768
657 2784263274
658 2816475877
659 2885083337
660 2917834784
661 2919128909
662 2974300881
663 2984503353
664 2984508170
665 639788755
666 8016729633
667 8055266556
668 8056155069

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

54

220

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.7177 37 267
7pdo-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with udp 0.7174 15 276
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.7151 37 263
5eke-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.7144 37 270
7pe4-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with udp-glucose 0.7114 15 276
ID Description Score Start End Superfamily
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8518 36 265 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8484 33 272 3.90.550.10
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8336 36 265 3.90.550.10
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.816 36 268 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8035 39 270 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A4D6U7H3-F1-model_v4 Glycosyltransferase family 2 protein 0.9931 10 276 GO:0004582
GO:0009247
GO:0016020
AF-A0A263NYG1-F1-model_v4 Glycosyl transferase family 2 0.9862 24 276 GO:0004582
GO:0009247
GO:0016020
AF-A0A1I7Z4H5-F1-model_v4 Glyco_trans_2-like domain-containing protein 0.9834 57 275 GO:0016020
AF-A0A839B8H7-F1-model_v4 deleted 0.9829 8 276
AF-A0A828R855-F1-model_v4 deleted 0.9826 57 274

Map