F412052

General Info

Members Datasets Scaffolds Average Seq Length
335 188 664 294

Family's Representative Sequence

Representative Sequence 3300001989|JGI24739J22299_10000030|JGI24739J22299_1000003035
Length 334
Sequence MYGKAKIRNSRSHCFPGSNCYFAIFTLYFLDNKSHYQMSNKNSRRDMIKKAAALAFASTTLSSLTNRVMAHEEAMDEKLKGNINHSVCAWCYNDIPLEDLCKAANKIGLASIDLLDPKDFATAKKYDLTCAMVASINKDWGITKGWNRVEHHDRLVEYYQYLIDETSKAGFPHLICFSGNREGLADELGLKNCAQGLQRIMGYAEKKNVTIVMELLNSKVNHHDYQCDHSAWGVELCKAIGSERFKLLYDIYHMQIMEGDVIRTIQENHPYFAHYHTGGVPGRNEIDETQELYYPAIMKAILETGFKGFVAQEFVPKRSDKLASLKQGVEICDI

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
65 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
101 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
102 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
103 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
104 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
109 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
110 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
111 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
126 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
127 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
128 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
131 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
152 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
158 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
159 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
160 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
161 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
162 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
163 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
164 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
168 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
169 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
170 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
171 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
172 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
173 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
174 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
175 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
176 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
177 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
178 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
179 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
180 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
181 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
182 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
183 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
184 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
185 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
186 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
187 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
188 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.42
Metatranscriptomes 0.9
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.52
Nodule 0
Rhizoplane 1.19
Rhizosphere 72.54
Stem 0
Stem Tuber 0
Unclassified 5.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000030 3300001989 Bacteria 39896
2 JGI24740J21852_10005630 3300001979 Bacteria 5275
3 JGI24740J21852_10016155 3300001979 Unclassified 2704
4 JGI24739J22299_10022126 3300001989 Bacteria 2258
5 JGI25154J39366_1000023 3300002738 Bacteria 219569
6 JGI25157J39369_1004050 3300002741 Bacteria 2773
7 JGI25152J39213_1000079 3300002773 Bacteria 65820
8 JGI25153J46596_10000551 3300003215 Bacteria 23390
9 JGI25153J46596_10008379 3300003215 Bacteria 4947
10 rootH1_10002187 3300003316 Bacteria 15443
11 rootH1_10034858 3300003316 Bacteria 21023
12 rootH1_10057866 3300003316 Bacteria 6592
13 rootH2_10003550 3300003320 Bacteria 62481
14 rootH2_10014026 3300003320 Bacteria 3667
15 rootH2_10143378 3300003320 Bacteria 2194
16 rootH2_10240261 3300003320 Bacteria 1741
17 rootL2_10003330 3300003322 Bacteria 14343
18 rootL2_10004867 3300003322 Bacteria 14604
19 rootL2_10013157 3300003322 Bacteria 3947
20 rootL2_10074626 3300003322 Bacteria 4323
21 rootL2_10209676 3300003322 Bacteria 3251
22 rootH1_10002424 3300003323 Bacteria 50256
23 rootH1_10013995 3300003323 Bacteria 73960
24 rootH1_10014349 3300003323 Bacteria 52043
25 rootH1_10020127 3300003323 Bacteria 8065
26 rootH1_10038075 3300003323 Bacteria 5225
27 rootH1_10055602 3300003323 Bacteria 9531
28 rootH1_10078003 3300003323 Bacteria 6116
29 rootH1_10142111 3300003323 Bacteria 2245
30 JGI25160J50197_1019625 3300003354 Bacteria 2066
31 Ga0055542_1003649 3300003762 Bacteria 4054
32 Ga0055526_1049155 3300003771 Bacteria 976
33 Ga0055528_1000532 3300003790 Bacteria 29352
34 Ga0055530_10000185 3300003791 Bacteria 55895
35 Ga0055531_10000038 3300003794 Bacteria 143598
36 Ga0055531_10000080 3300003794 Bacteria 103922
37 Ga0055531_10043653 3300003794 Bacteria 1266
38 Ga0055543_1008856 3300004625 Bacteria 2200
39 Ga0055543_1027535 3300004625 Bacteria 1005
40 Ga0065165_1000027 3300005262 Bacteria 228507
41 Ga0065165_1000169 3300005262 Bacteria 115398
42 Ga0065165_1002573 3300005262 Bacteria 14962
43 Ga0065704_10176816 3300005289 Bacteria 1259
44 Ga0070658_10010626 3300005327 Bacteria 7376
45 Ga0070658_10353356 3300005327 Bacteria 1258
46 Ga0070683_100047754 3300005329 Bacteria 3957
47 Ga0070683_100602983 3300005329 Bacteria 1051
48 Ga0070670_100091952 3300005331 Bacteria 2609
49 Ga0068869_100150488 3300005334 Bacteria 1805
50 Ga0070680_100002384 3300005336 Bacteria 13903
51 Ga0070680_100033472 3300005336 Bacteria 4143
52 Ga0070680_100061482 3300005336 Bacteria 3074
53 Ga0070682_100075010 3300005337 Bacteria 2174
54 Ga0070660_100000589 3300005339 Bacteria 24352
55 Ga0070660_100046062 3300005339 Bacteria 3341
56 Ga0070660_100127716 3300005339 Bacteria 2032
57 Ga0070660_100193980 3300005339 Bacteria 1646
58 Ga0070660_100315992 3300005339 Bacteria 1282
59 Ga0070668_100315238 3300005347 Bacteria 1315
60 Ga0070669_100028482 3300005353 Bacteria 4023
61 Ga0070659_100018572 3300005366 Bacteria 5247
62 Ga0070659_100023085 3300005366 Bacteria 4756
63 Ga0070659_100175444 3300005366 Bacteria 1757
64 Ga0070705_100085367 3300005440 Bacteria 1951
65 Ga0070663_100000935 3300005455 Bacteria 15875
66 Ga0070663_100302652 3300005455 Unclassified 1280
67 Ga0070681_10001937 3300005458 Bacteria 18677
68 Ga0070681_10064297 3300005458 Bacteria 3640
69 Ga0070681_10088789 3300005458 Bacteria 3043
70 Ga0070681_10247170 3300005458 Unclassified 1697
71 Ga0070681_10266910 3300005458 Bacteria 1623
72 Ga0070679_100004034 3300005530 Bacteria 13534
73 Ga0070679_100062001 3300005530 Bacteria 3727
74 Ga0070679_100064616 3300005530 Bacteria 3647
75 Ga0070679_100086751 3300005530 Bacteria 3116
76 Ga0070679_100133824 3300005530 Bacteria 2460
77 Ga0068853_100182603 3300005539 Bacteria 1903
78 Ga0070672_100132754 3300005543 Bacteria 2048
79 Ga0068855_100002978 3300005563 Bacteria 20697
80 Ga0068855_100012595 3300005563 Bacteria 10206
81 Ga0068855_100017499 3300005563 Bacteria 8619
82 Ga0068855_100490697 3300005563 Bacteria 1336
83 Ga0068857_100066782 3300005577 Bacteria 3201
84 Ga0068857_100162191 3300005577 Bacteria 2029
85 Ga0068854_100106961 3300005578 Unclassified 2105
86 Ga0068856_100008552 3300005614 Bacteria 9949
87 Ga0068856_100045873 3300005614 Bacteria 4304
88 Ga0068856_100095030 3300005614 Bacteria 2968
89 Ga0068852_100015434 3300005616 Bacteria 5925
90 Ga0068852_100120940 3300005616 Bacteria 2397
91 Ga0068859_100036136 3300005617 Bacteria 4959
92 Ga0068859_100255733 3300005617 Bacteria 1842
93 Ga0068863_100179044 3300005841 Bacteria 2035
94 Ga0068860_100003349 3300005843 Bacteria 16500
95 Ga0075428_100007808 3300006844 Bacteria 11859
96 Ga0075428_100026809 3300006844 Bacteria 6380
97 Ga0075428_100509050 3300006844 Bacteria 1288
98 Ga0075431_100117634 3300006847 Bacteria 2743
99 Ga0097620_100036136 3300006931 Bacteria 4959
100 Ga0097620_100255729 3300006931 Bacteria 1842
101 Ga0105240_10315525 3300009093 Bacteria 1783
102 Ga0111539_10008980 3300009094 Bacteria 12654
103 Ga0111539_10025044 3300009094 Bacteria 7313
104 Ga0111539_10071008 3300009094 Bacteria 4109
105 Ga0105241_10208302 3300009174 Unclassified 1637
106 Ga0105238_10001621 3300009551 Bacteria 22514
107 Ga0105249_10104379 3300009553 Bacteria 2671
108 Ga0105239_10147417 3300010375 Unclassified 2626
109 Ga0105239_10192365 3300010375 Bacteria 2284
110 Ga0157373_10015649 3300013100 Bacteria 5541
111 Ga0157373_10077855 3300013100 Bacteria 2339
112 Ga0157373_10109884 3300013100 Bacteria 1938
113 Ga0157373_10328316 3300013100 Bacteria 1089
114 Ga0157371_10003077 3300013102 Bacteria 15475
115 Ga0157371_10006552 3300013102 Bacteria 9574
116 Ga0157371_10007327 3300013102 Bacteria 8951
117 Ga0157371_10010482 3300013102 Bacteria 7213
118 Ga0157371_10011445 3300013102 Bacteria 6831
119 Ga0157371_10024970 3300013102 Bacteria 4361
120 Ga0157371_10028001 3300013102 Bacteria 4083
121 Ga0157371_10073277 3300013102 Bacteria 2425
122 Ga0157371_10217113 3300013102 Bacteria 1373
123 Ga0157370_10000408 3300013104 Bacteria 54355
124 Ga0157370_10002931 3300013104 Bacteria 20307
125 Ga0157370_10013614 3300013104 Bacteria 8371
126 Ga0157370_10159074 3300013104 Bacteria 2102
127 Ga0157370_10233198 3300013104 Bacteria 1703
128 Ga0157370_10235377 3300013104 Bacteria 1695
129 Ga0157369_10000605 3300013105 Bacteria 46691
130 Ga0157369_10046814 3300013105 Bacteria 4700
131 Ga0157369_10242608 3300013105 Bacteria 1882
132 Ga0157378_10322582 3300013297 Bacteria 1501
133 Ga0163162_10109971 3300013306 Bacteria 2853
134 Ga0157372_10000015 3300013307 Bacteria 225365
135 Ga0157372_10002383 3300013307 Bacteria 20341
136 Ga0157372_10026913 3300013307 Bacteria 6260
137 Ga0157372_10064472 3300013307 Bacteria 4111
138 Ga0157372_10422602 3300013307 Unclassified 1553
139 Ga0157372_10612642 3300013307 Bacteria 1269
140 Ga0157372_10625276 3300013307 Bacteria 1255
141 Ga0163163_10449326 3300014325 Bacteria 1349
142 Ga0157380_10030564 3300014326 Bacteria 4127
143 Ga0157379_10353786 3300014968 Bacteria 1345
144 Ga0182006_1053409 3300015261 Bacteria 1549
145 Ga0183373_1004 3300015682 Bacteria 537398
146 Ga0206351_10822572 3300020077 Unclassified 1687
147 Ga0209258_100116 3300025242 Bacteria 190317
148 Ga0209646_1000004 3300025246 Bacteria 786587
149 Ga0209026_1000136 3300025250 Bacteria 116507
150 Ga0209148_1000251 3300025254 Bacteria 85638
151 Ga0209673_1000203 3300025273 Bacteria 119623
152 Ga0209676_1002138 3300025292 Bacteria 15037
153 Ga0209564_1017064 3300025295 Bacteria 2853
154 Ga0209758_1001443 3300025297 Bacteria 28004
155 Ga0209758_1015166 3300025297 Bacteria 4018
156 Ga0209050_1000276 3300025298 Bacteria 109997
157 Ga0209050_1001434 3300025298 Bacteria 25653
158 Ga0209050_1001560 3300025298 Bacteria 23881
159 Ga0209050_1027684 3300025298 Bacteria 1861
160 Ga0207426_1000957 3300025302 Bacteria 28456
161 Ga0207426_1001718 3300025302 Bacteria 16783
162 Ga0209257_1000004 3300025304 Bacteria 1678347
163 Ga0209257_1000007 3300025304 Bacteria 1564415
164 Ga0209257_1006752 3300025304 Bacteria 7236
165 Ga0209257_1023027 3300025304 Bacteria 2203
166 Ga0207705_10001474 3300025909 Bacteria 18740
167 Ga0207705_10068406 3300025909 Bacteria 2571
168 Ga0207707_10027410 3300025912 Bacteria 4983
169 Ga0207707_10043073 3300025912 Bacteria 3939
170 Ga0207707_10291529 3300025912 Bacteria 1412
171 Ga0207695_10179311 3300025913 Unclassified 2040
172 Ga0207660_10003228 3300025917 Bacteria 10668
173 Ga0207660_10025881 3300025917 Bacteria 3989
174 Ga0207660_10320946 3300025917 Bacteria 1237
175 Ga0207657_10020993 3300025919 Bacteria 6157
176 Ga0207657_10024891 3300025919 Bacteria 5532
177 Ga0207657_10034473 3300025919 Bacteria 4551
178 Ga0207657_10078987 3300025919 Bacteria 2769
179 Ga0207652_10000160 3300025921 Bacteria 72867
180 Ga0207652_10001233 3300025921 Bacteria 22917
181 Ga0207652_10051324 3300025921 Bacteria 3536
182 Ga0207652_10073747 3300025921 Bacteria 2970
183 Ga0207652_10119821 3300025921 Bacteria 2341
184 Ga0207652_10221678 3300025921 Unclassified 1704
185 Ga0207681_10006905 3300025923 Bacteria 6963
186 Ga0207694_10034670 3300025924 Bacteria 3870
187 Ga0207650_10091982 3300025925 Bacteria 2319
188 Ga0207690_10012659 3300025932 Bacteria 5053
189 Ga0207690_10019114 3300025932 Bacteria 4211
190 Ga0207690_10095029 3300025932 Bacteria 2116
191 Ga0207670_10299851 3300025936 Bacteria 1258
192 Ga0207691_10085846 3300025940 Bacteria 2825
193 Ga0207667_10000630 3300025949 Bacteria 45583
194 Ga0207667_10016493 3300025949 Bacteria 8346
195 Ga0207667_10019347 3300025949 Bacteria 7604
196 Ga0207667_10026416 3300025949 Bacteria 6344
197 Ga0207667_10265742 3300025949 Bacteria 1754
198 Ga0207712_10378348 3300025961 Bacteria 1184
199 Ga0207640_10103493 3300025981 Bacteria 2002
200 Ga0207639_10154991 3300026041 Bacteria 1923
201 Ga0207639_10159038 3300026041 Unclassified 1902
202 Ga0207678_10006569 3300026067 Bacteria 10308
203 Ga0207678_10337648 3300026067 Unclassified 1298
204 Ga0207702_10436886 3300026078 Bacteria 1268
205 Ga0207641_10155212 3300026088 Bacteria 2076
206 Ga0207674_10023207 3300026116 Bacteria 6649
207 Ga0207674_10058204 3300026116 Bacteria 3916
208 Ga0207674_10102615 3300026116 Bacteria 2840
209 Ga0207674_10284917 3300026116 Bacteria 1600
210 Ga0207428_10007264 3300027907 Bacteria 10129
211 Ga0207428_10067706 3300027907 Bacteria 2811
212 Ga0207428_10083263 3300027907 Bacteria 2495
213 Ga0268265_10097159 3300028380 Bacteria 2369
214 Ga0268264_10057611 3300028381 Bacteria 3250
215 Ga0265337_1014152 3300028556 Bacteria 2652
216 Ga0265319_1013754 3300028563 Bacteria 3201
217 Ga0265334_10009911 3300028573 Bacteria 4028
218 Ga0265336_10048809 3300028666 Bacteria 1283
219 Ga0307517_10002284 3300028786 Bacteria 30925
220 Ga0307515_10000094 3300028794 Bacteria 210723
221 Ga0265338_10017335 3300028800 Bacteria 7772
222 Ga0265338_10019568 3300028800 Bacteria 7173
223 Ga0265327_10000985 3300031251 Bacteria 40550
224 Ga0265327_10004892 3300031251 Bacteria 11574
225 Ga0307509_10074669 3300031507 Bacteria 3525
226 Ga0316579_10213504 3300031691 Unclassified 933
227 Ga0316576_10270489 3300031727 Bacteria 1274
228 Ga0307516_10000656 3300031730 Bacteria 46771
229 Ga0307405_10136395 3300031731 Bacteria 1704
230 Ga0316577_10036770 3300031733 Unclassified 2739
231 Ga0307407_10069388 3300031903 Bacteria 2092
232 Ga0307412_10081525 3300031911 Bacteria 2238
233 Ga0307409_100062733 3300031995 Bacteria 2911
234 Ga0307416_100000002 3300032002 Bacteria 509907
235 Ga0307416_100005017 3300032002 Bacteria 8071
236 Ga0307415_100228264 3300032126 Bacteria 1497
237 Ga0373931_0334742 3300035691 Bacteria 944
238 Ga0316582_0509284 3300036647 Unclassified 829
239 Ga0395899_0000615 3300037312 Bacteria 37072
240 Ga0395899_0002489 3300037312 Bacteria 14953
241 Ga0395899_0006074 3300037312 Bacteria 9377
242 Ga0395899_0007101 3300037312 Bacteria 8668
243 Ga0395899_0043169 3300037312 Bacteria 3364
244 Ga0395900_0002996 3300037418 Bacteria 18376
245 Ga0395900_0024025 3300037418 Bacteria 6236
246 Ga0395900_0032543 3300037418 Bacteria 5362
247 Ga0395900_0062154 3300037418 Bacteria 3838
248 Ga0395900_0289568 3300037418 Unclassified 1627
249 Ga0395900_0524609 3300037418 Bacteria 1132
250 Ga0395898_0000738 3300037466 Bacteria 57155
251 Ga0395898_0006085 3300037466 Bacteria 12948
252 Ga0395898_0041215 3300037466 Bacteria 4561
253 Ga0395901_0002864 3300038443 Bacteria 17425
254 Ga0395901_0018348 3300038443 Bacteria 7143
255 Ga0395901_0038364 3300038443 Bacteria 4955
256 Ga0451798_0784811 3300041458 Bacteria 922
257 Ga0451800_0141886 3300041459 Bacteria 1070
258 Ga0451807_1689593 3300041486 Bacteria 1250
259 Ga0451849_0558546 3300041505 Bacteria 1103
260 Ga0451577_0015367 3300042876 Bacteria 7124
261 Ga0453683_0007051 3300044673 Bacteria 7657
262 Ga0466965_0149299 3300044683 Bacteria 1221
263 Ga0453684_0001857 3300044712 Bacteria 55136
264 Ga0466959_0152878 3300045049 Unclassified 1625
265 Ga0451576_0006481 3300045051 Bacteria 14343
266 Ga0451576_0008597 3300045051 Bacteria 11963
267 Ga0451576_0093702 3300045051 Unclassified 3123
268 Ga0466958_0005750 3300045836 Bacteria 6703
269 Ga0495638_0000004 3300046460 Bacteria 700795
270 Ga0495638_0000006 3300046460 Bacteria 668846
271 Ga0495662_0102016 3300046476 Bacteria 1403
272 Ga0495606_0059860 3300046507 Bacteria 2442
273 Ga0495618_0001313 3300046514 Bacteria 16719
274 Ga0495628_0000140 3300046516 Bacteria 62202
275 Ga0495640_0015274 3300046533 Bacteria 5780
276 Ga0495645_0001437 3300046543 Bacteria 16062
277 Ga0495633_0000116 3300046558 Bacteria 108667
278 Ga0495599_0047397 3300046678 Bacteria 2693
279 Ga0495624_0031236 3300046690 Bacteria 3465
280 Ga0495674_0010849 3300047319 Bacteria 8615
281 Ga0495681_0049422 3300047470 Bacteria 1988
282 Ga0496101_0092151 3300048904 Bacteria 2256
283 Ga0496126_0021648 3300048929 Bacteria 6276
284 Ga0501309_013296 3300049129 Bacteria 1093
285 Ga0501300_002628 3300049523 Bacteria 2693
286 Ga0501336_005245 3300049552 Bacteria 931
287 Ga0501033_0034102 3300049570 Bacteria 3820
288 Ga0501033_0412778 3300049570 Bacteria 941
289 Ga0501034_0155786 3300049571 Bacteria 2258
290 Ga0501034_0295830 3300049571 Bacteria 1556
291 Ga0501043_0207750 3300049579 Bacteria 1518
292 Ga0501047_0023388 3300049581 Bacteria 5933
293 Ga0501206_006541 3300049653 Bacteria 1516
294 Ga0501217_001988 3300049661 Bacteria 3944
295 Ga0501236_004723 3300049670 Bacteria 1625
296 Ga0501242_000924 3300049674 Bacteria 2805
297 Ga0501247_000618 3300049677 Bacteria 2952
298 Ga0501257_001169 3300049686 Bacteria 5367
299 Ga0501241_000709 3300049758 Bacteria 7191
300 Ga0501264_000066 3300049761 Bacteria 14768
301 nmdc:mga06r32_262639_c1 3300050510 Bacteria 1714
302 nmdc:mga08y16_333241_c1 3300050511 Bacteria 1561
303 nmdc:mga08y16_56189_c1 3300050511 Bacteria 4114
304 nmdc:mga08y16_8143_c1 3300050511 Bacteria 10966
305 Ga0500644_0000469 3300053088 Bacteria 17883
306 Ga0500646_0002201 3300053090 Bacteria 5086
307 Ga0500562_000004 3300053108 Bacteria 270087
308 Ga0500569_000534 3300053109 Bacteria 6350
309 Ga0500618_005550 3300053125 Bacteria 3816
310 Ga0500655_005657 3300053133 Bacteria 2248
311 Ga0500658_0003895 3300053134 Bacteria 5614
312 Ga0500559_0010236 3300053136 Bacteria 4032
313 Ga0500616_0000015 3300053153 Bacteria 633259
314 Ga0500616_0000065 3300053153 Bacteria 239287
315 Ga0500616_0026020 3300053153 Bacteria 3243
316 Ga0500616_0030483 3300053153 Bacteria 2962
317 Ga0500622_0000379 3300053156 Bacteria 42858
318 Ga0500622_0000418 3300053156 Bacteria 40378
319 Ga0500622_0000421 3300053156 Bacteria 40169
320 Ga0500633_0001068 3300053160 Bacteria 4904
321 Ga0500636_0008604 3300053177 Bacteria 5911
322 Ga0500661_006563 3300055283 Bacteria 2164
323 Ga0500661_008500 3300055283 Bacteria 1889
324 2522551170 2522125168 Bacteria 7376607
325 2840678778 2840677318 Bacteria 2664183
326 2884796793 2884791551 Bacteria 8511252
327 2896086596 2896085136 Bacteria 6129793
328 2896113104 2896109856 Bacteria 7140722
329 2910249027 2910245624 Bacteria 6935613
330 2929240055 2929239360 Bacteria 7745570
331 2929921754 2929921140 Bacteria 8649150
332 8003154300 8003151029 Bacteria 8187759
333 JGI24739J22299_10000030
334 JGI24740J21852_10005630
335 JGI24740J21852_10016155
336 JGI24739J22299_10022126
337 JGI25154J39366_1000023
338 JGI25157J39369_1004050
339 JGI25152J39213_1000079
340 JGI25153J46596_10000551
341 JGI25153J46596_10008379
342 rootH1_10002187
343 rootH1_10034858
344 rootH1_10057866
345 rootH2_10003550
346 rootH2_10014026
347 rootH2_10143378
348 rootH2_10240261
349 rootL2_10003330
350 rootL2_10004867
351 rootL2_10013157
352 rootL2_10074626
353 rootL2_10209676
354 rootH1_10002424
355 rootH1_10013995
356 rootH1_10014349
357 rootH1_10020127
358 rootH1_10038075
359 rootH1_10055602
360 rootH1_10078003
361 rootH1_10142111
362 JGI25160J50197_1019625
363 Ga0055542_1003649
364 Ga0055526_1049155
365 Ga0055528_1000532
366 Ga0055530_10000185
367 Ga0055531_10000038
368 Ga0055531_10000080
369 Ga0055531_10043653
370 Ga0055543_1008856
371 Ga0055543_1027535
372 Ga0065165_1000027
373 Ga0065165_1000169
374 Ga0065165_1002573
375 Ga0065704_10176816
376 Ga0070658_10010626
377 Ga0070658_10353356
378 Ga0070683_100047754
379 Ga0070683_100602983
380 Ga0070670_100091952
381 Ga0068869_100150488
382 Ga0070680_100002384
383 Ga0070680_100033472
384 Ga0070680_100061482
385 Ga0070682_100075010
386 Ga0070660_100000589
387 Ga0070660_100046062
388 Ga0070660_100127716
389 Ga0070660_100193980
390 Ga0070660_100315992
391 Ga0070668_100315238
392 Ga0070669_100028482
393 Ga0070659_100018572
394 Ga0070659_100023085
395 Ga0070659_100175444
396 Ga0070705_100085367
397 Ga0070663_100000935
398 Ga0070663_100302652
399 Ga0070681_10001937
400 Ga0070681_10064297
401 Ga0070681_10088789
402 Ga0070681_10247170
403 Ga0070681_10266910
404 Ga0070679_100004034
405 Ga0070679_100062001
406 Ga0070679_100064616
407 Ga0070679_100086751
408 Ga0070679_100133824
409 Ga0068853_100182603
410 Ga0070672_100132754
411 Ga0068855_100002978
412 Ga0068855_100012595
413 Ga0068855_100017499
414 Ga0068855_100490697
415 Ga0068857_100066782
416 Ga0068857_100162191
417 Ga0068854_100106961
418 Ga0068856_100008552
419 Ga0068856_100045873
420 Ga0068856_100095030
421 Ga0068852_100015434
422 Ga0068852_100120940
423 Ga0068859_100036136
424 Ga0068859_100255733
425 Ga0068863_100179044
426 Ga0068860_100003349
427 Ga0075428_100007808
428 Ga0075428_100026809
429 Ga0075428_100509050
430 Ga0075431_100117634
431 Ga0097620_100036136
432 Ga0097620_100255729
433 Ga0105240_10315525
434 Ga0111539_10008980
435 Ga0111539_10025044
436 Ga0111539_10071008
437 Ga0105241_10208302
438 Ga0105238_10001621
439 Ga0105249_10104379
440 Ga0105239_10147417
441 Ga0105239_10192365
442 Ga0157373_10015649
443 Ga0157373_10077855
444 Ga0157373_10109884
445 Ga0157373_10328316
446 Ga0157371_10003077
447 Ga0157371_10006552
448 Ga0157371_10007327
449 Ga0157371_10010482
450 Ga0157371_10011445
451 Ga0157371_10024970
452 Ga0157371_10028001
453 Ga0157371_10073277
454 Ga0157371_10217113
455 Ga0157370_10000408
456 Ga0157370_10002931
457 Ga0157370_10013614
458 Ga0157370_10159074
459 Ga0157370_10233198
460 Ga0157370_10235377
461 Ga0157369_10000605
462 Ga0157369_10046814
463 Ga0157369_10242608
464 Ga0157378_10322582
465 Ga0163162_10109971
466 Ga0157372_10000015
467 Ga0157372_10002383
468 Ga0157372_10026913
469 Ga0157372_10064472
470 Ga0157372_10422602
471 Ga0157372_10612642
472 Ga0157372_10625276
473 Ga0163163_10449326
474 Ga0157380_10030564
475 Ga0157379_10353786
476 Ga0182006_1053409
477 Ga0183373_1004
478 Ga0206351_10822572
479 Ga0209258_100116
480 Ga0209646_1000004
481 Ga0209026_1000136
482 Ga0209148_1000251
483 Ga0209673_1000203
484 Ga0209676_1002138
485 Ga0209564_1017064
486 Ga0209758_1001443
487 Ga0209758_1015166
488 Ga0209050_1000276
489 Ga0209050_1001434
490 Ga0209050_1001560
491 Ga0209050_1027684
492 Ga0207426_1000957
493 Ga0207426_1001718
494 Ga0209257_1000004
495 Ga0209257_1000007
496 Ga0209257_1006752
497 Ga0209257_1023027
498 Ga0207705_10001474
499 Ga0207705_10068406
500 Ga0207707_10027410
501 Ga0207707_10043073
502 Ga0207707_10291529
503 Ga0207695_10179311
504 Ga0207660_10003228
505 Ga0207660_10025881
506 Ga0207660_10320946
507 Ga0207657_10020993
508 Ga0207657_10024891
509 Ga0207657_10034473
510 Ga0207657_10078987
511 Ga0207652_10000160
512 Ga0207652_10001233
513 Ga0207652_10051324
514 Ga0207652_10073747
515 Ga0207652_10119821
516 Ga0207652_10221678
517 Ga0207681_10006905
518 Ga0207694_10034670
519 Ga0207650_10091982
520 Ga0207690_10012659
521 Ga0207690_10019114
522 Ga0207690_10095029
523 Ga0207670_10299851
524 Ga0207691_10085846
525 Ga0207667_10000630
526 Ga0207667_10016493
527 Ga0207667_10019347
528 Ga0207667_10026416
529 Ga0207667_10265742
530 Ga0207712_10378348
531 Ga0207640_10103493
532 Ga0207639_10154991
533 Ga0207639_10159038
534 Ga0207678_10006569
535 Ga0207678_10337648
536 Ga0207702_10436886
537 Ga0207641_10155212
538 Ga0207674_10023207
539 Ga0207674_10058204
540 Ga0207674_10102615
541 Ga0207674_10284917
542 Ga0207428_10007264
543 Ga0207428_10067706
544 Ga0207428_10083263
545 Ga0268265_10097159
546 Ga0268264_10057611
547 Ga0265337_1014152
548 Ga0265319_1013754
549 Ga0265334_10009911
550 Ga0265336_10048809
551 Ga0307517_10002284
552 Ga0307515_10000094
553 Ga0265338_10017335
554 Ga0265338_10019568
555 Ga0265327_10000985
556 Ga0265327_10004892
557 Ga0307509_10074669
558 Ga0316579_10213504
559 Ga0316576_10270489
560 Ga0307516_10000656
561 Ga0307405_10136395
562 Ga0316577_10036770
563 Ga0307407_10069388
564 Ga0307412_10081525
565 Ga0307409_100062733
566 Ga0307416_100000002
567 Ga0307416_100005017
568 Ga0307415_100228264
569 Ga0373931_0334742
570 Ga0316582_0509284
571 Ga0395899_0000615
572 Ga0395899_0002489
573 Ga0395899_0006074
574 Ga0395899_0007101
575 Ga0395899_0043169
576 Ga0395900_0002996
577 Ga0395900_0024025
578 Ga0395900_0032543
579 Ga0395900_0062154
580 Ga0395900_0289568
581 Ga0395900_0524609
582 Ga0395898_0000738
583 Ga0395898_0006085
584 Ga0395898_0041215
585 Ga0395901_0002864
586 Ga0395901_0018348
587 Ga0395901_0038364
588 Ga0451798_0784811
589 Ga0451800_0141886
590 Ga0451807_1689593
591 Ga0451849_0558546
592 Ga0451577_0015367
593 Ga0453683_0007051
594 Ga0466965_0149299
595 Ga0453684_0001857
596 Ga0466959_0152878
597 Ga0451576_0006481
598 Ga0451576_0008597
599 Ga0451576_0093702
600 Ga0466958_0005750
601 Ga0495638_0000004
602 Ga0495638_0000006
603 Ga0495662_0102016
604 Ga0495606_0059860
605 Ga0495618_0001313
606 Ga0495628_0000140
607 Ga0495640_0015274
608 Ga0495645_0001437
609 Ga0495633_0000116
610 Ga0495599_0047397
611 Ga0495624_0031236
612 Ga0495674_0010849
613 Ga0495681_0049422
614 Ga0496101_0092151
615 Ga0496126_0021648
616 Ga0501309_013296
617 Ga0501300_002628
618 Ga0501336_005245
619 Ga0501033_0034102
620 Ga0501033_0412778
621 Ga0501034_0155786
622 Ga0501034_0295830
623 Ga0501043_0207750
624 Ga0501047_0023388
625 Ga0501206_006541
626 Ga0501217_001988
627 Ga0501236_004723
628 Ga0501242_000924
629 Ga0501247_000618
630 Ga0501257_001169
631 Ga0501241_000709
632 Ga0501264_000066
633 nmdc:mga06r32_262639_c1
634 nmdc:mga08y16_333241_c1
635 nmdc:mga08y16_56189_c1
636 nmdc:mga08y16_8143_c1
637 Ga0500644_0000469
638 Ga0500646_0002201
639 Ga0500562_000004
640 Ga0500569_000534
641 Ga0500618_005550
642 Ga0500655_005657
643 Ga0500658_0003895
644 Ga0500559_0010236
645 Ga0500616_0000015
646 Ga0500616_0000065
647 Ga0500616_0026020
648 Ga0500616_0030483
649 Ga0500622_0000379
650 Ga0500622_0000418
651 Ga0500622_0000421
652 Ga0500633_0001068
653 Ga0500636_0008604
654 Ga0500661_006563
655 Ga0500661_008500
656 2522551170
657 2840678778
658 2884796793
659 2896086596
660 2896113104
661 2910249027
662 2929240055
663 2929921754
664 8003154300

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

102

332

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.8931 46 288
1k77-assembly1.cif.gz_A crystal structure of ec1530, a putative oxygenase from escherichia coli 0.8703 46 288
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.8416 46 288
3vyl-assembly2.cif.gz_H structure of l-ribulose 3-epimerase 0.8193 46 290
7x7w-assembly1.cif.gz_B-2 the x-ray crystallographic structure of d-psicose 3-epimerase from clostridia bacterium 0.8173 46 295
ID Description Score Start End Superfamily
af_Q7T3H9_4_269_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8921 46 288 3.20.20.150
af_P36951_1_261_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8818 46 288 3.20.20.150
1k77A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8652 47 288 3.20.20.150
af_P30147_1_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8615 46 288 3.20.20.150
af_Q11185_2_259_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8416 46 292 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A1V6DH27-F1-model_v4 deleted 0.9797 41 297
AF-A0A3B9APF4-F1-model_v4 Hydroxypyruvate isomerase 0.9774 120 297 GO:0016853
AF-A0A3M1BXT2-F1-model_v4 Hydroxypyruvate isomerase 0.9766 44 297 GO:0016853
AF-A0A7V8GM33-F1-model_v4 Hydroxypyruvate isomerase 0.9762 40 297 GO:0016853
AF-A0A3D4TDJ3-F1-model_v4 Hydroxypyruvate isomerase 0.9752 47 297 GO:0016853

Map