F412103

General Info

Members Datasets Scaffolds Average Seq Length
335 273 670 338

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100093941|Ga0070668_1000939412
Length 355
Sequence MYDVCSPYCRYRRGKHYMTKFTRFALLASTVTFAAGTVSAAELNIYTTREPGLIQPLLESFTASSGVKVNTVFLKDGLAERVLSEGASSPADVLMTVDAGNLVDLAEKGVTQAVESETLTKAVPAELRDAKGHWFALSMRARVLYAAKDLDLASFNYEDLADAKWKGKVCIRAGQHPYNTALFADYIAHYGAADTEKWLAGVKENLDRKAGGGDRDVAKDILGGICDIGIANSYYVGLMRSGKGGEEQVKWGDAIKVVLPTFKNGGTQVNISGAAVAKNAPNKAEAVKLLEYLVSDEAQKIYAEANFEYPVRQGAALNDIVASFGTLKVDNKSLTEIVSHRRQASELVDKVGFDQ

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
31 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
32 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
33 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
48 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
50 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
51 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
65 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
67 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
72 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
80 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
81 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
82 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
83 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
84 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
85 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
86 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
87 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
88 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
89 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
90 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
93 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
94 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
95 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
96 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
97 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
98 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
105 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
106 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
107 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
108 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
109 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
110 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
111 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
112 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
113 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
114 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
127 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
128 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
134 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
135 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
136 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
137 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
138 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
139 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
140 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
141 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
142 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
143 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
147 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
148 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
149 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
150 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
151 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
152 2534681786 Brucella suis 92/29 Isolate Unclassified
153 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
154 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
155 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
156 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
157 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
158 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
159 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
160 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
161 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
162 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
163 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
164 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
165 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
166 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
167 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
168 2643221568 Rhizobium sp. Root564 Isolate Unclassified
169 2643221582 Rhizobium sp. Root651 Isolate Unclassified
170 2643221607 Rhizobium sp. Root73 Isolate Unclassified
171 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
172 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
173 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
174 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
175 2643221693 Rhizobium sp. Root491 Isolate Unclassified
176 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
177 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
178 2751185800 Brucella pituitosa AA2 Isolate Unclassified
179 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
180 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
181 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
182 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
183 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
184 2791355256 Rhizobium sp. M10 Isolate Nodule
185 2791355261 Rhizobium sp. J15 Isolate Nodule
186 2791355262 Rhizobium sp. M1 Isolate Nodule
187 2791355265 Rhizobium sp. H4 Isolate Nodule
188 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
189 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
190 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
191 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
192 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
193 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
194 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
195 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
196 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
197 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
198 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
199 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
200 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
201 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
202 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
203 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
204 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
205 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
206 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
207 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
208 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
209 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
210 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
211 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
212 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
213 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
214 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
215 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
216 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
217 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
218 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
219 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
220 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
221 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
222 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
223 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
224 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
225 2854911287 Brucella lupini LUP21 Isolate Unclassified
226 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
227 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
228 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
229 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
230 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
231 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
232 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
233 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
234 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
235 2919150387 Rahnella aceris 1817 Isolate Unclassified
236 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
237 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
238 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
239 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
240 2927143783 Rahnella sp. 2050 Isolate Unclassified
241 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
242 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
243 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
244 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
245 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
246 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
247 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
248 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
249 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
250 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
251 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
252 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
253 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
254 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
255 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
256 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
257 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
258 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
259 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
260 2996893221 Rhizobium sp. R635 Isolate Nodule
261 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
262 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
263 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
264 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
265 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
266 8005382845 Rhizobium sp. R634 Isolate Nodule
267 8005395548 Rhizobium sp. R339 Isolate Nodule
268 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
269 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
270 8024501048 Rhizobium sp. H4 Isolate Nodule
271 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
272 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
273 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 60.6
Metatranscriptomes 1.19
Isolates 38.21

Biome Distribution

Category Percentage (%)
Aerial Root 1.49
Bulb 0
Endosphere 19.1
Nodule 18.21
Rhizoplane 4.18
Rhizosphere 32.54
Stem 0
Stem Tuber 0.3
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100093941 3300005347 Bacteria 2367
2 SwRhRL2b_contig_2475540 2162886007 Bacteria 5119
3 JGI25162J39368_1000035 3300002737 Bacteria 180993
4 JGI25163J39215_1000058 3300002771 Bacteria 49660
5 JGI25164J39214_1000019 3300002772 Bacteria 180993
6 JGI25151J46595_10000064 3300003187 Bacteria 145243
7 JGI25151J46595_10012023 3300003187 Bacteria 3951
8 rootH1_10257589 3300003323 Bacteria 3578
9 JGI25160J50197_1006290 3300003354 Bacteria 4821
10 Ga0006562J51391_1009380 3300003578 Bacteria 9240
11 Ga0055538_1000039 3300003751 Bacteria 180993
12 Ga0055539_1000050 3300003752 Bacteria 180993
13 Ga0055533_1000062 3300003756 Bacteria 180993
14 Ga0055525_1000072 3300003759 Bacteria 180993
15 Ga0055526_1031655 3300003771 Bacteria 1510
16 Ga0055524_1014726 3300003775 Bacteria 2884
17 Ga0055536_1012412 3300003781 Bacteria 3164
18 Ga0055528_1001247 3300003790 Bacteria 16149
19 Ga0055541_1000038 3300003841 Bacteria 180993
20 Ga0065704_10000679 3300005289 Bacteria 16360
21 Ga0070669_100018677 3300005353 Bacteria 4955
22 Ga0070659_100228821 3300005366 Bacteria 1536
23 Ga0070699_100009561 3300005518 Bacteria 8403
24 Ga0070665_100017006 3300005548 Bacteria 7292
25 Ga0070665_100026594 3300005548 Bacteria 5826
26 Ga0070665_100047861 3300005548 Bacteria 4292
27 Ga0070665_100258752 3300005548 Bacteria 1742
28 Ga0075368_10009078 3300006042 Bacteria 3570
29 Ga0075364_10000024 3300006051 Bacteria 51969
30 Ga0075367_10123082 3300006178 Bacteria 1599
31 Ga0075369_10022809 3300006186 Bacteria 2584
32 Ga0075366_10056408 3300006195 Bacteria 2333
33 Ga0075370_10095641 3300006353 Bacteria 1716
34 Ga0079104_1000044 3300006946 Bacteria 185367
35 Ga0099826_10000149 3300006948 Bacteria 29916
36 Ga0099826_10004007 3300006948 Bacteria 10209
37 Ga0105244_10001772 3300009036 Bacteria 16968
38 Ga0105244_10013236 3300009036 Bacteria 4831
39 Ga0105250_10000240 3300009092 Bacteria 45513
40 Ga0105250_10001434 3300009092 Bacteria 12868
41 Ga0105250_10008489 3300009092 Bacteria 4358
42 Ga0114129_10011500 3300009147 Bacteria 12603
43 Ga0105243_10007987 3300009148 Bacteria 8128
44 Ga0105246_10046335 3300011119 Bacteria 2965
45 Ga0157373_10034448 3300013100 Bacteria 3636
46 Ga0157371_10000004 3300013102 Bacteria 512593
47 Ga0157371_10003171 3300013102 Bacteria 15132
48 Ga0157370_10008228 3300013104 Bacteria 11263
49 Ga0157369_10053949 3300013105 Bacteria 4341
50 Ga0209760_100075 3300025207 Bacteria 80269
51 Ga0209784_100001 3300025224 Bacteria 3600592
52 Ga0209566_100001 3300025225 Bacteria 3600765
53 Ga0209674_100002 3300025226 Bacteria 3600592
54 Ga0209563_100002 3300025230 Bacteria 2045675
55 Ga0207427_100012 3300025231 Bacteria 585657
56 Ga0209437_100001 3300025233 Bacteria 2045675
57 Ga0209677_100002 3300025253 Bacteria 2045675
58 Ga0209129_1001061 3300025258 Bacteria 16229
59 Ga0209233_1002159 3300025261 Bacteria 7379
60 Ga0209673_1000054 3300025273 Bacteria 279116
61 Ga0209130_1002126 3300025284 Bacteria 10527
62 Ga0209676_1000286 3300025292 Bacteria 103478
63 Ga0209676_1033648 3300025292 Bacteria 1524
64 Ga0209025_1000060 3300025294 Bacteria 305017
65 Ga0209025_1000182 3300025294 Bacteria 156443
66 Ga0209025_1007502 3300025294 Bacteria 8106
67 Ga0209025_1010189 3300025294 Bacteria 6413
68 Ga0209758_1008461 3300025297 Bacteria 6653
69 Ga0209256_1000605 3300025299 Bacteria 49814
70 Ga0207426_1000102 3300025302 Bacteria 255303
71 Ga0209051_1027852 3300025303 Bacteria 2243
72 Ga0209257_1021523 3300025304 Bacteria 2338
73 Ga0207696_1000053 3300025711 Bacteria 268590
74 Ga0207696_1000352 3300025711 Bacteria 47130
75 Ga0207696_1000968 3300025711 Bacteria 17425
76 Ga0207655_1004326 3300025728 Bacteria 10138
77 Ga0207681_10114192 3300025923 Bacteria 1970
78 Ga0207709_10067949 3300025935 Bacteria 2251
79 Ga0207709_10079419 3300025935 Bacteria 2110
80 Ga0209281_1000129 3300027111 Bacteria 194490
81 Ga0209371_1000009 3300027312 Bacteria 963030
82 Ga0209371_1002453 3300027312 Bacteria 10345
83 Ga0209282_1000380 3300027666 Bacteria 21686
84 Ga0209813_10003127 3300027866 Bacteria 3847
85 Ga0268266_10024296 3300028379 Bacteria 5156
86 Ga0268266_10086558 3300028379 Bacteria 2740
87 Ga0268256_1000010 3300030500 Bacteria 963034
88 Ga0268256_1003692 3300030500 Bacteria 6751
89 Ga0307408_100267702 3300031548 Bacteria 1417
90 Ga0316576_10039015 3300031727 Bacteria 3408
91 Ga0316596_1045560 3300033541 Bacteria 1157
92 Ga0373931_0035507 3300035691 Bacteria 2593
93 Ga0395899_0000044 3300037312 Bacteria 248735
94 Ga0395900_0000042 3300037418 Bacteria 242667
95 Ga0395898_0000080 3300037466 Bacteria 242667
96 Ga0395905_0000044 3300037471 Bacteria 242916
97 Ga0395901_0000027 3300038443 Bacteria 244204
98 Ga0439436_0004834 3300041404 Bacteria 4133
99 Ga0439438_032628 3300041405 Bacteria 1380
100 Ga0439466_0031881 3300041411 Bacteria 1800
101 Ga0439465_0001543 3300041413 Bacteria 7493
102 Ga0439465_0035036 3300041413 Bacteria 1608
103 Ga0439431_0005172 3300041997 Bacteria 2876
104 Ga0439445_0015899 3300042004 Bacteria 1848
105 Ga0439462_0043794 3300042015 Bacteria 1197
106 Ga0450920_008470 3300042122 Bacteria 1880
107 Ga0450906_006701 3300042145 Bacteria 2307
108 Ga0439434_0014146 3300042435 Bacteria 2373
109 Ga0450918_000770 3300042531 Bacteria 6790
110 Ga0466965_0059143 3300044683 Bacteria 1912
111 Ga0451576_0000819 3300045051 Bacteria 60723
112 Ga0451576_0034088 3300045051 Bacteria 5409
113 Ga0495650_0000018 3300046471 Bacteria 538888
114 Ga0495597_0000482 3300046542 Bacteria 33359
115 Ga0495588_0002200 3300046674 Bacteria 8347
116 Ga0495660_0000004 3300046810 Bacteria 1003183
117 Ga0495672_0000009 3300047320 Bacteria 557755
118 Ga0495679_000052 3300047446 Bacteria 120793
119 Ga0495681_0005399 3300047470 Bacteria 8567
120 Ga0495681_0009142 3300047470 Bacteria 6135
121 Ga0496104_0001350 3300048907 Bacteria 21251
122 Ga0496104_0172921 3300048907 Bacteria 2070
123 Ga0496106_0134350 3300048909 Bacteria 1942
124 Ga0496110_0407048 3300048913 Bacteria 1240
125 Ga0496111_0008079 3300048914 Bacteria 6948
126 Ga0496113_0020148 3300048916 Bacteria 4683
127 Ga0496116_0000100 3300048919 Bacteria 194740
128 Ga0496116_0000225 3300048919 Bacteria 105470
129 Ga0496116_0118816 3300048919 Bacteria 1535
130 Ga0496117_0000002 3300048920 Bacteria 2483758
131 Ga0496117_0003587 3300048920 Bacteria 17905
132 Ga0496117_0092747 3300048920 Bacteria 1939
133 Ga0496118_0000776 3300048921 Bacteria 51291
134 Ga0496118_0005288 3300048921 Bacteria 14729
135 Ga0496118_0044032 3300048921 Bacteria 3499
136 Ga0496118_0190675 3300048921 Bacteria 1226
137 Ga0496119_0004809 3300048922 Bacteria 13251
138 Ga0496119_0016351 3300048922 Bacteria 5650
139 Ga0496119_0026457 3300048922 Bacteria 4022
140 Ga0496119_0041707 3300048922 Bacteria 2918
141 Ga0496120_0000034 3300048923 Bacteria 215228
142 Ga0496120_0009025 3300048923 Bacteria 7125
143 Ga0496120_0016245 3300048923 Bacteria 4871
144 Ga0496120_0054981 3300048923 Bacteria 2253
145 Ga0496121_0000143 3300048924 Bacteria 159577
146 Ga0496121_0000615 3300048924 Bacteria 66351
147 Ga0496122_0000001 3300048925 Bacteria 1827766
148 Ga0496122_0000007 3300048925 Bacteria 606493
149 Ga0496122_0011146 3300048925 Bacteria 9156
150 Ga0496122_0054607 3300048925 Bacteria 2998
151 Ga0496122_0086340 3300048925 Bacteria 2160
152 Ga0496123_0000001 3300048926 Bacteria 1831497
153 Ga0496123_0000004 3300048926 Bacteria 777230
154 Ga0496123_0010423 3300048926 Bacteria 8216
155 Ga0496123_0014871 3300048926 Bacteria 6422
156 Ga0496124_0000025 3300048927 Bacteria 405471
157 Ga0496124_0000083 3300048927 Bacteria 207798
158 Ga0496124_0034304 3300048927 Bacteria 4455
159 Ga0496125_0000013 3300048928 Bacteria 628761
160 Ga0496125_0000065 3300048928 Bacteria 249830
161 Ga0496125_0000589 3300048928 Bacteria 61966
162 Ga0496125_0015772 3300048928 Bacteria 7282
163 Ga0496125_0065674 3300048928 Bacteria 2872
164 Ga0496126_0000311 3300048929 Bacteria 103353
165 Ga0496126_0000358 3300048929 Bacteria 95082
166 Ga0496126_0063035 3300048929 Bacteria 3324
167 Ga0496126_0065791 3300048929 Bacteria 3243
168 Ga0496126_0068707 3300048929 Bacteria 3162
169 Ga0501033_0045044 3300049570 Bacteria 3284
170 Ga0501034_0179780 3300049571 Bacteria 2080
171 Ga0501042_0414873 3300049578 Bacteria 976
172 Ga0501043_0058135 3300049579 Bacteria 3036
173 Ga0501067_0030444 3300049583 Bacteria 2993
174 Ga0501073_0005716 3300049589 Bacteria 9303
175 Ga0501238_005632 3300049671 Bacteria 1595
176 Ga0501083_0119571 3300049744 Bacteria 1728
177 Ga0501083_0184825 3300049744 Bacteria 1360
178 Ga0501241_014829 3300049758 Bacteria 1417
179 Ga0501035_0028359 3300049822 Bacteria 5111
180 Ga0501035_0037157 3300049822 Bacteria 4412
181 Ga0501044_0129242 3300049823 Bacteria 2521
182 nmdc:mga00v17_24955_c1 3300050491 Bacteria 3470
183 nmdc:mga00v17_270_c1 3300050491 Bacteria 30629
184 nmdc:mga00v17_36_c1 3300050491 Bacteria 85171
185 nmdc:mga00v17_69033_c1 3300050491 Bacteria 2186
186 nmdc:mga0yw44_185_c1 3300050492 Bacteria 11944
187 nmdc:mga04h51_2995_c1 3300050495 Bacteria 4065
188 nmdc:mga05p37_106167_c1 3300050507 Bacteria 3455
189 nmdc:mga09592_174537_c1 3300050508 Bacteria 1859
190 nmdc:mga0qj67_39877_c1 3300050509 Bacteria 3690
191 nmdc:mga06r32_25088_c1 3300050510 Bacteria 5541
192 nmdc:mga0sz30_14283_c1 3300050516 Bacteria 3123
193 Ga0500560_000447 3300053107 Bacteria 5688
194 Ga0500560_002448 3300053107 Bacteria 3549
195 Ga0500572_003520 3300053111 Bacteria 3570
196 Ga0500607_060290 3300053121 Bacteria 1991
197 Ga0500559_0031888 3300053136 Bacteria 2262
198 Ga0500561_0000222 3300053137 Bacteria 10352
199 Ga0500604_0012262 3300053151 Bacteria 2313
200 Ga0500624_001758 3300053157 Bacteria 3181
201 Ga0500634_0010576 3300053161 Bacteria 4718
202 Ga0500634_0061620 3300053161 Bacteria 1989
203 Ga0500636_0000006 3300053177 Bacteria 183899
204 Ga0500636_0000101 3300053177 Bacteria 43900
205 Ga0587088_010453 3300059508 Bacteria 1360
206 Ga0587090_010592 3300059510 Bacteria 1281
207 Ga0501082_0076464 3300060353 Bacteria 2886
208 2509140578 2508501127 Bacteria 7037543
209 2510136484 2510065019 Bacteria 6903379
210 2511393054 2511231027 Bacteria 5013807
211 2513569652 2513237084 Bacteria 7231967
212 2513909437 2513237144 Bacteria 7530820
213 2513999187 2513237159 Bacteria 6810126
214 2535486655 2534681786 Bacteria 3308809
215 2537873307 2537561587 Bacteria 5425293
216 2538427457 2537561728 Bacteria 5149301
217 2554246435 2554235003 Bacteria 5877155
218 2559293657 2558860242 Bacteria 5568029
219 2585166986 2582581283 Bacteria 6030556
220 2585203959 2582581294 Bacteria 6626667
221 2585397033 2582581866 Bacteria 6859583
222 2599336309 2599185156 Bacteria 5403036
223 2599605771 2599185210 Bacteria 5624189
224 2599717944 2599185236 Bacteria 6875203
225 2601609322 2600255279 Bacteria 5605316
226 2601746097 2600255308 Bacteria 5611129
227 2616295194 2615840624 Bacteria 6557588
228 2643770460 2643221550 Bacteria 4619371
229 2643840566 2643221564 Bacteria 4193379
230 2643857324 2643221568 Bacteria 5187270
231 2643920819 2643221582 Bacteria 5804683
232 2644047602 2643221607 Bacteria 6314006
233 2644205933 2643221636 Bacteria 6583769
234 2644241116 2643221643 Bacteria 5749658
235 2644481069 2643221686 Bacteria 6310811
236 2644497577 2643221689 Bacteria 6042950
237 2644519376 2643221693 Bacteria 5513853
238 2671108628 2667528173 Bacteria 5375747
239 2739347581 2738543031 Bacteria 5769731
240 2753358109 2751185800 Bacteria 5467370
241 2758639113 2758568016 Bacteria 5645291
242 2770199633 2767802442 Bacteria 5747986
243 2776271011 2775506902 Bacteria 6208009
244 2776282903 2775506904 Bacteria 5954060
245 2776911009 2775507049 Bacteria 6284736
246 2793296428 2791355256 Bacteria 6798008
247 2793326026 2791355261 Bacteria 6661293
248 2793333059 2791355262 Bacteria 6774204
249 2793357135 2791355265 Bacteria 6539969
250 2805931747 2802429605 Bacteria 6875453
251 2805937253 2802429606 Bacteria 6346811
252 2808986572 2808606387 Bacteria 5697198
253 2819556643 2818991439 Bacteria 6907412
254 2821127329 2821123053 Bacteria 7836056
255 2838671483 2838668709 Bacteria 6671819
256 2838677377 2838675328 Bacteria 4909118
257 2838704250 2838701080 Bacteria 6669771
258 2838716265 2838714209 Bacteria 5525906
259 2838719935 2838719591 Bacteria 5523910
260 2838727017 2838724970 Bacteria 4908691
261 2838740527 2838736955 Bacteria 5760694
262 2840767772 2840764183 Bacteria 6358399
263 2841846166 2841840854 Bacteria 5761912
264 2841846866 2841846520 Bacteria 5345850
265 2841860606 2841859092 Bacteria 5436171
266 2842127105 2842124991 Bacteria 5346824
267 2842132270 2842130223 Bacteria 4909145
268 2842145912 2842140634 Bacteria 5759631
269 2842149132 2842146304 Bacteria 5957337
270 2842152561 2842152218 Bacteria 4908957
271 2842172510 2842170452 Bacteria 5525737
272 2842176180 2842175837 Bacteria 4908771
273 2842189372 2842187318 Bacteria 5524014
274 2842195250 2842192696 Bacteria 6147454
275 2842210265 2842205361 Bacteria 6340321
276 2842213686 2842211629 Bacteria 5523832
277 2842224696 2842224351 Bacteria 5524473
278 2842253701 2842250916 Bacteria 6579627
279 2842283719 2842278818 Bacteria 6340002
280 2842318992 2842317721 Bacteria 6793725
281 2842491442 2842489311 Bacteria 6620893
282 2842499510 2842495871 Bacteria 6820686
283 2842517391 2842515876 Bacteria 5436280
284 2842524932 2842521101 Bacteria 6569494
285 2842872595 2842871566 Bacteria 4827117
286 2844537918 2844533157 Bacteria 7517899
287 2854916358 2854911287 Bacteria 5582813
288 2857534690 2857531043 Bacteria 6754041
289 2871275406 2871272651 Bacteria 5042015
290 2883356755 2883354860 Bacteria 5865246
291 2891673941 2891670763 Bacteria 4967099
292 2899794602 2899792073 Bacteria 4926588
293 2899845946 2899845264 Bacteria 5672268
294 2904475676 2904474040 Bacteria 5504324
295 2915652748 2915650412 Bacteria 4288180
296 2919116469 2919114240 Bacteria 5700270
297 2919151845 2919150387 Bacteria 5500879
298 2919166697 2919166419 Bacteria 4952238
299 2919681241 2919679072 Bacteria 4629602
300 2926754491 2926754445 Bacteria 5964435
301 2926761664 2926760298 Bacteria 5505990
302 2927144514 2927143783 Bacteria 5504251
303 2928523341 2928521798 Bacteria 4960112
304 2929141581 2929138655 Bacteria 5810547
305 2933007207 2933006813 Bacteria 4912075
306 2933015203 2933011516 Bacteria 5439334
307 2933021813 2933016740 Bacteria 6355406
308 2933594408 2933594066 Bacteria 5594265
309 2936370631 2936367885 Bacteria 7324495
310 2936377856 2936375103 Bacteria 6652732
311 2939573137 2939573065 Bacteria 4926053
312 2954015612 2954011201 Bacteria 4762601
313 2978973092 2978969890 Bacteria 5400756
314 2979093073 2979089926 Bacteria 5670289
315 2979099539 2979095461 Bacteria 5669583
316 2979105043 2979100975 Bacteria 5423623
317 2984513143 2984509177 Bacteria 5274802
318 2984520490 2984518228 Bacteria 5277463
319 2984539785 2984537506 Bacteria 5277481
320 2984591347 2984587000 Bacteria 5263363
321 2984601998 2984601300 Bacteria 5455244
322 2996894532 2996893221 Bacteria 5823108
323 650738898 650716007 Bacteria 5573770
324 8003572454 8003570095 Bacteria 5747666
325 8005290646 8005289223 Bacteria 6634003
326 8005305031 8005301065 Bacteria 6614431
327 8005381865 8005376324 Bacteria 6590079
328 8005388485 8005382845 Bacteria 6732062
329 8005397651 8005395548 Bacteria 6806915
330 8005689425 8005688590 Bacteria 6610080
331 8018129364 8018127388 Bacteria 7351159
332 8024505575 8024501048 Bacteria 6427847
333 8054461143 8054460903 Bacteria 4872905
334 8054849271 8054849141 Bacteria 5232694
335 8056383509 8056382006 Bacteria 6408074
336 Ga0070668_100093941
337 SwRhRL2b_contig_2475540
338 JGI25162J39368_1000035
339 JGI25163J39215_1000058
340 JGI25164J39214_1000019
341 JGI25151J46595_10000064
342 JGI25151J46595_10012023
343 rootH1_10257589
344 JGI25160J50197_1006290
345 Ga0006562J51391_1009380
346 Ga0055538_1000039
347 Ga0055539_1000050
348 Ga0055533_1000062
349 Ga0055525_1000072
350 Ga0055526_1031655
351 Ga0055524_1014726
352 Ga0055536_1012412
353 Ga0055528_1001247
354 Ga0055541_1000038
355 Ga0065704_10000679
356 Ga0070669_100018677
357 Ga0070659_100228821
358 Ga0070699_100009561
359 Ga0070665_100017006
360 Ga0070665_100026594
361 Ga0070665_100047861
362 Ga0070665_100258752
363 Ga0075368_10009078
364 Ga0075364_10000024
365 Ga0075367_10123082
366 Ga0075369_10022809
367 Ga0075366_10056408
368 Ga0075370_10095641
369 Ga0079104_1000044
370 Ga0099826_10000149
371 Ga0099826_10004007
372 Ga0105244_10001772
373 Ga0105244_10013236
374 Ga0105250_10000240
375 Ga0105250_10001434
376 Ga0105250_10008489
377 Ga0114129_10011500
378 Ga0105243_10007987
379 Ga0105246_10046335
380 Ga0157373_10034448
381 Ga0157371_10000004
382 Ga0157371_10003171
383 Ga0157370_10008228
384 Ga0157369_10053949
385 Ga0209760_100075
386 Ga0209784_100001
387 Ga0209566_100001
388 Ga0209674_100002
389 Ga0209563_100002
390 Ga0207427_100012
391 Ga0209437_100001
392 Ga0209677_100002
393 Ga0209129_1001061
394 Ga0209233_1002159
395 Ga0209673_1000054
396 Ga0209130_1002126
397 Ga0209676_1000286
398 Ga0209676_1033648
399 Ga0209025_1000060
400 Ga0209025_1000182
401 Ga0209025_1007502
402 Ga0209025_1010189
403 Ga0209758_1008461
404 Ga0209256_1000605
405 Ga0207426_1000102
406 Ga0209051_1027852
407 Ga0209257_1021523
408 Ga0207696_1000053
409 Ga0207696_1000352
410 Ga0207696_1000968
411 Ga0207655_1004326
412 Ga0207681_10114192
413 Ga0207709_10067949
414 Ga0207709_10079419
415 Ga0209281_1000129
416 Ga0209371_1000009
417 Ga0209371_1002453
418 Ga0209282_1000380
419 Ga0209813_10003127
420 Ga0268266_10024296
421 Ga0268266_10086558
422 Ga0268256_1000010
423 Ga0268256_1003692
424 Ga0307408_100267702
425 Ga0316576_10039015
426 Ga0316596_1045560
427 Ga0373931_0035507
428 Ga0395899_0000044
429 Ga0395900_0000042
430 Ga0395898_0000080
431 Ga0395905_0000044
432 Ga0395901_0000027
433 Ga0439436_0004834
434 Ga0439438_032628
435 Ga0439466_0031881
436 Ga0439465_0001543
437 Ga0439465_0035036
438 Ga0439431_0005172
439 Ga0439445_0015899
440 Ga0439462_0043794
441 Ga0450920_008470
442 Ga0450906_006701
443 Ga0439434_0014146
444 Ga0450918_000770
445 Ga0466965_0059143
446 Ga0451576_0000819
447 Ga0451576_0034088
448 Ga0495650_0000018
449 Ga0495597_0000482
450 Ga0495588_0002200
451 Ga0495660_0000004
452 Ga0495672_0000009
453 Ga0495679_000052
454 Ga0495681_0005399
455 Ga0495681_0009142
456 Ga0496104_0001350
457 Ga0496104_0172921
458 Ga0496106_0134350
459 Ga0496110_0407048
460 Ga0496111_0008079
461 Ga0496113_0020148
462 Ga0496116_0000100
463 Ga0496116_0000225
464 Ga0496116_0118816
465 Ga0496117_0000002
466 Ga0496117_0003587
467 Ga0496117_0092747
468 Ga0496118_0000776
469 Ga0496118_0005288
470 Ga0496118_0044032
471 Ga0496118_0190675
472 Ga0496119_0004809
473 Ga0496119_0016351
474 Ga0496119_0026457
475 Ga0496119_0041707
476 Ga0496120_0000034
477 Ga0496120_0009025
478 Ga0496120_0016245
479 Ga0496120_0054981
480 Ga0496121_0000143
481 Ga0496121_0000615
482 Ga0496122_0000001
483 Ga0496122_0000007
484 Ga0496122_0011146
485 Ga0496122_0054607
486 Ga0496122_0086340
487 Ga0496123_0000001
488 Ga0496123_0000004
489 Ga0496123_0010423
490 Ga0496123_0014871
491 Ga0496124_0000025
492 Ga0496124_0000083
493 Ga0496124_0034304
494 Ga0496125_0000013
495 Ga0496125_0000065
496 Ga0496125_0000589
497 Ga0496125_0015772
498 Ga0496125_0065674
499 Ga0496126_0000311
500 Ga0496126_0000358
501 Ga0496126_0063035
502 Ga0496126_0065791
503 Ga0496126_0068707
504 Ga0501033_0045044
505 Ga0501034_0179780
506 Ga0501042_0414873
507 Ga0501043_0058135
508 Ga0501067_0030444
509 Ga0501073_0005716
510 Ga0501238_005632
511 Ga0501083_0119571
512 Ga0501083_0184825
513 Ga0501241_014829
514 Ga0501035_0028359
515 Ga0501035_0037157
516 Ga0501044_0129242
517 nmdc:mga00v17_24955_c1
518 nmdc:mga00v17_270_c1
519 nmdc:mga00v17_36_c1
520 nmdc:mga00v17_69033_c1
521 nmdc:mga0yw44_185_c1
522 nmdc:mga04h51_2995_c1
523 nmdc:mga05p37_106167_c1
524 nmdc:mga09592_174537_c1
525 nmdc:mga0qj67_39877_c1
526 nmdc:mga06r32_25088_c1
527 nmdc:mga0sz30_14283_c1
528 Ga0500560_000447
529 Ga0500560_002448
530 Ga0500572_003520
531 Ga0500607_060290
532 Ga0500559_0031888
533 Ga0500561_0000222
534 Ga0500604_0012262
535 Ga0500624_001758
536 Ga0500634_0010576
537 Ga0500634_0061620
538 Ga0500636_0000006
539 Ga0500636_0000101
540 Ga0587088_010453
541 Ga0587090_010592
542 Ga0501082_0076464
543 2509140578
544 2510136484
545 2511393054
546 2513569652
547 2513909437
548 2513999187
549 2535486655
550 2537873307
551 2538427457
552 2554246435
553 2559293657
554 2585166986
555 2585203959
556 2585397033
557 2599336309
558 2599605771
559 2599717944
560 2601609322
561 2601746097
562 2616295194
563 2643770460
564 2643840566
565 2643857324
566 2643920819
567 2644047602
568 2644205933
569 2644241116
570 2644481069
571 2644497577
572 2644519376
573 2671108628
574 2739347581
575 2753358109
576 2758639113
577 2770199633
578 2776271011
579 2776282903
580 2776911009
581 2793296428
582 2793326026
583 2793333059
584 2793357135
585 2805931747
586 2805937253
587 2808986572
588 2819556643
589 2821127329
590 2838671483
591 2838677377
592 2838704250
593 2838716265
594 2838719935
595 2838727017
596 2838740527
597 2840767772
598 2841846166
599 2841846866
600 2841860606
601 2842127105
602 2842132270
603 2842145912
604 2842149132
605 2842152561
606 2842172510
607 2842176180
608 2842189372
609 2842195250
610 2842210265
611 2842213686
612 2842224696
613 2842253701
614 2842283719
615 2842318992
616 2842491442
617 2842499510
618 2842517391
619 2842524932
620 2842872595
621 2844537918
622 2854916358
623 2857534690
624 2871275406
625 2883356755
626 2891673941
627 2899794602
628 2899845946
629 2904475676
630 2915652748
631 2919116469
632 2919151845
633 2919166697
634 2919681241
635 2926754491
636 2926761664
637 2927144514
638 2928523341
639 2929141581
640 2933007207
641 2933015203
642 2933021813
643 2933594408
644 2936370631
645 2936377856
646 2939573137
647 2954015612
648 2978973092
649 2979093073
650 2979099539
651 2979105043
652 2984513143
653 2984520490
654 2984539785
655 2984591347
656 2984601998
657 2996894532
658 650738898
659 8003572454
660 8005290646
661 8005305031
662 8005381865
663 8005388485
664 8005397651
665 8005689425
666 8018129364
667 8024505575
668 8054461143
669 8054849271
670 8056383509

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

88

326

0.89

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

57

328

0.8

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

45

308

0.79

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

46

300

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y9u-assembly1.cif.gz_A bordetella ferric binding protein 0.9697 30 345
1y9u-assembly1.cif.gz_A bordetella ferric binding protein 0.9666 30 345
7li0-assembly1.cif.gz_A crystal structure of apo moraxella catarrhalis ferric binding protein a in an open conformation 0.9494 31 343
6g7q-assembly1.cif.gz_B trichodesmium tery_3377 (idia) (futa) in complex with iron and citrate ligands. 0.9468 31 343
1si1-assembly1.cif.gz_A crystal structure of mannheimia haemolytica ferric iron-binding protein a in an open conformation 0.9417 30 345
ID Description Score Start End Superfamily
2owtA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9656 129 345 3.40.190.10
1q35A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9582 30 304 3.40.190.10
2owtA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9486 129 345 3.40.190.10
1y4tD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9475 32 306 3.40.190.10
1q35A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9454 30 304 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A519GNX6-F1-model_v4 Extracellular solute-binding protein 0.9812 116 345 GO:0030288
AF-M7CNG3-F1-model_v4 deleted 0.976 13 345
AF-A0A1Q7BMM5-F1-model_v4 Iron ABC transporter substrate-binding protein 0.9746 44 345 GO:0030288
GO:0046872
AF-M7CNG3-F1-model_v4 deleted 0.973 13 345
AF-A0A1Q7BMM5-F1-model_v4 Iron ABC transporter substrate-binding protein 0.9714 44 345 GO:0030288
GO:0046872

Map