F412072

General Info

Members Datasets Scaffolds Average Seq Length
335 209 670 143

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10021427|Ga0065714_100214273
Length 169
Sequence MAGETVITVVGNLTSDPELRYTQNGLAVANFTIASTPRNFDRATSEWKDGEALFLRASVWREFAEHVAGSLTKGSRVIASGRLKQRSYETKEGEKRTSMELEIDEIGPSLRYATASLTRAQSSSAPRGGAPVAQQQGNDEPWAPSAPAANTGGGDVWNTPGNFSDETPF

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
47 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
51 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
98 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
99 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
100 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
101 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
102 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
103 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
104 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
148 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
183 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
184 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
185 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
186 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
187 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
191 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
192 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
193 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
194 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
195 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
196 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
197 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
198 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
199 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
200 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
201 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
205 2517572101 Frankia sp. DC12 Isolate Nodule
206 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
207 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
208 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
209 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.96
Metatranscriptomes 9.55
Isolates 1.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.22
Nodule 0.3
Rhizoplane 7.76
Rhizosphere 67.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10021427 3300005288 Bacteria 1095
2 Ga0055540_1030061 3300003792 Bacteria 1265
3 Ga0058863_11767744 3300004799 Bacteria 1331
4 Ga0058861_11718171 3300004800 Bacteria 917
5 Ga0058862_12317645 3300004803 Bacteria 695
6 Ga0065714_10054755 3300005288 Bacteria 577
7 Ga0070683_100029247 3300005329 Bacteria 4986
8 Ga0070680_100294527 3300005336 Bacteria 1375
9 Ga0070668_100016009 3300005347 Bacteria 5611
10 Ga0070674_100151053 3300005356 Bacteria 1753
11 Ga0070667_101029500 3300005367 Bacteria 769
12 Ga0070714_100363560 3300005435 Bacteria 1361
13 Ga0070714_100792215 3300005435 Bacteria 917
14 Ga0070710_10384596 3300005437 Bacteria 937
15 Ga0070708_101454638 3300005445 Bacteria 639
16 Ga0070663_100646765 3300005455 Bacteria 894
17 Ga0070678_100586472 3300005456 Bacteria 994
18 Ga0070681_10867453 3300005458 Bacteria 821
19 Ga0070679_100262114 3300005530 Bacteria 1683
20 Ga0070679_100680310 3300005530 Bacteria 971
21 Ga0070684_100652546 3300005535 Bacteria 980
22 Ga0068853_100070238 3300005539 Bacteria 3048
23 Ga0068853_100574288 3300005539 Bacteria 1069
24 Ga0070665_100892223 3300005548 Bacteria 902
25 Ga0068855_100163242 3300005563 Bacteria 2527
26 Ga0081455_10097205 3300005937 Bacteria 2373
27 Ga0075365_10021198 3300006038 Bacteria 4049
28 Ga0075365_10037259 3300006038 Bacteria 3156
29 Ga0075365_10148448 3300006038 Bacteria 1630
30 Ga0075365_10595517 3300006038 Bacteria 782
31 Ga0075363_100006695 3300006048 Bacteria 5257
32 Ga0075363_100039811 3300006048 Bacteria 2475
33 Ga0075363_100077465 3300006048 Bacteria 1814
34 Ga0075363_100309080 3300006048 Bacteria 918
35 Ga0075364_10000313 3300006051 Bacteria 23763
36 Ga0075364_10204582 3300006051 Bacteria 1338
37 Ga0075364_10447534 3300006051 Bacteria 882
38 Ga0075362_10008094 3300006177 Bacteria 4008
39 Ga0075362_10021215 3300006177 Bacteria 2723
40 Ga0075362_10079406 3300006177 Bacteria 1510
41 Ga0075367_10076291 3300006178 Bacteria 2022
42 Ga0075367_10141968 3300006178 Bacteria 1488
43 Ga0075367_10229756 3300006178 Bacteria 1162
44 Ga0075369_10045602 3300006186 Bacteria 1885
45 Ga0075369_10049855 3300006186 Bacteria 1809
46 Ga0075369_10064380 3300006186 Bacteria 1605
47 Ga0075370_10028113 3300006353 Bacteria 3124
48 Ga0075370_10066386 3300006353 Bacteria 2058
49 Ga0075435_101246876 3300007076 Bacteria 651
50 Ga0105240_10645391 3300009093 Bacteria 1161
51 Ga0105247_10000024 3300009101 Bacteria 210946
52 Ga0114129_10303113 3300009147 Bacteria 2128
53 Ga0105242_10360235 3300009176 Bacteria 1346
54 Ga0105248_10077715 3300009177 Bacteria 3731
55 Ga0105237_10014123 3300009545 Bacteria 8357
56 Ga0105249_10564123 3300009553 Bacteria 1190
57 Ga0105239_10017001 3300010375 Bacteria 8041
58 Ga0157370_10289587 3300013104 Bacteria 1513
59 Ga0157369_10047677 3300013105 Bacteria 4650
60 Ga0157369_10130227 3300013105 Bacteria 2666
61 Ga0171462_1002 3300013250 Bacteria 1052134
62 Ga0157372_10531557 3300013307 Bacteria 1371
63 Ga0157372_10699347 3300013307 Bacteria 1180
64 Ga0157375_10600056 3300013308 Bacteria 1260
65 Ga0163163_10058202 3300014325 Bacteria 3821
66 Ga0157380_10105523 3300014326 Bacteria 2355
67 Ga0183365_11489 3300015684 Bacteria 849
68 Ga0183360_11206 3300015689 Bacteria 876
69 Ga0163161_10084540 3300017792 Bacteria 2340
70 Ga0197907_10961421 3300020069 Bacteria 1055
71 Ga0206355_1038144 3300020076 Bacteria 2000
72 Ga0206350_11586544 3300020080 Bacteria 634
73 Ga0206354_10214892 3300020081 Bacteria 868
74 Ga0206353_11965733 3300020082 Bacteria 634
75 Ga0209051_1000628 3300025303 Bacteria 40593
76 Ga0209051_1001487 3300025303 Bacteria 19629
77 Ga0207655_1012042 3300025728 Bacteria 5092
78 Ga0207710_10000045 3300025900 Bacteria 210957
79 Ga0207707_10376138 3300025912 Bacteria 1221
80 Ga0207671_10001793 3300025914 Bacteria 24059
81 Ga0207671_10029794 3300025914 Bacteria 4074
82 Ga0207663_10443748 3300025916 Bacteria 1000
83 Ga0207657_10602008 3300025919 Bacteria 857
84 Ga0207649_10829243 3300025920 Bacteria 723
85 Ga0207687_11219490 3300025927 Bacteria 647
86 Ga0207664_10334211 3300025929 Bacteria 1339
87 Ga0207664_10460971 3300025929 Bacteria 1135
88 Ga0207686_10124986 3300025934 Bacteria 1757
89 Ga0207709_10024067 3300025935 Bacteria 3473
90 Ga0207669_10329687 3300025937 Bacteria 1171
91 Ga0207704_10766090 3300025938 Bacteria 804
92 Ga0207711_10141995 3300025941 Bacteria 2161
93 Ga0207661_10083616 3300025944 Bacteria 2642
94 Ga0207667_10067699 3300025949 Bacteria 3719
95 Ga0207668_10009746 3300025972 Bacteria 5768
96 Ga0207639_10026359 3300026041 Bacteria 4225
97 Ga0207678_10091379 3300026067 Bacteria 2602
98 Ga0207702_10437195 3300026078 Bacteria 1267
99 Ga0207683_10120471 3300026121 Bacteria 2355
100 Ga0268266_10462884 3300028379 Bacteria 1207
101 Ga0307408_100243021 3300031548 Bacteria 1480
102 Ga0307405_10115789 3300031731 Bacteria 1824
103 Ga0307413_10170479 3300031824 Bacteria 1540
104 Ga0307413_10303332 3300031824 Bacteria 1212
105 Ga0307413_10602830 3300031824 Bacteria 899
106 Ga0307413_11559395 3300031824 Bacteria 585
107 Ga0307410_10111421 3300031852 Bacteria 1980
108 Ga0307410_10284288 3300031852 Bacteria 1299
109 Ga0307406_10001414 3300031901 Bacteria 13327
110 Ga0307406_10010729 3300031901 Bacteria 5177
111 Ga0307406_10024838 3300031901 Bacteria 3583
112 Ga0307406_10403323 3300031901 Bacteria 1084
113 Ga0307407_10005597 3300031903 Bacteria 5472
114 Ga0307407_10314357 3300031903 Bacteria 1097
115 Ga0307412_10397261 3300031911 Bacteria 1121
116 Ga0307412_10706518 3300031911 Bacteria 866
117 Ga0307409_101189411 3300031995 Bacteria 785
118 Ga0307416_100739760 3300032002 Bacteria 1075
119 Ga0307416_101179946 3300032002 Bacteria 871
120 Ga0307416_101610744 3300032002 Bacteria 754
121 Ga0307416_101611030 3300032002 Bacteria 754
122 Ga0307414_10488372 3300032004 Bacteria 1087
123 Ga0307414_10518867 3300032004 Bacteria 1057
124 Ga0307414_11256741 3300032004 Bacteria 686
125 Ga0307414_11260009 3300032004 Bacteria 685
126 Ga0307411_10272066 3300032005 Bacteria 1344
127 Ga0307411_11046457 3300032005 Bacteria 733
128 Ga0307415_100473497 3300032126 Bacteria 1088
129 Ga0307415_100673705 3300032126 Bacteria 930
130 Ga0307415_101015427 3300032126 Bacteria 772
131 Ga0307415_101389841 3300032126 Bacteria 668
132 Ga0307415_101619506 3300032126 Bacteria 622
133 Ga0373935_1169831 3300035692 Bacteria 573
134 Ga0316584_0335227 3300036712 Bacteria 1088
135 Ga0395899_0281452 3300037312 Bacteria 1131
136 Ga0395900_0506823 3300037418 Bacteria 1156
137 Ga0395900_0544392 3300037418 Bacteria 1106
138 Ga0395900_0778781 3300037418 Bacteria 886
139 Ga0395900_1136070 3300037418 Bacteria 698
140 Ga0395898_0018250 3300037466 Bacteria 7156
141 Ga0395898_0064168 3300037466 Bacteria 3562
142 Ga0395905_0225531 3300037471 Bacteria 1753
143 Ga0395905_0839327 3300037471 Bacteria 822
144 Ga0395901_0027819 3300038443 Bacteria 5814
145 Ga0395901_0362134 3300038443 Bacteria 1495
146 Ga0395901_0456410 3300038443 Bacteria 1306
147 Ga0395901_1013800 3300038443 Bacteria 805
148 Ga0436365_1428208 3300039437 Bacteria 1311
149 Ga0439436_0043522 3300041404 Bacteria 1281
150 Ga0439465_0007517 3300041413 Bacteria 3463
151 Ga0451791_1684085 3300041451 Bacteria 1587
152 Ga0451793_1458892 3300041452 Bacteria 3708
153 Ga0451797_1234086 3300041453 Bacteria 1019
154 Ga0451797_1323798 3300041453 Bacteria 989
155 Ga0451847_0641468 3300041503 Bacteria 927
156 Ga0439433_0054109 3300041999 Bacteria 949
157 Ga0466969_0039373 3300044656 Bacteria 2374
158 Ga0466966_0090065 3300044684 Bacteria 1905
159 Ga0466966_0154170 3300044684 Bacteria 1400
160 Ga0466966_0378584 3300044684 Bacteria 850
161 Ga0466961_0008394 3300044693 Bacteria 6579
162 Ga0466961_0576963 3300044693 Bacteria 677
163 Ga0466963_0005006 3300044694 Bacteria 7738
164 Ga0466963_0021561 3300044694 Bacteria 4067
165 Ga0466963_0071686 3300044694 Bacteria 2332
166 Ga0466963_0103053 3300044694 Bacteria 1955
167 Ga0466963_1203350 3300044694 Bacteria 532
168 Ga0466964_0248580 3300044706 Bacteria 876
169 Ga0466964_0383977 3300044706 Bacteria 730
170 Ga0466964_0434417 3300044706 Bacteria 693
171 Ga0466971_0150858 3300044719 Bacteria 1085
172 Ga0466968_0113082 3300044735 Bacteria 1222
173 Ga0466970_0171308 3300044765 Bacteria 1203
174 Ga0466970_0436895 3300044765 Bacteria 749
175 Ga0466957_0151843 3300044842 Bacteria 1498
176 Ga0466957_0206193 3300044842 Bacteria 1293
177 Ga0466957_0668787 3300044842 Bacteria 731
178 Ga0466957_0773460 3300044842 Bacteria 681
179 Ga0466960_0142271 3300044901 Bacteria 1275
180 Ga0466960_0357034 3300044901 Bacteria 834
181 Ga0466959_0129072 3300045049 Bacteria 1792
182 Ga0466959_0177294 3300045049 Bacteria 1492
183 Ga0466959_0362349 3300045049 Bacteria 988
184 Ga0466958_0023375 3300045836 Bacteria 3628
185 Ga0466958_0071254 3300045836 Bacteria 2128
186 Ga0466958_0099883 3300045836 Bacteria 1803
187 Ga0466967_0045031 3300045976 Bacteria 3832
188 Ga0466967_0379589 3300045976 Bacteria 1372
189 Ga0466967_0385519 3300045976 Bacteria 1361
190 Ga0466967_0481903 3300045976 Bacteria 1215
191 Ga0466967_1141301 3300045976 Bacteria 776
192 Ga0466967_1681348 3300045976 Bacteria 632
193 Ga0495638_0001483 3300046460 Bacteria 21203
194 Ga0495650_0337521 3300046471 Bacteria 500
195 Ga0495606_0007788 3300046507 Bacteria 9479
196 Ga0495644_0245833 3300046523 Bacteria 694
197 Ga0495648_0013828 3300046524 Bacteria 5945
198 Ga0495648_0048148 3300046524 Bacteria 2627
199 Ga0495654_0038605 3300046530 Bacteria 2387
200 Ga0495625_0194668 3300046660 Bacteria 1341
201 Ga0495625_0466949 3300046660 Bacteria 777
202 Ga0495635_0315581 3300046663 Bacteria 1047
203 Ga0495600_0518788 3300046809 Bacteria 731
204 Ga0495672_0002575 3300047320 Bacteria 16485
205 Ga0495672_0300691 3300047320 Bacteria 760
206 Ga0495673_0000444 3300047469 Bacteria 45563
207 Ga0495686_0001889 3300047472 Bacteria 20961
208 Ga0495686_0016616 3300047472 Bacteria 4986
209 Ga0496100_0002836 3300048903 Bacteria 8879
210 Ga0496100_0098449 3300048903 Bacteria 2010
211 Ga0496101_0000026 3300048904 Bacteria 199963
212 Ga0496101_0223236 3300048904 Bacteria 1463
213 Ga0496101_0532174 3300048904 Bacteria 929
214 Ga0496102_0000031 3300048905 Bacteria 217389
215 Ga0496102_0023598 3300048905 Bacteria 5465
216 Ga0496102_0449578 3300048905 Bacteria 1209
217 Ga0496103_0000025 3300048906 Bacteria 221144
218 Ga0496104_0122816 3300048907 Bacteria 2493
219 Ga0496105_0008082 3300048908 Bacteria 8178
220 Ga0496105_0371574 3300048908 Bacteria 1139
221 Ga0496105_0598209 3300048908 Bacteria 856
222 Ga0496106_0020434 3300048909 Bacteria 4914
223 Ga0496106_0021910 3300048909 Bacteria 4747
224 Ga0496107_0201986 3300048910 Bacteria 1477
225 Ga0496107_0301144 3300048910 Bacteria 1193
226 Ga0496108_0126453 3300048911 Bacteria 2195
227 Ga0496108_0332030 3300048911 Bacteria 1326
228 Ga0496111_0636945 3300048914 Bacteria 779
229 Ga0496112_0443310 3300048915 Bacteria 1236
230 Ga0496115_0009018 3300048918 Bacteria 7400
231 Ga0496116_0000084 3300048919 Bacteria 219579
232 Ga0496116_0000509 3300048919 Bacteria 52583
233 Ga0496117_0000018 3300048920 Bacteria 479613
234 Ga0496117_0004491 3300048920 Bacteria 15336
235 Ga0496117_0049339 3300048920 Bacteria 2995
236 Ga0496118_0000013 3300048921 Bacteria 574008
237 Ga0496118_0001558 3300048921 Bacteria 34068
238 Ga0496118_0077589 3300048921 Bacteria 2355
239 Ga0496118_0125775 3300048921 Bacteria 1660
240 Ga0496118_0136251 3300048921 Bacteria 1566
241 Ga0496119_0001033 3300048922 Bacteria 35640
242 Ga0496119_0058231 3300048922 Bacteria 2329
243 Ga0496119_0096382 3300048922 Bacteria 1669
244 Ga0496119_0211688 3300048922 Bacteria 997
245 Ga0496119_0349033 3300048922 Bacteria 717
246 Ga0496120_0000418 3300048923 Bacteria 67915
247 Ga0496120_0095618 3300048923 Bacteria 1579
248 Ga0496121_0000056 3300048924 Bacteria 296250
249 Ga0496122_0190170 3300048925 Bacteria 1213
250 Ga0496123_0174241 3300048926 Bacteria 1131
251 Ga0496124_0041534 3300048927 Bacteria 3968
252 Ga0496124_0051526 3300048927 Bacteria 3502
253 Ga0496124_0326971 3300048927 Bacteria 1095
254 Ga0496125_0000230 3300048928 Bacteria 114490
255 Ga0496125_0021720 3300048928 Bacteria 5975
256 Ga0496125_0079697 3300048928 Bacteria 2511
257 Ga0496126_0002664 3300048929 Bacteria 23643
258 Ga0496126_0229851 3300048929 Bacteria 1554
259 Ga0501306_020212 3300049127 Bacteria 924
260 Ga0501309_025965 3300049129 Bacteria 844
261 Ga0501305_019608 3300049161 Bacteria 988
262 Ga0501305_040731 3300049161 Bacteria 755
263 Ga0501305_047216 3300049161 Bacteria 715
264 Ga0501307_039225 3300049162 Bacteria 683
265 Ga0501311_071351 3300049527 Bacteria 577
266 Ga0501313_019807 3300049529 Bacteria 825
267 Ga0501315_012833 3300049531 Bacteria 1042
268 Ga0501316_003150 3300049532 Bacteria 1583
269 Ga0501317_003008 3300049533 Bacteria 1645
270 Ga0501317_004069 3300049533 Bacteria 1501
271 Ga0501317_010607 3300049533 Bacteria 1104
272 Ga0501318_007040 3300049534 Bacteria 1163
273 Ga0501318_008519 3300049534 Bacteria 1098
274 Ga0501318_011567 3300049534 Bacteria 999
275 Ga0501318_022690 3300049534 Bacteria 806
276 Ga0501321_007895 3300049537 Bacteria 1116
277 Ga0501323_005359 3300049539 Bacteria 1401
278 Ga0501323_039301 3300049539 Bacteria 689
279 Ga0501324_016437 3300049540 Bacteria 726
280 Ga0501324_017142 3300049540 Bacteria 716
281 Ga0501032_0002608 3300049569 Bacteria 14092
282 Ga0501034_0016640 3300049571 Bacteria 7540
283 Ga0501037_0000365 3300049573 Bacteria 37978
284 Ga0501038_0006076 3300049574 Bacteria 11170
285 Ga0501039_0000118 3300049575 Bacteria 54344
286 Ga0501042_0235440 3300049578 Bacteria 1321
287 Ga0501043_0000931 3300049579 Bacteria 25918
288 Ga0501067_0066310 3300049583 Bacteria 1998
289 Ga0501068_0463708 3300049584 Bacteria 820
290 Ga0501069_0224904 3300049585 Bacteria 1091
291 Ga0501070_0000548 3300049586 Bacteria 34385
292 Ga0501070_0685257 3300049586 Bacteria 811
293 Ga0501071_0213555 3300049587 Bacteria 1451
294 Ga0501073_0009392 3300049589 Bacteria 7222
295 Ga0501077_0093930 3300049593 Bacteria 1901
296 Ga0501217_293743 3300049661 Bacteria 535
297 Ga0501080_0120118 3300049742 Bacteria 2436
298 Ga0501035_1224428 3300049822 Bacteria 582
299 nmdc:mga03n38_103020_c1 3300050490 Bacteria 1379
300 nmdc:mga03n38_154911_c1 3300050490 Bacteria 1156
301 nmdc:mga03n38_4799_c1 3300050490 Bacteria 4526
302 nmdc:mga00v17_107361_c1 3300050491 Bacteria 1768
303 nmdc:mga00v17_38801_c1 3300050491 Bacteria 2421
304 nmdc:mga00v17_98144_c1 3300050491 Bacteria 1847
305 nmdc:mga0yw44_134912_c1 3300050492 Bacteria 1601
306 nmdc:mga0yw44_13507_c1 3300050492 Bacteria 4303
307 nmdc:mga0yw44_14023_c1 3300050492 Bacteria 4241
308 nmdc:mga06z11_11576_c1 3300050494 Bacteria 3809
309 nmdc:mga04h51_31182_c1 3300050495 Bacteria 1683
310 nmdc:mga07m45_16212_c1 3300050496 Bacteria 3989
311 nmdc:mga05p37_192583_c1 3300050507 Bacteria 2474
312 nmdc:mga0rr50_690441_c1 3300050513 Bacteria 871
313 nmdc:mga0sz30_22081_c1 3300050516 Bacteria 2580
314 nmdc:mga0sz30_5284_c3 3300050516 Bacteria 3437
315 Ga0500610_0010181 3300053079 Bacteria 4217
316 Ga0500643_009169 3300053087 Bacteria 3804
317 Ga0500556_0000008 3300053104 Bacteria 304943
318 Ga0500562_014754 3300053108 Bacteria 2002
319 Ga0500655_058928 3300053133 Bacteria 772
320 Ga0500568_0000003 3300053139 Bacteria 863587
321 Ga0500589_174940 3300053147 Bacteria 849
322 Ga0500604_0026727 3300053151 Bacteria 1666
323 Ga0500616_0006211 3300053153 Bacteria 7882
324 Ga0500616_0009295 3300053153 Bacteria 5988
325 Ga0500616_0036377 3300053153 Bacteria 2672
326 Ga0500627_0064033 3300053158 Bacteria 1621
327 Ga0587073_0019918 3300059492 Bacteria 1273
328 Ga0587107_014939 3300059652 Bacteria 1006
329 Ga0501082_0225445 3300060353 Bacteria 1631
330 Ga0466962_0044694 3300061719 Bacteria 2119
331 2517761650 2517572101 Bacteria 6884336
332 2939661425 2939660829 Bacteria 3784848
333 2964327900 2964326757 Bacteria 3290868
334 8003318667 8003314358 Bacteria 10575343
335 8056213892 8056207758 Bacteria 8639239
336 Ga0065714_10021427
337 Ga0055540_1030061
338 Ga0058863_11767744
339 Ga0058861_11718171
340 Ga0058862_12317645
341 Ga0065714_10054755
342 Ga0070683_100029247
343 Ga0070680_100294527
344 Ga0070668_100016009
345 Ga0070674_100151053
346 Ga0070667_101029500
347 Ga0070714_100363560
348 Ga0070714_100792215
349 Ga0070710_10384596
350 Ga0070708_101454638
351 Ga0070663_100646765
352 Ga0070678_100586472
353 Ga0070681_10867453
354 Ga0070679_100262114
355 Ga0070679_100680310
356 Ga0070684_100652546
357 Ga0068853_100070238
358 Ga0068853_100574288
359 Ga0070665_100892223
360 Ga0068855_100163242
361 Ga0081455_10097205
362 Ga0075365_10021198
363 Ga0075365_10037259
364 Ga0075365_10148448
365 Ga0075365_10595517
366 Ga0075363_100006695
367 Ga0075363_100039811
368 Ga0075363_100077465
369 Ga0075363_100309080
370 Ga0075364_10000313
371 Ga0075364_10204582
372 Ga0075364_10447534
373 Ga0075362_10008094
374 Ga0075362_10021215
375 Ga0075362_10079406
376 Ga0075367_10076291
377 Ga0075367_10141968
378 Ga0075367_10229756
379 Ga0075369_10045602
380 Ga0075369_10049855
381 Ga0075369_10064380
382 Ga0075370_10028113
383 Ga0075370_10066386
384 Ga0075435_101246876
385 Ga0105240_10645391
386 Ga0105247_10000024
387 Ga0114129_10303113
388 Ga0105242_10360235
389 Ga0105248_10077715
390 Ga0105237_10014123
391 Ga0105249_10564123
392 Ga0105239_10017001
393 Ga0157370_10289587
394 Ga0157369_10047677
395 Ga0157369_10130227
396 Ga0171462_1002
397 Ga0157372_10531557
398 Ga0157372_10699347
399 Ga0157375_10600056
400 Ga0163163_10058202
401 Ga0157380_10105523
402 Ga0183365_11489
403 Ga0183360_11206
404 Ga0163161_10084540
405 Ga0197907_10961421
406 Ga0206355_1038144
407 Ga0206350_11586544
408 Ga0206354_10214892
409 Ga0206353_11965733
410 Ga0209051_1000628
411 Ga0209051_1001487
412 Ga0207655_1012042
413 Ga0207710_10000045
414 Ga0207707_10376138
415 Ga0207671_10001793
416 Ga0207671_10029794
417 Ga0207663_10443748
418 Ga0207657_10602008
419 Ga0207649_10829243
420 Ga0207687_11219490
421 Ga0207664_10334211
422 Ga0207664_10460971
423 Ga0207686_10124986
424 Ga0207709_10024067
425 Ga0207669_10329687
426 Ga0207704_10766090
427 Ga0207711_10141995
428 Ga0207661_10083616
429 Ga0207667_10067699
430 Ga0207668_10009746
431 Ga0207639_10026359
432 Ga0207678_10091379
433 Ga0207702_10437195
434 Ga0207683_10120471
435 Ga0268266_10462884
436 Ga0307408_100243021
437 Ga0307405_10115789
438 Ga0307413_10170479
439 Ga0307413_10303332
440 Ga0307413_10602830
441 Ga0307413_11559395
442 Ga0307410_10111421
443 Ga0307410_10284288
444 Ga0307406_10001414
445 Ga0307406_10010729
446 Ga0307406_10024838
447 Ga0307406_10403323
448 Ga0307407_10005597
449 Ga0307407_10314357
450 Ga0307412_10397261
451 Ga0307412_10706518
452 Ga0307409_101189411
453 Ga0307416_100739760
454 Ga0307416_101179946
455 Ga0307416_101610744
456 Ga0307416_101611030
457 Ga0307414_10488372
458 Ga0307414_10518867
459 Ga0307414_11256741
460 Ga0307414_11260009
461 Ga0307411_10272066
462 Ga0307411_11046457
463 Ga0307415_100473497
464 Ga0307415_100673705
465 Ga0307415_101015427
466 Ga0307415_101389841
467 Ga0307415_101619506
468 Ga0373935_1169831
469 Ga0316584_0335227
470 Ga0395899_0281452
471 Ga0395900_0506823
472 Ga0395900_0544392
473 Ga0395900_0778781
474 Ga0395900_1136070
475 Ga0395898_0018250
476 Ga0395898_0064168
477 Ga0395905_0225531
478 Ga0395905_0839327
479 Ga0395901_0027819
480 Ga0395901_0362134
481 Ga0395901_0456410
482 Ga0395901_1013800
483 Ga0436365_1428208
484 Ga0439436_0043522
485 Ga0439465_0007517
486 Ga0451791_1684085
487 Ga0451793_1458892
488 Ga0451797_1234086
489 Ga0451797_1323798
490 Ga0451847_0641468
491 Ga0439433_0054109
492 Ga0466969_0039373
493 Ga0466966_0090065
494 Ga0466966_0154170
495 Ga0466966_0378584
496 Ga0466961_0008394
497 Ga0466961_0576963
498 Ga0466963_0005006
499 Ga0466963_0021561
500 Ga0466963_0071686
501 Ga0466963_0103053
502 Ga0466963_1203350
503 Ga0466964_0248580
504 Ga0466964_0383977
505 Ga0466964_0434417
506 Ga0466971_0150858
507 Ga0466968_0113082
508 Ga0466970_0171308
509 Ga0466970_0436895
510 Ga0466957_0151843
511 Ga0466957_0206193
512 Ga0466957_0668787
513 Ga0466957_0773460
514 Ga0466960_0142271
515 Ga0466960_0357034
516 Ga0466959_0129072
517 Ga0466959_0177294
518 Ga0466959_0362349
519 Ga0466958_0023375
520 Ga0466958_0071254
521 Ga0466958_0099883
522 Ga0466967_0045031
523 Ga0466967_0379589
524 Ga0466967_0385519
525 Ga0466967_0481903
526 Ga0466967_1141301
527 Ga0466967_1681348
528 Ga0495638_0001483
529 Ga0495650_0337521
530 Ga0495606_0007788
531 Ga0495644_0245833
532 Ga0495648_0013828
533 Ga0495648_0048148
534 Ga0495654_0038605
535 Ga0495625_0194668
536 Ga0495625_0466949
537 Ga0495635_0315581
538 Ga0495600_0518788
539 Ga0495672_0002575
540 Ga0495672_0300691
541 Ga0495673_0000444
542 Ga0495686_0001889
543 Ga0495686_0016616
544 Ga0496100_0002836
545 Ga0496100_0098449
546 Ga0496101_0000026
547 Ga0496101_0223236
548 Ga0496101_0532174
549 Ga0496102_0000031
550 Ga0496102_0023598
551 Ga0496102_0449578
552 Ga0496103_0000025
553 Ga0496104_0122816
554 Ga0496105_0008082
555 Ga0496105_0371574
556 Ga0496105_0598209
557 Ga0496106_0020434
558 Ga0496106_0021910
559 Ga0496107_0201986
560 Ga0496107_0301144
561 Ga0496108_0126453
562 Ga0496108_0332030
563 Ga0496111_0636945
564 Ga0496112_0443310
565 Ga0496115_0009018
566 Ga0496116_0000084
567 Ga0496116_0000509
568 Ga0496117_0000018
569 Ga0496117_0004491
570 Ga0496117_0049339
571 Ga0496118_0000013
572 Ga0496118_0001558
573 Ga0496118_0077589
574 Ga0496118_0125775
575 Ga0496118_0136251
576 Ga0496119_0001033
577 Ga0496119_0058231
578 Ga0496119_0096382
579 Ga0496119_0211688
580 Ga0496119_0349033
581 Ga0496120_0000418
582 Ga0496120_0095618
583 Ga0496121_0000056
584 Ga0496122_0190170
585 Ga0496123_0174241
586 Ga0496124_0041534
587 Ga0496124_0051526
588 Ga0496124_0326971
589 Ga0496125_0000230
590 Ga0496125_0021720
591 Ga0496125_0079697
592 Ga0496126_0002664
593 Ga0496126_0229851
594 Ga0501306_020212
595 Ga0501309_025965
596 Ga0501305_019608
597 Ga0501305_040731
598 Ga0501305_047216
599 Ga0501307_039225
600 Ga0501311_071351
601 Ga0501313_019807
602 Ga0501315_012833
603 Ga0501316_003150
604 Ga0501317_003008
605 Ga0501317_004069
606 Ga0501317_010607
607 Ga0501318_007040
608 Ga0501318_008519
609 Ga0501318_011567
610 Ga0501318_022690
611 Ga0501321_007895
612 Ga0501323_005359
613 Ga0501323_039301
614 Ga0501324_016437
615 Ga0501324_017142
616 Ga0501032_0002608
617 Ga0501034_0016640
618 Ga0501037_0000365
619 Ga0501038_0006076
620 Ga0501039_0000118
621 Ga0501042_0235440
622 Ga0501043_0000931
623 Ga0501067_0066310
624 Ga0501068_0463708
625 Ga0501069_0224904
626 Ga0501070_0000548
627 Ga0501070_0685257
628 Ga0501071_0213555
629 Ga0501073_0009392
630 Ga0501077_0093930
631 Ga0501217_293743
632 Ga0501080_0120118
633 Ga0501035_1224428
634 nmdc:mga03n38_103020_c1
635 nmdc:mga03n38_154911_c1
636 nmdc:mga03n38_4799_c1
637 nmdc:mga00v17_107361_c1
638 nmdc:mga00v17_38801_c1
639 nmdc:mga00v17_98144_c1
640 nmdc:mga0yw44_134912_c1
641 nmdc:mga0yw44_13507_c1
642 nmdc:mga0yw44_14023_c1
643 nmdc:mga06z11_11576_c1
644 nmdc:mga04h51_31182_c1
645 nmdc:mga07m45_16212_c1
646 nmdc:mga05p37_192583_c1
647 nmdc:mga0rr50_690441_c1
648 nmdc:mga0sz30_22081_c1
649 nmdc:mga0sz30_5284_c3
650 Ga0500610_0010181
651 Ga0500643_009169
652 Ga0500556_0000008
653 Ga0500562_014754
654 Ga0500655_058928
655 Ga0500568_0000003
656 Ga0500589_174940
657 Ga0500604_0026727
658 Ga0500616_0006211
659 Ga0500616_0009295
660 Ga0500616_0036377
661 Ga0500627_0064033
662 Ga0587073_0019918
663 Ga0587107_014939
664 Ga0501082_0225445
665 Ga0466962_0044694
666 2517761650
667 2939661425
668 2964327900
669 8003318667
670 8056213892

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00436

SSB

Single-strand binding protein family

5

109

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bhw-assembly2.cif.gz_E b. subtilis ssba 0.9259 7 110
2cwa-assembly1.cif.gz_A crystal structure of the single-stranded dna binding protein from thermus thermophilus hb8 0.9257 7 112
6bhx-assembly1.cif.gz_C b. subtilis ssba with dna 0.9151 7 110
7r4w-assembly1.cif.gz_A single stranded dna binding protein ssb m5 from fervidobacterium gondwanense 0.9143 7 107
1z9f-assembly1.cif.gz_A crystal structure of single stranded dna-binding protein (tm0604) from thermotoga maritima at 2.60 a resolution 0.9104 7 110
ID Description Score Start End Superfamily
1z9fA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9104 7 110 2.40.50.140
5odnH00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8859 1 110 2.40.50.140
2iheA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8788 7 119 2.40.50.140
af_C4J9S9_72_176_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8723 7 116 2.40.50.140
5odnH00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8689 1 110 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A8B3SQ42-F1-model_v4 Single-stranded DNA-binding protein 0.8822 5 109 GO:0003697
GO:0006260
GO:0009295
AF-A0A849RPJ7-F1-model_v4 Single-stranded DNA-binding protein 0.8791 7 104 GO:0003697
AF-A0A5F1YIA1-F1-model_v4 Single-stranded DNA-binding protein (SSB) 0.8773 6 110 GO:0003697
GO:0006260
GO:0009295
AF-A0A6M3JK56-F1-model_v4 Putative single-stranded DNA-binding protein 0.8744 7 105 GO:0003697
GO:0006260
GO:0009295
AF-A0A7C5BEN0-F1-model_v4 Single-stranded DNA-binding protein 0.8709 7 104 GO:0003697
GO:0006260
GO:0009295

Map