F412081

General Info

Members Datasets Scaffolds Average Seq Length
335 210 670 284

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10106748|Ga0070658_101067482
Length 291
Sequence MRASLPSPSILLQYALPHRLLSRIVYWATRWTWRPWKNFLIRHVVKSYAVDMAQAAEPDAFAYASFNAFFTRALRAGARVAPADALAVACPADGRVSQLGAIESNGSDGGRIVQAKGQDFSVAELLADDAEAAKYAHGQFITVYLSPRDYHRVHAPLSGTLRETLHIPGRLFSVAPAAVAHVPRLFARNERLVCHFDGAHGPFAVILVGAMLVSGVETVWSGVEIPPYASAIQRKDWRSKNVRLERFDELGRFNMGSTVIVLLPAGSAALDVNLKSEDFVQVGQEIGRFIS

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
69 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
113 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
114 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
115 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
116 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
117 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
124 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
125 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
126 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
133 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
134 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
135 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
142 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
143 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
144 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
145 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
146 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
147 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
148 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
149 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
166 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
193 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
194 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
195 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
199 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
200 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
201 2734482264 Dyella sp. AD052 Isolate Unclassified
202 2738543009 Luteibacter sp. OK325 Isolate Unclassified
203 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
204 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
205 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
206 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
207 2919085039 Luteibacter sp. 1214 Isolate Unclassified
208 2919404418 Luteibacter sp. 3190 Isolate Unclassified
209 2941471342 Luteibacter sp. 621 Isolate Unclassified
210 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.52
Metatranscriptomes 0.6
Isolates 3.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.07
Nodule 0
Rhizoplane 2.69
Rhizosphere 82.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10106748 3300005327 Bacteria 2317
2 JGI24736J21556_1002124 3300001904 Bacteria 3519
3 JGI24738J21930_10004508 3300002075 Bacteria 3404
4 JGI25162J39368_1005567 3300002737 Bacteria 2413
5 Ga0006562J51391_1044937 3300003578 Bacteria 5090
6 Ga0006562J51391_1044938 3300003578 Bacteria 3850
7 Ga0055533_1008474 3300003756 Bacteria 1299
8 Ga0055543_1006859 3300004625 Bacteria 2702
9 Ga0065165_1000118 3300005262 Bacteria 134488
10 Ga0070658_10072510 3300005327 Bacteria 2822
11 Ga0070676_10057237 3300005328 Bacteria 2307
12 Ga0068869_100037777 3300005334 Bacteria 3435
13 Ga0068869_100098677 3300005334 Bacteria 2207
14 Ga0070666_10002860 3300005335 Bacteria 10423
15 Ga0070660_100198892 3300005339 Bacteria 1625
16 Ga0070660_100305405 3300005339 Bacteria 1305
17 Ga0070661_100013309 3300005344 Bacteria 5775
18 Ga0070661_100127591 3300005344 Bacteria 1909
19 Ga0070671_100437729 3300005355 Bacteria 1121
20 Ga0070673_100147659 3300005364 Bacteria 1989
21 Ga0070659_100032894 3300005366 Bacteria 4026
22 Ga0070667_100029138 3300005367 Bacteria 4597
23 Ga0070667_100029340 3300005367 Bacteria 4582
24 Ga0070667_100114606 3300005367 Bacteria 2340
25 Ga0070709_10036319 3300005434 Bacteria 3001
26 Ga0070708_100001161 3300005445 Bacteria 20274
27 Ga0070663_100055132 3300005455 Bacteria 2844
28 Ga0070663_100063104 3300005455 Bacteria 2674
29 Ga0070662_100070389 3300005457 Bacteria 2577
30 Ga0070685_10172989 3300005466 Bacteria 1385
31 Ga0070706_100000505 3300005467 Bacteria 45815
32 Ga0070707_100009576 3300005468 Bacteria 8999
33 Ga0070698_100115332 3300005471 Bacteria 2651
34 Ga0070699_100005779 3300005518 Bacteria 10820
35 Ga0070679_100388130 3300005530 Bacteria 1343
36 Ga0070684_100311074 3300005535 Bacteria 1446
37 Ga0068853_100000094 3300005539 Bacteria 60921
38 Ga0068853_100091303 3300005539 Bacteria 2678
39 Ga0068853_100171262 3300005539 Bacteria 1964
40 Ga0070665_100000077 3300005548 Bacteria 188308
41 Ga0070665_100008335 3300005548 Bacteria 10483
42 Ga0070665_100086173 3300005548 Bacteria 3146
43 Ga0068855_100041569 3300005563 Bacteria 5448
44 Ga0070664_100045831 3300005564 Bacteria 3692
45 Ga0068857_100035689 3300005577 Bacteria 4404
46 Ga0068857_100060060 3300005577 Bacteria 3378
47 Ga0068854_100174443 3300005578 Bacteria 1675
48 Ga0068854_100239586 3300005578 Bacteria 1444
49 Ga0068856_100099825 3300005614 Bacteria 2894
50 Ga0068856_100120882 3300005614 Bacteria 2620
51 Ga0068856_100430994 3300005614 Bacteria 1339
52 Ga0068852_100136727 3300005616 Bacteria 2263
53 Ga0068859_100001643 3300005617 Bacteria 22816
54 Ga0068864_100144111 3300005618 Bacteria 2152
55 Ga0068851_10012343 3300005834 Bacteria 4025
56 Ga0068851_10080103 3300005834 Bacteria 1704
57 Ga0068863_100002896 3300005841 Bacteria 17005
58 Ga0068863_100161401 3300005841 Bacteria 2147
59 Ga0068858_100036717 3300005842 Bacteria 4543
60 Ga0068862_100000453 3300005844 Bacteria 44400
61 Ga0081540_1010601 3300005983 Bacteria 6223
62 Ga0068871_100291024 3300006358 Bacteria 1431
63 Ga0097620_100001643 3300006931 Bacteria 22816
64 Ga0099794_10000121 3300007265 Bacteria 28467
65 Ga0105240_10003874 3300009093 Bacteria 23103
66 Ga0105240_10053682 3300009093 Bacteria 5057
67 Ga0105240_10148007 3300009093 Bacteria 2800
68 Ga0105245_10074350 3300009098 Bacteria 3092
69 Ga0105245_10245219 3300009098 Bacteria 1739
70 Ga0105247_10013414 3300009101 Bacteria 4914
71 Ga0105241_10003925 3300009174 Bacteria 11013
72 Ga0105241_10024856 3300009174 Bacteria 4450
73 Ga0105241_10069399 3300009174 Bacteria 2733
74 Ga0105241_10158752 3300009174 Bacteria 1857
75 Ga0105248_10035775 3300009177 Bacteria 5555
76 Ga0105237_10037182 3300009545 Bacteria 4922
77 Ga0105237_10109957 3300009545 Bacteria 2748
78 Ga0105237_10157844 3300009545 Bacteria 2266
79 Ga0105237_10253449 3300009545 Bacteria 1762
80 Ga0105238_10017602 3300009551 Bacteria 7264
81 Ga0105249_10059016 3300009553 Bacteria 3518
82 Ga0105239_10002497 3300010375 Bacteria 23416
83 Ga0105239_10005331 3300010375 Bacteria 15084
84 Ga0105239_10010054 3300010375 Bacteria 10607
85 Ga0105239_10019395 3300010375 Bacteria 7509
86 Ga0105239_10169252 3300010375 Bacteria 2443
87 Ga0105239_10299125 3300010375 Bacteria 1812
88 Ga0157373_10022734 3300013100 Bacteria 4547
89 Ga0157370_10000033 3300013104 Bacteria 138137
90 Ga0157370_10208598 3300013104 Bacteria 1811
91 Ga0157369_10000107 3300013105 Bacteria 117307
92 Ga0157369_10001162 3300013105 Bacteria 32848
93 Ga0157369_10013887 3300013105 Bacteria 9099
94 Ga0157374_10149526 3300013296 Bacteria 2270
95 Ga0157378_10000130 3300013297 Bacteria 72949
96 Ga0157372_10013923 3300013307 Bacteria 8594
97 Ga0157372_10168587 3300013307 Bacteria 2533
98 Ga0157372_10408967 3300013307 Bacteria 1581
99 Ga0163163_10000168 3300014325 Bacteria 68808
100 Ga0163163_10265638 3300014325 Bacteria 1767
101 Ga0182008_10018884 3300014497 Bacteria 3565
102 Ga0182008_10047342 3300014497 Bacteria 2136
103 Ga0157379_10100575 3300014968 Bacteria 2595
104 Ga0157379_10346212 3300014968 Bacteria 1360
105 Ga0157376_10096261 3300014969 Bacteria 2576
106 Ga0182006_1000027 3300015261 Bacteria 252946
107 Ga0182006_1000594 3300015261 Bacteria 26468
108 Ga0182007_10004103 3300015262 Bacteria 6700
109 Ga0182005_1000054 3300015265 Bacteria 112885
110 Ga0182005_1001774 3300015265 Bacteria 8305
111 Ga0182005_1003986 3300015265 Bacteria 4868
112 Ga0209674_100559 3300025226 Bacteria 14723
113 Ga0209147_105205 3300025229 Bacteria 1988
114 Ga0209437_101329 3300025233 Bacteria 6485
115 Ga0209148_1000843 3300025254 Bacteria 21760
116 Ga0209129_1001177 3300025258 Bacteria 15055
117 Ga0209758_1010423 3300025297 Bacteria 5563
118 Ga0209256_1023206 3300025299 Bacteria 1856
119 Ga0209051_1012258 3300025303 Bacteria 4157
120 Ga0209051_1012929 3300025303 Bacteria 4004
121 Ga0207656_10028570 3300025321 Bacteria 2290
122 Ga0207656_10093867 3300025321 Bacteria 1366
123 Ga0207680_10002020 3300025903 Bacteria 9512
124 Ga0207680_10168102 3300025903 Bacteria 1475
125 Ga0207647_10000221 3300025904 Bacteria 46891
126 Ga0207645_10065630 3300025907 Bacteria 2320
127 Ga0207684_10000062 3300025910 Bacteria 202863
128 Ga0207654_10000072 3300025911 Bacteria 66188
129 Ga0207707_10176145 3300025912 Bacteria 1868
130 Ga0207695_10001009 3300025913 Bacteria 49724
131 Ga0207695_10020104 3300025913 Bacteria 7660
132 Ga0207671_10023827 3300025914 Bacteria 4612
133 Ga0207671_10216769 3300025914 Bacteria 1498
134 Ga0207671_10409429 3300025914 Bacteria 1079
135 Ga0207657_10001113 3300025919 Bacteria 28509
136 Ga0207649_10003854 3300025920 Bacteria 8178
137 Ga0207646_10024748 3300025922 Bacteria 5495
138 Ga0207644_10325859 3300025931 Bacteria 1243
139 Ga0207704_10106448 3300025938 Bacteria 1884
140 Ga0207691_10041677 3300025940 Bacteria 4237
141 Ga0207711_10020414 3300025941 Bacteria 5523
142 Ga0207689_10043186 3300025942 Bacteria 3726
143 Ga0207667_10002516 3300025949 Bacteria 22863
144 Ga0207667_10015232 3300025949 Bacteria 8743
145 Ga0207667_10050445 3300025949 Bacteria 4390
146 Ga0207640_10019112 3300025981 Bacteria 4041
147 Ga0207640_10206679 3300025981 Bacteria 1492
148 Ga0207658_10037140 3300025986 Bacteria 3497
149 Ga0207658_10095779 3300025986 Bacteria 2313
150 Ga0207703_10054296 3300026035 Bacteria 3258
151 Ga0207639_10000722 3300026041 Bacteria 22566
152 Ga0207639_10008263 3300026041 Bacteria 7131
153 Ga0207639_10083068 3300026041 Bacteria 2541
154 Ga0207678_10051667 3300026067 Bacteria 3548
155 Ga0207678_10120908 3300026067 Bacteria 2235
156 Ga0207702_10024342 3300026078 Bacteria 5023
157 Ga0207641_10011821 3300026088 Bacteria 7163
158 Ga0207641_10608381 3300026088 Bacteria 1071
159 Ga0207676_10026841 3300026095 Bacteria 4284
160 Ga0207674_10023124 3300026116 Bacteria 6664
161 Ga0207674_10023495 3300026116 Bacteria 6602
162 Ga0207674_10047606 3300026116 Bacteria 4394
163 Ga0207698_10048695 3300026142 Bacteria 3219
164 Ga0209588_1000004 3300027671 Bacteria 228800
165 Ga0268266_10000001 3300028379 Bacteria 4040580
166 Ga0268266_10100934 3300028379 Bacteria 2543
167 Ga0268265_10000431 3300028380 Bacteria 44419
168 Ga0268264_10055359 3300028381 Bacteria 3314
169 Ga0307509_10230993 3300031507 Bacteria 1653
170 Ga0307508_10181993 3300031616 Bacteria 1704
171 Ga0307412_10001314 3300031911 Bacteria 13918
172 Ga0439436_0000010 3300041404 Bacteria 104480
173 Ga0451791_0806195 3300041451 Bacteria 2593
174 Ga0451791_1639907 3300041451 Bacteria 1891
175 Ga0451797_0083339 3300041453 Bacteria 1969
176 Ga0451807_0536136 3300041486 Bacteria 3959
177 Ga0451807_1517285 3300041486 Bacteria 2249
178 Ga0439445_0030127 3300042004 Bacteria 1405
179 Ga0450908_000074 3300042184 Bacteria 19802
180 Ga0466972_0002304 3300044658 Bacteria 9392
181 Ga0466982_0000048 3300044672 Bacteria 37037
182 Ga0453684_0000672 3300044712 Bacteria 122591
183 Ga0466970_0002763 3300044765 Bacteria 8470
184 Ga0451576_0000268 3300045051 Bacteria 127422
185 Ga0495617_000113 3300046452 Bacteria 56843
186 Ga0495617_000203 3300046452 Bacteria 37588
187 Ga0495638_0000522 3300046460 Bacteria 44904
188 Ga0495638_0045660 3300046460 Bacteria 2755
189 Ga0495650_0004556 3300046471 Bacteria 9459
190 Ga0495650_0046774 3300046471 Bacteria 1814
191 Ga0495584_0000769 3300046491 Bacteria 21244
192 Ga0495584_0069858 3300046491 Bacteria 1765
193 Ga0495585_0000019 3300046492 Bacteria 156966
194 Ga0495585_0001923 3300046492 Bacteria 15545
195 Ga0495607_0000019 3300046501 Bacteria 167319
196 Ga0495607_0000538 3300046501 Bacteria 37198
197 Ga0495606_0000181 3300046507 Bacteria 111247
198 Ga0495606_0007303 3300046507 Bacteria 9950
199 Ga0495606_0007724 3300046507 Bacteria 9525
200 Ga0495610_0001640 3300046512 Bacteria 19663
201 Ga0495616_0000047 3300046513 Bacteria 110592
202 Ga0495616_0001193 3300046513 Bacteria 18315
203 Ga0495620_0000524 3300046515 Bacteria 24699
204 Ga0495620_0004114 3300046515 Bacteria 8252
205 Ga0495631_0000184 3300046518 Bacteria 42706
206 Ga0495631_0000929 3300046518 Bacteria 18225
207 Ga0495632_0000080 3300046519 Bacteria 99523
208 Ga0495632_0006767 3300046519 Bacteria 7323
209 Ga0495632_0017694 3300046519 Bacteria 3928
210 Ga0495632_0208952 3300046519 Bacteria 886
211 Ga0495637_0056957 3300046520 Bacteria 1616
212 Ga0495643_0033272 3300046522 Bacteria 2854
213 Ga0495648_0000424 3300046524 Bacteria 46425
214 Ga0495648_0014506 3300046524 Bacteria 5765
215 Ga0495668_0008627 3300046616 Bacteria 6337
216 Ga0495611_0000001 3300046648 Bacteria 2628469
217 Ga0495611_0000103 3300046648 Bacteria 58463
218 Ga0495625_0000001 3300046660 Bacteria 1641829
219 Ga0495625_0017931 3300046660 Bacteria 5533
220 Ga0495625_0019904 3300046660 Bacteria 5193
221 Ga0495661_0000396 3300046665 Bacteria 46420
222 Ga0495670_0001939 3300046691 Bacteria 10200
223 Ga0495670_0002433 3300046691 Bacteria 9195
224 Ga0495671_0001113 3300046692 Bacteria 18576
225 Ga0495649_0046089 3300046694 Bacteria 2375
226 Ga0495589_0000272 3300046794 Bacteria 42126
227 Ga0495660_0000415 3300046810 Bacteria 36278
228 Ga0495660_0000466 3300046810 Bacteria 33526
229 Ga0495683_0001307 3300047323 Bacteria 16716
230 Ga0495679_000001 3300047446 Bacteria 1607568
231 Ga0495673_0000001 3300047469 Bacteria 1630730
232 Ga0495673_0000464 3300047469 Bacteria 44038
233 Ga0495673_0000937 3300047469 Bacteria 26461
234 Ga0495686_0000085 3300047472 Bacteria 198128
235 Ga0495686_0000255 3300047472 Bacteria 95600
236 Ga0495686_0006213 3300047472 Bacteria 9210
237 Ga0495686_0006900 3300047472 Bacteria 8596
238 Ga0495686_0077302 3300047472 Bacteria 2038
239 Ga0496100_0000244 3300048903 Bacteria 28418
240 Ga0496101_0003789 3300048904 Bacteria 9448
241 Ga0496102_0430990 3300048905 Bacteria 1238
242 Ga0496106_0002620 3300048909 Bacteria 13386
243 Ga0496116_0152467 3300048919 Bacteria 1281
244 Ga0496117_0032884 3300048920 Bacteria 3932
245 Ga0496118_0000749 3300048921 Bacteria 52548
246 Ga0496118_0002232 3300048921 Bacteria 26711
247 Ga0496118_0003119 3300048921 Bacteria 21231
248 Ga0496119_0016565 3300048922 Bacteria 5600
249 Ga0496120_0132024 3300048923 Bacteria 1278
250 Ga0496121_0000210 3300048924 Bacteria 128287
251 Ga0496121_0001261 3300048924 Bacteria 43799
252 Ga0496121_0005273 3300048924 Bacteria 16676
253 Ga0496121_0206750 3300048924 Bacteria 1394
254 Ga0496122_0035515 3300048925 Bacteria 4052
255 Ga0496122_0232471 3300048925 Bacteria 1047
256 Ga0496123_0003676 3300048926 Bacteria 16915
257 Ga0496123_0050420 3300048926 Bacteria 2781
258 Ga0496123_0119485 3300048926 Bacteria 1486
259 Ga0496124_0002009 3300048927 Bacteria 27702
260 Ga0496124_0002041 3300048927 Bacteria 27442
261 Ga0496126_0034876 3300048929 Bacteria 4720
262 Ga0495678_000207 3300049459 Bacteria 68441
263 Ga0495682_0002794 3300049460 Bacteria 8063
264 Ga0495682_0010089 3300049460 Bacteria 3666
265 Ga0501031_0008125 3300049568 Bacteria 6834
266 Ga0501031_0019414 3300049568 Bacteria 4429
267 Ga0501032_0028649 3300049569 Bacteria 3826
268 Ga0501032_0053459 3300049569 Bacteria 2719
269 Ga0501033_0001525 3300049570 Bacteria 20468
270 Ga0501033_0002150 3300049570 Bacteria 17042
271 Ga0501034_0002351 3300049571 Bacteria 23045
272 Ga0501034_0003794 3300049571 Bacteria 17052
273 Ga0501034_0350147 3300049571 Bacteria 1405
274 Ga0501036_0003706 3300049572 Bacteria 12246
275 Ga0501036_0021696 3300049572 Bacteria 5398
276 Ga0501036_0122592 3300049572 Bacteria 2195
277 Ga0501037_0000336 3300049573 Bacteria 39761
278 Ga0501037_0026462 3300049573 Bacteria 4289
279 Ga0501037_0032458 3300049573 Bacteria 3856
280 Ga0501038_0006022 3300049574 Bacteria 11222
281 Ga0501038_0020596 3300049574 Bacteria 5927
282 Ga0501038_0118095 3300049574 Bacteria 2190
283 Ga0501039_0030654 3300049575 Bacteria 4147
284 Ga0501039_0062081 3300049575 Bacteria 2895
285 Ga0501043_0006855 3300049579 Bacteria 9094
286 Ga0501043_0139992 3300049579 Bacteria 1895
287 Ga0501043_0157415 3300049579 Bacteria 1776
288 Ga0501046_0000908 3300049580 Bacteria 28913
289 Ga0501046_0013023 3300049580 Bacteria 7057
290 Ga0501047_0004939 3300049581 Bacteria 12520
291 Ga0501047_0009431 3300049581 Bacteria 9222
292 Ga0501047_0336889 3300049581 Bacteria 1346
293 Ga0501048_0044183 3300049582 Bacteria 3187
294 Ga0501067_0000630 3300049583 Bacteria 18924
295 Ga0501068_0055468 3300049584 Bacteria 2401
296 Ga0501069_0001151 3300049585 Bacteria 12806
297 Ga0501069_0023080 3300049585 Bacteria 3389
298 Ga0501069_0030478 3300049585 Bacteria 2962
299 Ga0501070_0020295 3300049586 Bacteria 5574
300 Ga0501070_0186585 3300049586 Bacteria 1705
301 Ga0501071_0130509 3300049587 Bacteria 1866
302 Ga0501072_0022095 3300049588 Bacteria 4935
303 Ga0501073_0001086 3300049589 Bacteria 19668
304 Ga0501073_0036781 3300049589 Bacteria 3477
305 Ga0501074_0046942 3300049590 Bacteria 3122
306 Ga0501079_0022694 3300049741 Bacteria 4815
307 Ga0501079_0030908 3300049741 Bacteria 4115
308 Ga0501080_0020021 3300049742 Bacteria 6193
309 Ga0501080_0037138 3300049742 Bacteria 4548
310 Ga0501080_0073038 3300049742 Bacteria 3191
311 Ga0501083_0001373 3300049744 Bacteria 16526
312 Ga0501035_0008886 3300049822 Bacteria 9350
313 Ga0501035_0029081 3300049822 Bacteria 5039
314 Ga0501044_0002330 3300049823 Bacteria 21651
315 Ga0501044_0010585 3300049823 Bacteria 10005
316 Ga0501044_0159731 3300049823 Bacteria 2231
317 Ga0500643_000002 3300053087 Bacteria 1277657
318 Ga0500651_0002382 3300053093 Bacteria 9897
319 Ga0500555_000077 3300053103 Bacteria 46807
320 Ga0500633_0008583 3300053160 Bacteria 2643
321 Ga0501084_0246197 3300054114 Bacteria 1509
322 Ga0501082_0027866 3300060353 Bacteria 4865
323 2595445729 2593339238 Bacteria 4182970
324 2595449422 2593339239 Bacteria 4124669
325 2721027968 2718218334 Bacteria 4765486
326 2735836463 2734482264 Unclassified 5014763
327 2739227440 2738543009 Bacteria 4944499
328 2842915580 2842914999 Bacteria 4419378
329 2842919594 2842918807 Bacteria 4289178
330 2884340106 2884338543 Bacteria 4610696
331 2904463764 2904463128 Bacteria 4775606
332 2919085806 2919085039 Bacteria 4532964
333 2919405938 2919404418 Bacteria 4232372
334 2941474591 2941471342 Bacteria 5018624
335 2953997942 2953994433 Bacteria 4303959
336 Ga0070658_10106748
337 JGI24736J21556_1002124
338 JGI24738J21930_10004508
339 JGI25162J39368_1005567
340 Ga0006562J51391_1044937
341 Ga0006562J51391_1044938
342 Ga0055533_1008474
343 Ga0055543_1006859
344 Ga0065165_1000118
345 Ga0070658_10072510
346 Ga0070676_10057237
347 Ga0068869_100037777
348 Ga0068869_100098677
349 Ga0070666_10002860
350 Ga0070660_100198892
351 Ga0070660_100305405
352 Ga0070661_100013309
353 Ga0070661_100127591
354 Ga0070671_100437729
355 Ga0070673_100147659
356 Ga0070659_100032894
357 Ga0070667_100029138
358 Ga0070667_100029340
359 Ga0070667_100114606
360 Ga0070709_10036319
361 Ga0070708_100001161
362 Ga0070663_100055132
363 Ga0070663_100063104
364 Ga0070662_100070389
365 Ga0070685_10172989
366 Ga0070706_100000505
367 Ga0070707_100009576
368 Ga0070698_100115332
369 Ga0070699_100005779
370 Ga0070679_100388130
371 Ga0070684_100311074
372 Ga0068853_100000094
373 Ga0068853_100091303
374 Ga0068853_100171262
375 Ga0070665_100000077
376 Ga0070665_100008335
377 Ga0070665_100086173
378 Ga0068855_100041569
379 Ga0070664_100045831
380 Ga0068857_100035689
381 Ga0068857_100060060
382 Ga0068854_100174443
383 Ga0068854_100239586
384 Ga0068856_100099825
385 Ga0068856_100120882
386 Ga0068856_100430994
387 Ga0068852_100136727
388 Ga0068859_100001643
389 Ga0068864_100144111
390 Ga0068851_10012343
391 Ga0068851_10080103
392 Ga0068863_100002896
393 Ga0068863_100161401
394 Ga0068858_100036717
395 Ga0068862_100000453
396 Ga0081540_1010601
397 Ga0068871_100291024
398 Ga0097620_100001643
399 Ga0099794_10000121
400 Ga0105240_10003874
401 Ga0105240_10053682
402 Ga0105240_10148007
403 Ga0105245_10074350
404 Ga0105245_10245219
405 Ga0105247_10013414
406 Ga0105241_10003925
407 Ga0105241_10024856
408 Ga0105241_10069399
409 Ga0105241_10158752
410 Ga0105248_10035775
411 Ga0105237_10037182
412 Ga0105237_10109957
413 Ga0105237_10157844
414 Ga0105237_10253449
415 Ga0105238_10017602
416 Ga0105249_10059016
417 Ga0105239_10002497
418 Ga0105239_10005331
419 Ga0105239_10010054
420 Ga0105239_10019395
421 Ga0105239_10169252
422 Ga0105239_10299125
423 Ga0157373_10022734
424 Ga0157370_10000033
425 Ga0157370_10208598
426 Ga0157369_10000107
427 Ga0157369_10001162
428 Ga0157369_10013887
429 Ga0157374_10149526
430 Ga0157378_10000130
431 Ga0157372_10013923
432 Ga0157372_10168587
433 Ga0157372_10408967
434 Ga0163163_10000168
435 Ga0163163_10265638
436 Ga0182008_10018884
437 Ga0182008_10047342
438 Ga0157379_10100575
439 Ga0157379_10346212
440 Ga0157376_10096261
441 Ga0182006_1000027
442 Ga0182006_1000594
443 Ga0182007_10004103
444 Ga0182005_1000054
445 Ga0182005_1001774
446 Ga0182005_1003986
447 Ga0209674_100559
448 Ga0209147_105205
449 Ga0209437_101329
450 Ga0209148_1000843
451 Ga0209129_1001177
452 Ga0209758_1010423
453 Ga0209256_1023206
454 Ga0209051_1012258
455 Ga0209051_1012929
456 Ga0207656_10028570
457 Ga0207656_10093867
458 Ga0207680_10002020
459 Ga0207680_10168102
460 Ga0207647_10000221
461 Ga0207645_10065630
462 Ga0207684_10000062
463 Ga0207654_10000072
464 Ga0207707_10176145
465 Ga0207695_10001009
466 Ga0207695_10020104
467 Ga0207671_10023827
468 Ga0207671_10216769
469 Ga0207671_10409429
470 Ga0207657_10001113
471 Ga0207649_10003854
472 Ga0207646_10024748
473 Ga0207644_10325859
474 Ga0207704_10106448
475 Ga0207691_10041677
476 Ga0207711_10020414
477 Ga0207689_10043186
478 Ga0207667_10002516
479 Ga0207667_10015232
480 Ga0207667_10050445
481 Ga0207640_10019112
482 Ga0207640_10206679
483 Ga0207658_10037140
484 Ga0207658_10095779
485 Ga0207703_10054296
486 Ga0207639_10000722
487 Ga0207639_10008263
488 Ga0207639_10083068
489 Ga0207678_10051667
490 Ga0207678_10120908
491 Ga0207702_10024342
492 Ga0207641_10011821
493 Ga0207641_10608381
494 Ga0207676_10026841
495 Ga0207674_10023124
496 Ga0207674_10023495
497 Ga0207674_10047606
498 Ga0207698_10048695
499 Ga0209588_1000004
500 Ga0268266_10000001
501 Ga0268266_10100934
502 Ga0268265_10000431
503 Ga0268264_10055359
504 Ga0307509_10230993
505 Ga0307508_10181993
506 Ga0307412_10001314
507 Ga0439436_0000010
508 Ga0451791_0806195
509 Ga0451791_1639907
510 Ga0451797_0083339
511 Ga0451807_0536136
512 Ga0451807_1517285
513 Ga0439445_0030127
514 Ga0450908_000074
515 Ga0466972_0002304
516 Ga0466982_0000048
517 Ga0453684_0000672
518 Ga0466970_0002763
519 Ga0451576_0000268
520 Ga0495617_000113
521 Ga0495617_000203
522 Ga0495638_0000522
523 Ga0495638_0045660
524 Ga0495650_0004556
525 Ga0495650_0046774
526 Ga0495584_0000769
527 Ga0495584_0069858
528 Ga0495585_0000019
529 Ga0495585_0001923
530 Ga0495607_0000019
531 Ga0495607_0000538
532 Ga0495606_0000181
533 Ga0495606_0007303
534 Ga0495606_0007724
535 Ga0495610_0001640
536 Ga0495616_0000047
537 Ga0495616_0001193
538 Ga0495620_0000524
539 Ga0495620_0004114
540 Ga0495631_0000184
541 Ga0495631_0000929
542 Ga0495632_0000080
543 Ga0495632_0006767
544 Ga0495632_0017694
545 Ga0495632_0208952
546 Ga0495637_0056957
547 Ga0495643_0033272
548 Ga0495648_0000424
549 Ga0495648_0014506
550 Ga0495668_0008627
551 Ga0495611_0000001
552 Ga0495611_0000103
553 Ga0495625_0000001
554 Ga0495625_0017931
555 Ga0495625_0019904
556 Ga0495661_0000396
557 Ga0495670_0001939
558 Ga0495670_0002433
559 Ga0495671_0001113
560 Ga0495649_0046089
561 Ga0495589_0000272
562 Ga0495660_0000415
563 Ga0495660_0000466
564 Ga0495683_0001307
565 Ga0495679_000001
566 Ga0495673_0000001
567 Ga0495673_0000464
568 Ga0495673_0000937
569 Ga0495686_0000085
570 Ga0495686_0000255
571 Ga0495686_0006213
572 Ga0495686_0006900
573 Ga0495686_0077302
574 Ga0496100_0000244
575 Ga0496101_0003789
576 Ga0496102_0430990
577 Ga0496106_0002620
578 Ga0496116_0152467
579 Ga0496117_0032884
580 Ga0496118_0000749
581 Ga0496118_0002232
582 Ga0496118_0003119
583 Ga0496119_0016565
584 Ga0496120_0132024
585 Ga0496121_0000210
586 Ga0496121_0001261
587 Ga0496121_0005273
588 Ga0496121_0206750
589 Ga0496122_0035515
590 Ga0496122_0232471
591 Ga0496123_0003676
592 Ga0496123_0050420
593 Ga0496123_0119485
594 Ga0496124_0002009
595 Ga0496124_0002041
596 Ga0496126_0034876
597 Ga0495678_000207
598 Ga0495682_0002794
599 Ga0495682_0010089
600 Ga0501031_0008125
601 Ga0501031_0019414
602 Ga0501032_0028649
603 Ga0501032_0053459
604 Ga0501033_0001525
605 Ga0501033_0002150
606 Ga0501034_0002351
607 Ga0501034_0003794
608 Ga0501034_0350147
609 Ga0501036_0003706
610 Ga0501036_0021696
611 Ga0501036_0122592
612 Ga0501037_0000336
613 Ga0501037_0026462
614 Ga0501037_0032458
615 Ga0501038_0006022
616 Ga0501038_0020596
617 Ga0501038_0118095
618 Ga0501039_0030654
619 Ga0501039_0062081
620 Ga0501043_0006855
621 Ga0501043_0139992
622 Ga0501043_0157415
623 Ga0501046_0000908
624 Ga0501046_0013023
625 Ga0501047_0004939
626 Ga0501047_0009431
627 Ga0501047_0336889
628 Ga0501048_0044183
629 Ga0501067_0000630
630 Ga0501068_0055468
631 Ga0501069_0001151
632 Ga0501069_0023080
633 Ga0501069_0030478
634 Ga0501070_0020295
635 Ga0501070_0186585
636 Ga0501071_0130509
637 Ga0501072_0022095
638 Ga0501073_0001086
639 Ga0501073_0036781
640 Ga0501074_0046942
641 Ga0501079_0022694
642 Ga0501079_0030908
643 Ga0501080_0020021
644 Ga0501080_0037138
645 Ga0501080_0073038
646 Ga0501083_0001373
647 Ga0501035_0008886
648 Ga0501035_0029081
649 Ga0501044_0002330
650 Ga0501044_0010585
651 Ga0501044_0159731
652 Ga0500643_000002
653 Ga0500651_0002382
654 Ga0500555_000077
655 Ga0500633_0008583
656 Ga0501084_0246197
657 Ga0501082_0027866
658 2595445729
659 2595449422
660 2721027968
661 2735836463
662 2739227440
663 2842915580
664 2842919594
665 2884340106
666 2904463764
667 2919085806
668 2919405938
669 2941474591
670 2953997942

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02666

PS_Dcarbxylase

Phosphatidylserine decarboxylase

66

288

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cnz-assembly2.cif.gz_G crystal structure of 10pe bound psd from e. coli (2.70 a) 0.9614 8 246
7cnx-assembly2.cif.gz_E crystal structure of apo psd from e. coli (2.63 a) 0.9556 7 246
7cnz-assembly2.cif.gz_G crystal structure of 10pe bound psd from e. coli (2.70 a) 0.931 8 246
7cnx-assembly2.cif.gz_E crystal structure of apo psd from e. coli (2.63 a) 0.9184 7 246
7utd-assembly1.cif.gz_A the 2.19-angstrom cryoem structure of the [nife]-hydrogenase huc from mycobacterium smegmatis - complex minus stalk 0.6361 179 202
ID Description Score Start End Superfamily
af_P0A8K1_63_285_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9642 61 275 2.70.70.10
af_P0A8K1_63_285_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9262 61 275 2.70.70.10
af_Q54CR2_119_353_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9135 62 275 2.70.70.10
af_C7FZZ8_173_397_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9127 62 275 2.70.70.10
af_A1A5T2_181_425_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9011 62 275 2.70.70.10
ID Description Score Start End GO Terms
AF-A0A3M0FAF4-F1-model_v4 deleted 0.9911 1 280
AF-A0A0R0DQG4-F1-model_v4 deleted 0.9906 81 277
AF-A0A091B9H1-F1-model_v4 Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] 0.9875 1 277 GO:0004609
GO:0005886
GO:0006646
AF-A0A6N1YAJ3-F1-model_v4 Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] 0.9851 6 277 GO:0004609
GO:0005886
GO:0006646
AF-A0A3M0FAF4-F1-model_v4 deleted 0.9841 1 280

Map