F412062

General Info

Members Datasets Scaffolds Average Seq Length
335 228 670 132

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10088056|rootH2_100880562
Length 135
Sequence MMKLTPELHSLVLVAVVTVLMWIPYMAARIFTRGPVKTLANPDPAFKPDPAWAERARRAHANAVENLVVFAPLVIVAAMLGVSTPTTVMAANVYLWARIAHFVVYAAGIPVLRTLAFAAGFAATLAMAGAVLGQA

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
124 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
125 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
126 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
129 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
130 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
134 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
135 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
136 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
213 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
224 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.04
Nodule 0
Rhizoplane 11.94
Rhizosphere 72.84
Stem 0
Stem Tuber 0
Unclassified 17.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10088056 3300003320 Bacteria 2404
2 JGI25153J46596_10032940 3300003215 Bacteria 1719
3 rootL2_10309207 3300003322 Bacteria 1100
4 rootH1_10308701 3300003323 Bacteria 1418
5 rootH1_10340903 3300003323 Bacteria 5139
6 Ga0055535_1026428 3300003761 Unclassified 643
7 Ga0055529_1004789 3300003763 Bacteria 2025
8 Ga0055526_1018945 3300003771 Bacteria 2534
9 Ga0055537_1000005 3300003773 Bacteria 160497
10 Ga0055524_1004182 3300003775 Bacteria 6734
11 Ga0055524_1081161 3300003775 Bacteria 590
12 Ga0055534_1000127 3300003784 Bacteria 57100
13 Ga0055528_1000063 3300003790 Bacteria 85587
14 Ga0055530_10000085 3300003791 Bacteria 80382
15 Ga0055531_10001673 3300003794 Bacteria 15960
16 Ga0065165_1000414 3300005262 Bacteria 67711
17 Ga0070676_11075099 3300005328 Unclassified 607
18 Ga0070690_100706065 3300005330 Bacteria 775
19 Ga0070670_101049204 3300005331 Unclassified 742
20 Ga0070677_10675820 3300005333 Unclassified 579
21 Ga0070666_10707459 3300005335 Unclassified 739
22 Ga0070680_100163741 3300005336 Bacteria 1870
23 Ga0070680_101567504 3300005336 Unclassified 571
24 Ga0070682_100217738 3300005337 Bacteria 1357
25 Ga0070682_100253163 3300005337 Bacteria 1271
26 Ga0070682_101000624 3300005337 Unclassified 694
27 Ga0070660_100628306 3300005339 Bacteria 899
28 Ga0070691_10236617 3300005341 Unclassified 974
29 Ga0070661_100595732 3300005344 Bacteria 893
30 Ga0070671_100095816 3300005355 Bacteria 2488
31 Ga0070671_100104266 3300005355 Bacteria 2380
32 Ga0070674_100210494 3300005356 Bacteria 1506
33 Ga0070710_10109446 3300005437 Bacteria 1657
34 Ga0070711_100221127 3300005439 Bacteria 1472
35 Ga0070711_100580043 3300005439 Unclassified 933
36 Ga0070705_100736665 3300005440 Unclassified 778
37 Ga0070700_100249980 3300005441 Unclassified 1271
38 Ga0070700_100274770 3300005441 Bacteria 1219
39 Ga0070663_101623692 3300005455 Bacteria 577
40 Ga0070678_100232533 3300005456 Bacteria 1537
41 Ga0070678_100359196 3300005456 Bacteria 1255
42 Ga0070662_100230124 3300005457 Bacteria 1482
43 Ga0070681_10883438 3300005458 Unclassified 812
44 Ga0068867_100244031 3300005459 Bacteria 1458
45 Ga0068853_102097031 3300005539 Unclassified 548
46 Ga0070672_101278252 3300005543 Bacteria 655
47 Ga0070695_100504852 3300005545 Unclassified 936
48 Ga0070695_100775502 3300005545 Bacteria 766
49 Ga0070693_100012005 3300005547 Bacteria 4374
50 Ga0070693_100449225 3300005547 Unclassified 904
51 Ga0070665_102415871 3300005548 Unclassified 528
52 Ga0070665_102456461 3300005548 Unclassified 523
53 Ga0070664_100197764 3300005564 Unclassified 1793
54 Ga0068864_100721469 3300005618 Unclassified 975
55 Ga0068866_10415002 3300005718 Unclassified 872
56 Ga0068863_100056085 3300005841 Bacteria 3730
57 Ga0068862_100894801 3300005844 Bacteria 872
58 Ga0075365_10645772 3300006038 Bacteria 748
59 Ga0075364_10297373 3300006051 Bacteria 1099
60 Ga0075367_10720052 3300006178 Bacteria 635
61 Ga0097621_100191313 3300006237 Bacteria 1772
62 Ga0097621_101239641 3300006237 Unclassified 703
63 Ga0097621_101435892 3300006237 Bacteria 654
64 Ga0097621_102138584 3300006237 Bacteria 535
65 Ga0068871_100019344 3300006358 Bacteria 5198
66 Ga0068871_100117668 3300006358 Bacteria 2241
67 Ga0068871_100318579 3300006358 Bacteria 1369
68 Ga0068871_100729545 3300006358 Bacteria 909
69 Ga0068871_101153230 3300006358 Bacteria 726
70 Ga0075428_100622405 3300006844 Bacteria 1152
71 Ga0075431_100209398 3300006847 Bacteria 1992
72 Ga0075433_10017141 3300006852 Bacteria 5993
73 Ga0075434_100024715 3300006871 Bacteria 5874
74 Ga0075434_100212226 3300006871 Unclassified 1956
75 Ga0068865_100238045 3300006881 Bacteria 1431
76 Ga0068865_100479819 3300006881 Bacteria 1033
77 Ga0075436_100878475 3300006914 Bacteria 670
78 Ga0105240_10000115 3300009093 Bacteria 165594
79 Ga0105240_12567477 3300009093 Bacteria 526
80 Ga0111539_10086028 3300009094 Bacteria 3695
81 Ga0105245_10034576 3300009098 Bacteria 4483
82 Ga0105245_10110740 3300009098 Bacteria 2553
83 Ga0105245_11451914 3300009098 Bacteria 736
84 Ga0105247_11223535 3300009101 Unclassified 599
85 Ga0105243_10244928 3300009148 Bacteria 1597
86 Ga0105243_10929634 3300009148 Bacteria 867
87 Ga0105243_11649630 3300009148 Unclassified 669
88 Ga0105241_10132492 3300009174 Bacteria 2020
89 Ga0105242_10083958 3300009176 Bacteria 2668
90 Ga0105242_10545496 3300009176 Bacteria 1111
91 Ga0105248_10017412 3300009177 Bacteria 7922
92 Ga0105248_10039894 3300009177 Bacteria 5263
93 Ga0105248_10653408 3300009177 Bacteria 1186
94 Ga0105248_12231352 3300009177 Bacteria 623
95 Ga0105237_10749337 3300009545 Bacteria 983
96 Ga0105238_10520081 3300009551 Bacteria 1192
97 Ga0105238_11216852 3300009551 Bacteria 778
98 Ga0105239_10206423 3300010375 Bacteria 2201
99 Ga0105239_10481381 3300010375 Bacteria 1410
100 Ga0105239_11243928 3300010375 Unclassified 858
101 Ga0105246_10427733 3300011119 Bacteria 1107
102 Ga0157370_10220488 3300013104 Bacteria 1757
103 Ga0157374_11934180 3300013296 Unclassified 616
104 Ga0157378_10186479 3300013297 Bacteria 1954
105 Ga0157378_10835310 3300013297 Bacteria 949
106 Ga0163162_10054199 3300013306 Bacteria 4033
107 Ga0163162_10483511 3300013306 Bacteria 1369
108 Ga0157380_10378616 3300014326 Bacteria 1335
109 Ga0157377_10645693 3300014745 Unclassified 761
110 Ga0157376_10139715 3300014969 Bacteria 2171
111 Ga0157376_10260507 3300014969 Bacteria 1624
112 Ga0157376_10359069 3300014969 Unclassified 1397
113 Ga0163161_10032455 3300017792 Bacteria 3728
114 Ga0163161_10034854 3300017792 Bacteria 3600
115 Ga0209258_102814 3300025242 Bacteria 4173
116 Ga0209565_1000074 3300025263 Bacteria 164237
117 Ga0209455_1001534 3300025272 Bacteria 10303
118 Ga0209673_1000129 3300025273 Bacteria 164238
119 Ga0209675_1000072 3300025291 Bacteria 164237
120 Ga0209564_1000160 3300025295 Bacteria 164214
121 Ga0209758_1001079 3300025297 Bacteria 35474
122 Ga0209050_1000034 3300025298 Bacteria 433906
123 Ga0209256_1000125 3300025299 Bacteria 165336
124 Ga0209256_1000146 3300025299 Bacteria 149440
125 Ga0209257_1000052 3300025304 Bacteria 430947
126 Ga0209257_1000100 3300025304 Bacteria 253399
127 Ga0209257_1011367 3300025304 Bacteria 4297
128 Ga0207692_10210710 3300025898 Unclassified 1147
129 Ga0207692_10283808 3300025898 Unclassified 1003
130 Ga0207680_10900082 3300025903 Unclassified 634
131 Ga0207685_10210128 3300025905 Unclassified 920
132 Ga0207654_10467527 3300025911 Bacteria 887
133 Ga0207707_10180230 3300025912 Bacteria 1844
134 Ga0207707_10218064 3300025912 Bacteria 1661
135 Ga0207695_10000116 3300025913 Bacteria 239510
136 Ga0207663_10322942 3300025916 Bacteria 1160
137 Ga0207657_10441459 3300025919 Unclassified 1022
138 Ga0207652_10277703 3300025921 Unclassified 1511
139 Ga0207687_10027802 3300025927 Bacteria 3796
140 Ga0207687_11056927 3300025927 Unclassified 697
141 Ga0207700_11209557 3300025928 Bacteria 674
142 Ga0207644_10990428 3300025931 Unclassified 705
143 Ga0207644_11248859 3300025931 Bacteria 624
144 Ga0207706_10080149 3300025933 Bacteria 2871
145 Ga0207686_10097083 3300025934 Bacteria 1959
146 Ga0207686_10892387 3300025934 Unclassified 717
147 Ga0207709_11131032 3300025935 Unclassified 644
148 Ga0207669_10187554 3300025937 Bacteria 1489
149 Ga0207704_10534632 3300025938 Unclassified 950
150 Ga0207704_11147033 3300025938 Bacteria 661
151 Ga0207665_10382394 3300025939 Bacteria 1068
152 Ga0207691_10799722 3300025940 Bacteria 792
153 Ga0207711_10013223 3300025941 Bacteria 6857
154 Ga0207711_10446267 3300025941 Bacteria 1204
155 Ga0207651_10982302 3300025960 Bacteria 754
156 Ga0207651_11411780 3300025960 Unclassified 627
157 Ga0207658_10180925 3300025986 Bacteria 1745
158 Ga0207677_12241543 3300026023 Bacteria 508
159 Ga0207703_10304394 3300026035 Bacteria 1455
160 Ga0207678_10017033 3300026067 Bacteria 6381
161 Ga0207708_10425045 3300026075 Bacteria 1102
162 Ga0207708_10467888 3300026075 Bacteria 1052
163 Ga0207641_10182504 3300026088 Bacteria 1923
164 Ga0207675_100513441 3300026118 Bacteria 1194
165 Ga0207683_10057789 3300026121 Bacteria 3405
166 Ga0207683_10489607 3300026121 Bacteria 1135
167 Ga0207428_10179995 3300027907 Bacteria 1598
168 Ga0268266_10000003 3300028379 Bacteria 1701703
169 Ga0268266_10290464 3300028379 Bacteria 1523
170 Ga0268266_11041090 3300028379 Bacteria 792
171 Ga0268265_11085253 3300028380 Bacteria 794
172 Ga0268265_11365736 3300028380 Unclassified 710
173 Ga0265325_10007227 3300031241 Bacteria 6677
174 Ga0265325_10238480 3300031241 Bacteria 827
175 Ga0265331_10326680 3300031250 Bacteria 687
176 Ga0307509_10020609 3300031507 Bacteria 7477
177 Ga0307509_10468540 3300031507 Bacteria 950
178 Ga0307416_100960561 3300032002 Bacteria 957
179 Ga0373950_0138436 3300034818 Unclassified 550
180 Ga0373958_0009154 3300034819 Bacteria 1624
181 Ga0373938_0053811 3300034957 Bacteria 925
182 Ga0373929_0001716 3300035085 Bacteria 4119
183 Ga0373934_0039890 3300035086 Bacteria 1851
184 Ga0373940_0032211 3300035088 Bacteria 1404
185 Ga0373944_0125292 3300035089 Bacteria 889
186 Ga0373951_0104333 3300035091 Unclassified 757
187 Ga0373951_0109965 3300035091 Unclassified 741
188 Ga0373923_0211088 3300035111 Bacteria 900
189 Ga0373941_0491737 3300035115 Unclassified 520
190 Ga0373953_0045821 3300035117 Bacteria 1754
191 Ga0373954_0160005 3300035118 Bacteria 1101
192 Ga0373956_0001709 3300035119 Bacteria 9055
193 Ga0373960_0029630 3300035121 Bacteria 1519
194 Ga0373943_0026041 3300035170 Bacteria 2738
195 Ga0373943_0624267 3300035170 Bacteria 636
196 Ga0373946_0150984 3300035171 Bacteria 1084
197 Ga0373955_0047021 3300035172 Bacteria 2335
198 Ga0373942_0008860 3300035207 Bacteria 2350
199 Ga0373961_0031127 3300035241 Bacteria 1488
200 Ga0373962_0202186 3300035242 Unclassified 673
201 Ga0373931_0003638 3300035691 Bacteria 6962
202 Ga0373931_0009778 3300035691 Bacteria 4592
203 Ga0373931_0067587 3300035691 Bacteria 1943
204 Ga0373931_0445544 3300035691 Bacteria 827
205 Ga0373935_0174954 3300035692 Bacteria 1470
206 Ga0373927_0270578 3300035695 Bacteria 1117
207 Ga0373927_0608462 3300035695 Bacteria 722
208 Ga0373933_0337171 3300035724 Unclassified 978
209 Ga0373933_0671302 3300035724 Bacteria 681
210 Ga0373947_0018023 3300035725 Bacteria 4063
211 Ga0373947_0053316 3300035725 Bacteria 2438
212 Ga0373947_0224498 3300035725 Bacteria 1236
213 Ga0373937_0374761 3300036401 Bacteria 1349
214 Ga0373925_0072489 3300037068 Bacteria 2606
215 Ga0373925_0098481 3300037068 Bacteria 2244
216 Ga0373925_0830001 3300037068 Unclassified 762
217 Ga0436365_0211847 3300039437 Bacteria 772
218 Ga0495592_0008274 3300046454 Bacteria 7808
219 Ga0495592_0268512 3300046454 Bacteria 1120
220 Ga0495603_0170817 3300046455 Bacteria 1259
221 Ga0495629_0414726 3300046459 Bacteria 914
222 Ga0495638_0397934 3300046460 Bacteria 715
223 Ga0495651_0007988 3300046462 Bacteria 8113
224 Ga0495653_0302605 3300046463 Bacteria 1042
225 Ga0495664_0031346 3300046477 Bacteria 3116
226 Ga0495664_0129665 3300046477 Bacteria 1526
227 Ga0495594_0116188 3300046499 Bacteria 1511
228 Ga0495606_0000194 3300046507 Bacteria 106498
229 Ga0495608_0009002 3300046511 Bacteria 6981
230 Ga0495618_0156829 3300046514 Bacteria 1452
231 Ga0495620_0000016 3300046515 Bacteria 153638
232 Ga0495628_0081667 3300046516 Bacteria 2510
233 Ga0495628_0370127 3300046516 Bacteria 1051
234 Ga0495630_0043991 3300046517 Bacteria 3337
235 Ga0495631_0486863 3300046518 Bacteria 525
236 Ga0495652_0086128 3300046529 Bacteria 2580
237 Ga0495652_0927833 3300046529 Bacteria 573
238 Ga0495640_0098782 3300046533 Bacteria 1918
239 Ga0495586_0007328 3300046535 Bacteria 5888
240 Ga0495587_0000789 3300046536 Bacteria 21156
241 Ga0495645_0021815 3300046543 Bacteria 4629
242 Ga0495645_0184457 3300046543 Bacteria 1427
243 Ga0495667_0004879 3300046559 Bacteria 9068
244 Ga0495634_0437966 3300046642 Unclassified 772
245 Ga0495635_0015470 3300046663 Bacteria 5334
246 Ga0495657_0004003 3300046675 Bacteria 11826
247 Ga0495599_0003713 3300046678 Bacteria 8948
248 Ga0495623_0022240 3300046679 Bacteria 4095
249 Ga0495646_0015592 3300046680 Bacteria 4821
250 Ga0495647_0186262 3300046681 Bacteria 905
251 Ga0495613_0381205 3300046689 Bacteria 964
252 Ga0495624_0299465 3300046690 Bacteria 970
253 Ga0495589_0183997 3300046794 Bacteria 990
254 Ga0495600_0087597 3300046809 Bacteria 2031
255 Ga0495604_0010602 3300047317 Bacteria 7308
256 Ga0495604_0459849 3300047317 Bacteria 830
257 Ga0495674_0050112 3300047319 Bacteria 3685
258 Ga0495674_0338990 3300047319 Bacteria 1222
259 Ga0495680_0108951 3300047322 Bacteria 2055
260 Ga0495680_0227718 3300047322 Bacteria 1328
261 Ga0495675_0053782 3300047444 Bacteria 2555
262 Ga0495593_0040321 3300047673 Bacteria 2514
263 Ga0495593_0140729 3300047673 Unclassified 1222
264 Ga0495602_0051885 3300048088 Bacteria 3648
265 Ga0495602_0575511 3300048088 Bacteria 777
266 Ga0496100_0001666 3300048903 Bacteria 11022
267 Ga0496100_0015882 3300048903 Bacteria 4408
268 Ga0496100_0395275 3300048903 Bacteria 1052
269 Ga0496101_0001037 3300048904 Bacteria 16401
270 Ga0496102_0008876 3300048905 Bacteria 8628
271 Ga0496102_0203145 3300048905 Unclassified 1868
272 Ga0496102_0431299 3300048905 Bacteria 1238
273 Ga0496102_0855612 3300048905 Bacteria 831
274 Ga0496104_0018257 3300048907 Bacteria 6399
275 Ga0496104_0566662 3300048907 Unclassified 1046
276 Ga0496104_0660688 3300048907 Bacteria 954
277 Ga0496104_1307823 3300048907 Unclassified 628
278 Ga0496105_0004561 3300048908 Bacteria 10432
279 Ga0496105_0301487 3300048908 Unclassified 1288
280 Ga0496106_0016464 3300048909 Bacteria 5470
281 Ga0496106_0051586 3300048909 Bacteria 3102
282 Ga0496106_0778726 3300048909 Unclassified 759
283 Ga0496107_0035841 3300048910 Bacteria 3558
284 Ga0496107_0111107 3300048910 Bacteria 2014
285 Ga0496107_0216104 3300048910 Bacteria 1426
286 Ga0496108_0017308 3300048911 Bacteria 5895
287 Ga0496108_0104912 3300048911 Bacteria 2413
288 Ga0496109_0418156 3300048912 Bacteria 1266
289 Ga0496110_0016195 3300048913 Bacteria 6218
290 Ga0496111_0054501 3300048914 Bacteria 2891
291 Ga0496112_0127134 3300048915 Bacteria 2519
292 Ga0496112_0659719 3300048915 Bacteria 975
293 Ga0496113_0138598 3300048916 Bacteria 1913
294 Ga0496113_0750652 3300048916 Unclassified 777
295 Ga0496114_0004415 3300048917 Bacteria 10917
296 Ga0496114_0028188 3300048917 Bacteria 4606
297 Ga0496114_0792254 3300048917 Unclassified 826
298 Ga0496114_1098740 3300048917 Unclassified 680
299 Ga0496114_1135755 3300048917 Bacteria 667
300 Ga0496115_0012480 3300048918 Bacteria 6396
301 Ga0496115_0053387 3300048918 Bacteria 3243
302 Ga0496115_0077194 3300048918 Bacteria 2708
303 Ga0496115_0159783 3300048918 Bacteria 1862
304 Ga0496115_0419842 3300048918 Bacteria 1084
305 Ga0496115_0460834 3300048918 Bacteria 1025
306 Ga0496119_0038357 3300048922 Bacteria 3097
307 Ga0496120_0052590 3300048923 Bacteria 2319
308 Ga0496121_0001427 3300048924 Bacteria 40370
309 Ga0496121_0011460 3300048924 Bacteria 9843
310 Ga0496125_0067152 3300048928 Bacteria 2828
311 Ga0496126_0029098 3300048929 Bacteria 5251
312 Ga0496126_0401537 3300048929 Bacteria 1111
313 Ga0501071_1611960 3300049587 Bacteria 501
314 Ga0501079_0614055 3300049741 Bacteria 856
315 Ga0501083_0127817 3300049744 Bacteria 1666
316 nmdc:mga03683_563118_c1 3300050489 Bacteria 555
317 nmdc:mga03n38_698587_c1 3300050490 Unclassified 584
318 nmdc:mga00v17_123656_c1 3300050491 Bacteria 1649
319 nmdc:mga06z11_438596_c1 3300050494 Bacteria 788
320 nmdc:mga08y16_246020_c1 3300050511 Bacteria 1848
321 nmdc:mga0n895_100378_c1 3300050512 Bacteria 2903
322 nmdc:mga0a205_137759_c1 3300050515 Bacteria 2341
323 Ga0495601_0092067 3300053077 Bacteria 1952
324 Ga0495601_0142376 3300053077 Bacteria 1564
325 Ga0495612_0013082 3300053078 Bacteria 3342
326 Ga0495595_0026689 3300053084 Bacteria 2567
327 Ga0495595_0032060 3300053084 Bacteria 2365
328 Ga0495619_0015112 3300053085 Bacteria 4879
329 Ga0495619_0170007 3300053085 Bacteria 1507
330 Ga0500652_000546 3300053131 Bacteria 13134
331 Ga0500658_0053302 3300053134 Bacteria 1659
332 Ga0500559_0508287 3300053136 Bacteria 553
333 Ga0500588_0000070 3300053146 Bacteria 15026
334 Ga0500616_0220378 3300053153 Bacteria 828
335 Ga0501082_0755929 3300060353 Bacteria 851
336 rootH2_10088056
337 JGI25153J46596_10032940
338 rootL2_10309207
339 rootH1_10308701
340 rootH1_10340903
341 Ga0055535_1026428
342 Ga0055529_1004789
343 Ga0055526_1018945
344 Ga0055537_1000005
345 Ga0055524_1004182
346 Ga0055524_1081161
347 Ga0055534_1000127
348 Ga0055528_1000063
349 Ga0055530_10000085
350 Ga0055531_10001673
351 Ga0065165_1000414
352 Ga0070676_11075099
353 Ga0070690_100706065
354 Ga0070670_101049204
355 Ga0070677_10675820
356 Ga0070666_10707459
357 Ga0070680_100163741
358 Ga0070680_101567504
359 Ga0070682_100217738
360 Ga0070682_100253163
361 Ga0070682_101000624
362 Ga0070660_100628306
363 Ga0070691_10236617
364 Ga0070661_100595732
365 Ga0070671_100095816
366 Ga0070671_100104266
367 Ga0070674_100210494
368 Ga0070710_10109446
369 Ga0070711_100221127
370 Ga0070711_100580043
371 Ga0070705_100736665
372 Ga0070700_100249980
373 Ga0070700_100274770
374 Ga0070663_101623692
375 Ga0070678_100232533
376 Ga0070678_100359196
377 Ga0070662_100230124
378 Ga0070681_10883438
379 Ga0068867_100244031
380 Ga0068853_102097031
381 Ga0070672_101278252
382 Ga0070695_100504852
383 Ga0070695_100775502
384 Ga0070693_100012005
385 Ga0070693_100449225
386 Ga0070665_102415871
387 Ga0070665_102456461
388 Ga0070664_100197764
389 Ga0068864_100721469
390 Ga0068866_10415002
391 Ga0068863_100056085
392 Ga0068862_100894801
393 Ga0075365_10645772
394 Ga0075364_10297373
395 Ga0075367_10720052
396 Ga0097621_100191313
397 Ga0097621_101239641
398 Ga0097621_101435892
399 Ga0097621_102138584
400 Ga0068871_100019344
401 Ga0068871_100117668
402 Ga0068871_100318579
403 Ga0068871_100729545
404 Ga0068871_101153230
405 Ga0075428_100622405
406 Ga0075431_100209398
407 Ga0075433_10017141
408 Ga0075434_100024715
409 Ga0075434_100212226
410 Ga0068865_100238045
411 Ga0068865_100479819
412 Ga0075436_100878475
413 Ga0105240_10000115
414 Ga0105240_12567477
415 Ga0111539_10086028
416 Ga0105245_10034576
417 Ga0105245_10110740
418 Ga0105245_11451914
419 Ga0105247_11223535
420 Ga0105243_10244928
421 Ga0105243_10929634
422 Ga0105243_11649630
423 Ga0105241_10132492
424 Ga0105242_10083958
425 Ga0105242_10545496
426 Ga0105248_10017412
427 Ga0105248_10039894
428 Ga0105248_10653408
429 Ga0105248_12231352
430 Ga0105237_10749337
431 Ga0105238_10520081
432 Ga0105238_11216852
433 Ga0105239_10206423
434 Ga0105239_10481381
435 Ga0105239_11243928
436 Ga0105246_10427733
437 Ga0157370_10220488
438 Ga0157374_11934180
439 Ga0157378_10186479
440 Ga0157378_10835310
441 Ga0163162_10054199
442 Ga0163162_10483511
443 Ga0157380_10378616
444 Ga0157377_10645693
445 Ga0157376_10139715
446 Ga0157376_10260507
447 Ga0157376_10359069
448 Ga0163161_10032455
449 Ga0163161_10034854
450 Ga0209258_102814
451 Ga0209565_1000074
452 Ga0209455_1001534
453 Ga0209673_1000129
454 Ga0209675_1000072
455 Ga0209564_1000160
456 Ga0209758_1001079
457 Ga0209050_1000034
458 Ga0209256_1000125
459 Ga0209256_1000146
460 Ga0209257_1000052
461 Ga0209257_1000100
462 Ga0209257_1011367
463 Ga0207692_10210710
464 Ga0207692_10283808
465 Ga0207680_10900082
466 Ga0207685_10210128
467 Ga0207654_10467527
468 Ga0207707_10180230
469 Ga0207707_10218064
470 Ga0207695_10000116
471 Ga0207663_10322942
472 Ga0207657_10441459
473 Ga0207652_10277703
474 Ga0207687_10027802
475 Ga0207687_11056927
476 Ga0207700_11209557
477 Ga0207644_10990428
478 Ga0207644_11248859
479 Ga0207706_10080149
480 Ga0207686_10097083
481 Ga0207686_10892387
482 Ga0207709_11131032
483 Ga0207669_10187554
484 Ga0207704_10534632
485 Ga0207704_11147033
486 Ga0207665_10382394
487 Ga0207691_10799722
488 Ga0207711_10013223
489 Ga0207711_10446267
490 Ga0207651_10982302
491 Ga0207651_11411780
492 Ga0207658_10180925
493 Ga0207677_12241543
494 Ga0207703_10304394
495 Ga0207678_10017033
496 Ga0207708_10425045
497 Ga0207708_10467888
498 Ga0207641_10182504
499 Ga0207675_100513441
500 Ga0207683_10057789
501 Ga0207683_10489607
502 Ga0207428_10179995
503 Ga0268266_10000003
504 Ga0268266_10290464
505 Ga0268266_11041090
506 Ga0268265_11085253
507 Ga0268265_11365736
508 Ga0265325_10007227
509 Ga0265325_10238480
510 Ga0265331_10326680
511 Ga0307509_10020609
512 Ga0307509_10468540
513 Ga0307416_100960561
514 Ga0373950_0138436
515 Ga0373958_0009154
516 Ga0373938_0053811
517 Ga0373929_0001716
518 Ga0373934_0039890
519 Ga0373940_0032211
520 Ga0373944_0125292
521 Ga0373951_0104333
522 Ga0373951_0109965
523 Ga0373923_0211088
524 Ga0373941_0491737
525 Ga0373953_0045821
526 Ga0373954_0160005
527 Ga0373956_0001709
528 Ga0373960_0029630
529 Ga0373943_0026041
530 Ga0373943_0624267
531 Ga0373946_0150984
532 Ga0373955_0047021
533 Ga0373942_0008860
534 Ga0373961_0031127
535 Ga0373962_0202186
536 Ga0373931_0003638
537 Ga0373931_0009778
538 Ga0373931_0067587
539 Ga0373931_0445544
540 Ga0373935_0174954
541 Ga0373927_0270578
542 Ga0373927_0608462
543 Ga0373933_0337171
544 Ga0373933_0671302
545 Ga0373947_0018023
546 Ga0373947_0053316
547 Ga0373947_0224498
548 Ga0373937_0374761
549 Ga0373925_0072489
550 Ga0373925_0098481
551 Ga0373925_0830001
552 Ga0436365_0211847
553 Ga0495592_0008274
554 Ga0495592_0268512
555 Ga0495603_0170817
556 Ga0495629_0414726
557 Ga0495638_0397934
558 Ga0495651_0007988
559 Ga0495653_0302605
560 Ga0495664_0031346
561 Ga0495664_0129665
562 Ga0495594_0116188
563 Ga0495606_0000194
564 Ga0495608_0009002
565 Ga0495618_0156829
566 Ga0495620_0000016
567 Ga0495628_0081667
568 Ga0495628_0370127
569 Ga0495630_0043991
570 Ga0495631_0486863
571 Ga0495652_0086128
572 Ga0495652_0927833
573 Ga0495640_0098782
574 Ga0495586_0007328
575 Ga0495587_0000789
576 Ga0495645_0021815
577 Ga0495645_0184457
578 Ga0495667_0004879
579 Ga0495634_0437966
580 Ga0495635_0015470
581 Ga0495657_0004003
582 Ga0495599_0003713
583 Ga0495623_0022240
584 Ga0495646_0015592
585 Ga0495647_0186262
586 Ga0495613_0381205
587 Ga0495624_0299465
588 Ga0495589_0183997
589 Ga0495600_0087597
590 Ga0495604_0010602
591 Ga0495604_0459849
592 Ga0495674_0050112
593 Ga0495674_0338990
594 Ga0495680_0108951
595 Ga0495680_0227718
596 Ga0495675_0053782
597 Ga0495593_0040321
598 Ga0495593_0140729
599 Ga0495602_0051885
600 Ga0495602_0575511
601 Ga0496100_0001666
602 Ga0496100_0015882
603 Ga0496100_0395275
604 Ga0496101_0001037
605 Ga0496102_0008876
606 Ga0496102_0203145
607 Ga0496102_0431299
608 Ga0496102_0855612
609 Ga0496104_0018257
610 Ga0496104_0566662
611 Ga0496104_0660688
612 Ga0496104_1307823
613 Ga0496105_0004561
614 Ga0496105_0301487
615 Ga0496106_0016464
616 Ga0496106_0051586
617 Ga0496106_0778726
618 Ga0496107_0035841
619 Ga0496107_0111107
620 Ga0496107_0216104
621 Ga0496108_0017308
622 Ga0496108_0104912
623 Ga0496109_0418156
624 Ga0496110_0016195
625 Ga0496111_0054501
626 Ga0496112_0127134
627 Ga0496112_0659719
628 Ga0496113_0138598
629 Ga0496113_0750652
630 Ga0496114_0004415
631 Ga0496114_0028188
632 Ga0496114_0792254
633 Ga0496114_1098740
634 Ga0496114_1135755
635 Ga0496115_0012480
636 Ga0496115_0053387
637 Ga0496115_0077194
638 Ga0496115_0159783
639 Ga0496115_0419842
640 Ga0496115_0460834
641 Ga0496119_0038357
642 Ga0496120_0052590
643 Ga0496121_0001427
644 Ga0496121_0011460
645 Ga0496125_0067152
646 Ga0496126_0029098
647 Ga0496126_0401537
648 Ga0501071_1611960
649 Ga0501079_0614055
650 Ga0501083_0127817
651 nmdc:mga03683_563118_c1
652 nmdc:mga03n38_698587_c1
653 nmdc:mga00v17_123656_c1
654 nmdc:mga06z11_438596_c1
655 nmdc:mga08y16_246020_c1
656 nmdc:mga0n895_100378_c1
657 nmdc:mga0a205_137759_c1
658 Ga0495601_0092067
659 Ga0495601_0142376
660 Ga0495612_0013082
661 Ga0495595_0026689
662 Ga0495595_0032060
663 Ga0495619_0015112
664 Ga0495619_0170007
665 Ga0500652_000546
666 Ga0500658_0053302
667 Ga0500559_0508287
668 Ga0500588_0000070
669 Ga0500616_0220378
670 Ga0501082_0755929

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01124

MAPEG

MAPEG family

8

133

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i1m-assembly2.cif.gz_B crystal structure of the legionella pneumophila gap domain of lepb 0.8471 86 129
4bpm-assembly1.cif.gz_A crystal structure of a human integral membrane enzyme 0.8 4 131
3dww-assembly1.cif.gz_C electron crystallographic structure of human microsomal prostaglandin e synthase 1 0.769 5 131
4bpm-assembly1.cif.gz_A crystal structure of a human integral membrane enzyme 0.7676 4 131
5bqg-assembly1.cif.gz_A crystal structure of mpges-1 bound to an inhibitor 0.7523 5 131
ID Description Score Start End Superfamily
4wabA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8102 5 131 1.20.120.550
4yl1A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8082 5 131 1.20.120.550
af_B0R1E9_1_152_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7959 5 132 1.20.120.550
4wabA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.772 5 131 1.20.120.550
4yl1A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.77 5 131 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A533JAF3-F1-model_v4 deleted 0.9852 47 132
AF-A0A1S8FIP3-F1-model_v4 MAPEG family protein 0.9815 3 132 GO:0016020
AF-A0A7S7Z5G2-F1-model_v4 MAPEG family protein 0.9796 3 131 GO:0016020
AF-A0A2M8R4K8-F1-model_v4 MAPEG family protein 0.9794 3 132 GO:0016020
AF-A0A4R3U1U7-F1-model_v4 Putative MAPEG superfamily protein 0.9787 3 132 GO:0016020

Map