F412109

General Info

Members Datasets Scaffolds Average Seq Length
335 207 670 334

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100048167|Ga0070671_1000481673
Length 376
Sequence MSFVILFGLHRTGFCETIPIMNAGLPWFANAFPLYLAPMAGVTDKIFRQICKRYGADVLVTEFVSAEGVFRRNERTREYLDFDERERPLGVQLFGASPAHMAVAAKQVVDWVGPDFIDLNFGCPVNKVVAKNGGSALLKDCPTLSSVAKAVVQAVAPLPVTAKIRIGWDANSINAVRVAEILQECGVAALAVHGRTRAQGYSGEADWRVIGEVAEAVRIPVIGNGDLFCAEEVARRRTETRIAGVMIGRAAMSAPWIFRQIKYYLVTGELLSAPELSERWNVIIEHCRRHAEDWGDEEQAIRSLRARLMAYSKNFPEAKALREKFQHVSTVAEIEDIAKTHHRTSQERPLQTPVRLGPADRRLMAARSVLNFSPTA

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
148 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
149 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
150 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
151 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
190 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
191 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
192 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
201 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
202 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
203 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
204 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
205 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
206 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
207 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.37
Nodule 0
Rhizoplane 6.27
Rhizosphere 84.18
Stem 0
Stem Tuber 0
Unclassified 23.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100048167 3300005355 Bacteria 3543
2 SwRhRL2b_contig_736758 2162886007 Unclassified 1615
3 CNXas_1000098 3300000545 Bacteria 15882
4 JGI24744J21845_10007701 3300002077 Bacteria 2226
5 JGI24033J26618_1000014 3300002155 Bacteria 29929
6 rootH2_10000114 3300003320 Bacteria 33365
7 Ga0065704_10002826 3300005289 Unclassified 4648
8 Ga0065712_10004304 3300005290 Bacteria 3959
9 Ga0065707_10010793 3300005295 Bacteria 6416
10 Ga0070658_10004555 3300005327 Bacteria 11267
11 Ga0070658_10053769 3300005327 Bacteria 3269
12 Ga0070658_10057689 3300005327 Bacteria 3159
13 Ga0070676_10000524 3300005328 Bacteria 18431
14 Ga0070676_10003120 3300005328 Bacteria 8558
15 Ga0070690_100099365 3300005330 Bacteria 1927
16 Ga0070670_100088733 3300005331 Unclassified 2658
17 Ga0070670_100354377 3300005331 Bacteria 1289
18 Ga0070666_10002500 3300005335 Bacteria 11121
19 Ga0070666_10009998 3300005335 Bacteria 5920
20 Ga0068868_100027783 3300005338 Bacteria 4319
21 Ga0068868_100039352 3300005338 Unclassified 3674
22 Ga0070660_100064030 3300005339 Bacteria 2860
23 Ga0070661_100001159 3300005344 Bacteria 18561
24 Ga0070668_100002535 3300005347 Bacteria 13448
25 Ga0070668_100006269 3300005347 Bacteria 8804
26 Ga0070668_100022255 3300005347 Bacteria 4790
27 Ga0070668_100189657 3300005347 Unclassified 1683
28 Ga0070675_100002782 3300005354 Bacteria 13164
29 Ga0070675_100067730 3300005354 Unclassified 2954
30 Ga0070675_100256160 3300005354 Unclassified 1532
31 Ga0070671_100002816 3300005355 Bacteria 13517
32 Ga0070671_100092913 3300005355 Bacteria 2528
33 Ga0070674_100001445 3300005356 Bacteria 12640
34 Ga0070674_100082704 3300005356 Unclassified 2297
35 Ga0070673_100004315 3300005364 Bacteria 8983
36 Ga0070673_100022953 3300005364 Bacteria 4552
37 Ga0070688_100025833 3300005365 Unclassified 3482
38 Ga0070659_100018749 3300005366 Bacteria 5223
39 Ga0070667_100018981 3300005367 Bacteria 5701
40 Ga0070667_100191183 3300005367 Bacteria 1813
41 Ga0070709_10192248 3300005434 Bacteria 1440
42 Ga0070714_100284154 3300005435 Bacteria 1538
43 Ga0070713_100004516 3300005436 Bacteria 9366
44 Ga0070713_100321889 3300005436 Bacteria 1428
45 Ga0070710_10054199 3300005437 Unclassified 2262
46 Ga0070710_10077004 3300005437 Bacteria 1937
47 Ga0070711_100008874 3300005439 Bacteria 6169
48 Ga0070711_100197180 3300005439 Bacteria 1551
49 Ga0070705_100101289 3300005440 Bacteria 1819
50 Ga0070678_100031467 3300005456 Bacteria 3661
51 Ga0068867_100000238 3300005459 Bacteria 36084
52 Ga0068867_100079298 3300005459 Bacteria 2471
53 Ga0068867_100113346 3300005459 Unclassified 2086
54 Ga0070706_100002546 3300005467 Bacteria 18327
55 Ga0070706_100004217 3300005467 Bacteria 13956
56 Ga0070706_100066485 3300005467 Unclassified 3334
57 Ga0070706_100263778 3300005467 Bacteria 1608
58 Ga0070706_100382895 3300005467 Bacteria 1310
59 Ga0070706_100578560 3300005467 Unclassified 1044
60 Ga0070707_100035525 3300005468 Unclassified 4754
61 Ga0070707_100094466 3300005468 Bacteria 2895
62 Ga0070707_100270768 3300005468 Bacteria 1651
63 Ga0070707_100350087 3300005468 Bacteria 1435
64 Ga0070698_100000343 3300005471 Bacteria 47990
65 Ga0070698_100005638 3300005471 Bacteria 13703
66 Ga0070698_100056617 3300005471 Bacteria 3973
67 Ga0070698_100256256 3300005471 Bacteria 1682
68 Ga0070699_100092244 3300005518 Unclassified 2649
69 Ga0070699_100257311 3300005518 Bacteria 1561
70 Ga0070697_100006834 3300005536 Bacteria 8856
71 Ga0070697_100008344 3300005536 Bacteria 8083
72 Ga0070697_100053749 3300005536 Bacteria 3274
73 Ga0070697_100108627 3300005536 Unclassified 2309
74 Ga0068853_100000010 3300005539 Bacteria 249824
75 Ga0070672_100004200 3300005543 Bacteria 9411
76 Ga0070672_100019454 3300005543 Bacteria 4928
77 Ga0070696_100024743 3300005546 Bacteria 4080
78 Ga0070693_100140152 3300005547 Bacteria 1521
79 Ga0070665_100096124 3300005548 Bacteria 2967
80 Ga0070665_100123921 3300005548 Unclassified 2586
81 Ga0070664_100001295 3300005564 Bacteria 20026
82 Ga0068857_100106721 3300005577 Bacteria 2515
83 Ga0070702_100027829 3300005615 Unclassified 3055
84 Ga0068852_100180983 3300005616 Archaea 1982
85 Ga0068866_10011930 3300005718 Bacteria 3776
86 Ga0068863_100039851 3300005841 Unclassified 4468
87 Ga0068863_100375351 3300005841 Bacteria 1388
88 Ga0068858_100043223 3300005842 Bacteria 4178
89 Ga0068860_100000107 3300005843 Bacteria 133502
90 Ga0068860_100371137 3300005843 Bacteria 1411
91 Ga0068862_100150510 3300005844 Unclassified 2071
92 Ga0068862_100152265 3300005844 Archaea 2059
93 Ga0081540_1000380 3300005983 Bacteria 44546
94 Ga0081540_1048504 3300005983 Bacteria 2126
95 Ga0081539_10065818 3300005985 Unclassified 1967
96 Ga0070717_10002602 3300006028 Bacteria 12731
97 Ga0070717_10256468 3300006028 Bacteria 1546
98 Ga0075363_100016200 3300006048 Unclassified 3678
99 Ga0070715_10075844 3300006163 Bacteria 1513
100 Ga0070712_100014127 3300006175 Bacteria 5121
101 Ga0070712_100171830 3300006175 Bacteria 1682
102 Ga0075362_10000170 3300006177 Bacteria 17825
103 Ga0097621_100033099 3300006237 Bacteria 4114
104 Ga0075370_10026954 3300006353 Unclassified 3186
105 Ga0068871_100245803 3300006358 Unclassified 1557
106 Ga0068871_100283424 3300006358 Archaea 1450
107 Ga0075434_100087002 3300006871 Bacteria 3125
108 Ga0075434_100218087 3300006871 Bacteria 1928
109 Ga0068865_100030735 3300006881 Unclassified 3575
110 Ga0068865_100126250 3300006881 Archaea 1910
111 Ga0075435_100251602 3300007076 Bacteria 1504
112 Ga0105240_10000026 3300009093 Bacteria 355569
113 Ga0105245_10101455 3300009098 Bacteria 2664
114 Ga0105245_10169086 3300009098 Bacteria 2080
115 Ga0105247_10269908 3300009101 Bacteria 1170
116 Ga0105243_10000253 3300009148 Bacteria 61384
117 Ga0157373_10007527 3300013100 Bacteria 8096
118 Ga0157371_10183247 3300013102 Bacteria 1498
119 Ga0157370_10000735 3300013104 Bacteria 41132
120 Ga0157374_10000030 3300013296 Bacteria 211102
121 Ga0157374_10048868 3300013296 Unclassified 3927
122 Ga0157374_10058964 3300013296 Unclassified 3588
123 Ga0157378_10003406 3300013297 Bacteria 14134
124 Ga0157378_10016705 3300013297 Bacteria 6431
125 Ga0157378_10095438 3300013297 Unclassified 2708
126 Ga0157378_10299320 3300013297 Unclassified 1556
127 Ga0163162_10010592 3300013306 Bacteria 8967
128 Ga0163162_10011221 3300013306 Bacteria 8735
129 Ga0163162_10505371 3300013306 Unclassified 1339
130 Ga0157372_10004490 3300013307 Bacteria 14885
131 Ga0157372_10012764 3300013307 Bacteria 8951
132 Ga0157372_10477923 3300013307 Unclassified 1453
133 Ga0157375_10007535 3300013308 Bacteria 9515
134 Ga0157375_10212264 3300013308 Unclassified 2093
135 Ga0157375_10288097 3300013308 Unclassified 1805
136 Ga0163163_10064720 3300014325 Unclassified 3628
137 Ga0157376_10000110 3300014969 Bacteria 58480
138 Ga0157376_10079625 3300014969 Unclassified 2809
139 Ga0163161_10025407 3300017792 Unclassified 4192
140 Ga0163161_10061620 3300017792 Unclassified 2731
141 Ga0213876_10000896 3300021384 Bacteria 19899
142 Ga0213876_10001388 3300021384 Bacteria 15114
143 Ga0213876_10005257 3300021384 Bacteria 7131
144 Ga0213876_10049730 3300021384 Bacteria 2215
145 Ga0207673_1004598 3300025290 Unclassified 1656
146 Ga0207697_10000199 3300025315 Bacteria 32092
147 Ga0207697_10000391 3300025315 Bacteria 24629
148 Ga0207697_10001557 3300025315 Bacteria 12380
149 Ga0207697_10027976 3300025315 Unclassified 2305
150 Ga0207682_10019342 3300025893 Unclassified 2665
151 Ga0207692_10075749 3300025898 Bacteria 1786
152 Ga0207642_10006665 3300025899 Bacteria 3855
153 Ga0207688_10000927 3300025901 Bacteria 14806
154 Ga0207688_10001043 3300025901 Bacteria 14204
155 Ga0207680_10036165 3300025903 Unclassified 2842
156 Ga0207685_10078049 3300025905 Bacteria 1362
157 Ga0207699_10020017 3300025906 Bacteria 3579
158 Ga0207645_10001104 3300025907 Bacteria 22279
159 Ga0207645_10004708 3300025907 Bacteria 10038
160 Ga0207645_10021276 3300025907 Bacteria 4231
161 Ga0207645_10076637 3300025907 Bacteria 2142
162 Ga0207705_10158894 3300025909 Bacteria 1697
163 Ga0207684_10012463 3300025910 Bacteria 7393
164 Ga0207684_10287492 3300025910 Bacteria 1418
165 Ga0207695_10000246 3300025913 Bacteria 140972
166 Ga0207693_10001095 3300025915 Bacteria 24368
167 Ga0207663_10011119 3300025916 Bacteria 4820
168 Ga0207649_10001634 3300025920 Bacteria 13021
169 Ga0207649_10002706 3300025920 Bacteria 9817
170 Ga0207646_10036180 3300025922 Unclassified 4457
171 Ga0207646_10043900 3300025922 Unclassified 4013
172 Ga0207646_10124450 3300025922 Bacteria 2318
173 Ga0207681_10085881 3300025923 Unclassified 2234
174 Ga0207650_10021725 3300025925 Bacteria 4538
175 Ga0207650_10159483 3300025925 Unclassified 1786
176 Ga0207650_10236585 3300025925 Bacteria 1475
177 Ga0207659_10004701 3300025926 Bacteria 8276
178 Ga0207659_10043327 3300025926 Unclassified 3160
179 Ga0207659_10072994 3300025926 Bacteria 2511
180 Ga0207659_10168253 3300025926 Archaea 1727
181 Ga0207687_10073625 3300025927 Bacteria 2446
182 Ga0207700_10008854 3300025928 Bacteria 6257
183 Ga0207664_10253054 3300025929 Bacteria 1538
184 Ga0207644_10016927 3300025931 Unclassified 4912
185 Ga0207644_10025249 3300025931 Unclassified 4086
186 Ga0207690_10011659 3300025932 Bacteria 5255
187 Ga0207709_10000268 3300025935 Bacteria 61343
188 Ga0207669_10003417 3300025937 Bacteria 6868
189 Ga0207669_10024944 3300025937 Bacteria 3222
190 Ga0207669_10227425 3300025937 Unclassified 1374
191 Ga0207704_10028885 3300025938 Bacteria 3084
192 Ga0207665_10058367 3300025939 Bacteria 2609
193 Ga0207665_10060075 3300025939 Unclassified 2573
194 Ga0207691_10000297 3300025940 Bacteria 49253
195 Ga0207691_10005220 3300025940 Bacteria 12536
196 Ga0207679_10001370 3300025945 Bacteria 15359
197 Ga0207651_10121020 3300025960 Bacteria 1985
198 Ga0207677_10205414 3300026023 Unclassified 1569
199 Ga0207639_10000018 3300026041 Bacteria 250081
200 Ga0207641_10081137 3300026088 Unclassified 2816
201 Ga0207648_10000759 3300026089 Bacteria 36227
202 Ga0207648_10386728 3300026089 Archaea 1266
203 Ga0207683_10017330 3300026121 Bacteria 6139
204 Ga0207683_10025998 3300026121 Bacteria 5054
205 Ga0207683_10035278 3300026121 Bacteria 4349
206 Ga0207683_10070764 3300026121 Bacteria 3082
207 Ga0268266_10019994 3300028379 Bacteria 5706
208 Ga0268264_10000807 3300028381 Bacteria 33745
209 Ga0268264_10439701 3300028381 Bacteria 1261
210 Ga0268264_10502719 3300028381 Archaea 1182
211 Ga0265325_10067353 3300031241 Bacteria 1804
212 Ga0265327_10002819 3300031251 Bacteria 17551
213 Ga0265327_10012885 3300031251 Bacteria 5599
214 Ga0307408_100000036 3300031548 Bacteria 197635
215 Ga0307408_100003268 3300031548 Bacteria 11150
216 Ga0307408_100036404 3300031548 Bacteria 3460
217 Ga0307410_10137883 3300031852 Bacteria 1801
218 Ga0307406_10000366 3300031901 Bacteria 26254
219 Ga0307407_10000061 3300031903 Bacteria 44571
220 Ga0307407_10024163 3300031903 Bacteria 3183
221 Ga0307412_10000070 3300031911 Bacteria 107229
222 Ga0307414_10000044 3300032004 Bacteria 137202
223 Ga0307414_10033201 3300032004 Bacteria 3408
224 Ga0307411_10220143 3300032005 Bacteria 1472
225 Ga0373943_0012708 3300035170 Bacteria 3796
226 Ga0373943_0086732 3300035170 Unclassified 1614
227 Ga0373946_0084773 3300035171 Bacteria 1394
228 Ga0373955_0074486 3300035172 Bacteria 1905
229 Ga0373931_0051075 3300035691 Unclassified 2201
230 Ga0373935_0114333 3300035692 Unclassified 1795
231 Ga0373935_0123428 3300035692 Bacteria 1733
232 Ga0373927_0145071 3300035695 Unclassified 1553
233 Ga0373933_0042474 3300035724 Bacteria 2688
234 Ga0373947_0072980 3300035725 Bacteria 2108
235 Ga0373947_0169855 3300035725 Unclassified 1414
236 Ga0373937_0009765 3300036401 Bacteria 8367
237 Ga0373937_0133636 3300036401 Bacteria 2319
238 Ga0373925_0140260 3300037068 Bacteria 1891
239 Ga0373925_0155978 3300037068 Unclassified 1795
240 Ga0373925_0250120 3300037068 Bacteria 1421
241 Ga0395900_0069039 3300037418 Bacteria 3632
242 Ga0395905_0301112 3300037471 Unclassified 1491
243 Ga0436364_0251776 3300037853 Unclassified 2035
244 Ga0436364_0834308 3300037853 Unclassified 1389
245 Ga0395901_0151221 3300038443 Bacteria 2439
246 Ga0395901_0326602 3300038443 Bacteria 1587
247 Ga0436365_0589557 3300039437 Bacteria 7016
248 Ga0436365_0709130 3300039437 Bacteria 46894
249 Ga0436365_1094202 3300039437 Bacteria 7272
250 Ga0436365_1166744 3300039437 Bacteria 2802
251 Ga0436365_1667651 3300039437 Bacteria 24017
252 Ga0436365_1668993 3300039437 Bacteria 39268
253 Ga0436360_0607018 3300039438 Bacteria 3966
254 Ga0436360_0657450 3300039438 Bacteria 2602
255 Ga0436361_0310948 3300039447 Bacteria 4733
256 Ga0436361_0626131 3300039447 Bacteria 5281
257 Ga0436361_1010188 3300039447 Bacteria 1596
258 Ga0436361_1019012 3300039447 Bacteria 1292
259 Ga0436361_1029113 3300039447 Bacteria 4220
260 Ga0436361_1051797 3300039447 Bacteria 3202
261 Ga0436363_1473531 3300039450 Bacteria 11049
262 Ga0439453_0000478 3300041408 Bacteria 4385
263 Ga0450890_000055 3300042127 Bacteria 23022
264 Ga0450890_011718 3300042127 Bacteria 1134
265 Ga0450891_003000 3300042129 Bacteria 1658
266 Ga0450892_000099 3300042130 Bacteria 9522
267 Ga0450893_0000240 3300042532 Bacteria 7396
268 Ga0451576_0002928 3300045051 Bacteria 24282
269 Ga0495651_0013541 3300046462 Bacteria 6307
270 Ga0495580_0239333 3300046472 Unclassified 1245
271 Ga0495664_0059917 3300046477 Bacteria 2266
272 Ga0495608_0041582 3300046511 Bacteria 3076
273 Ga0495618_0020660 3300046514 Bacteria 4054
274 Ga0495628_0074304 3300046516 Bacteria 2648
275 Ga0495642_0007963 3300046528 Unclassified 4055
276 Ga0495652_0033778 3300046529 Bacteria 4462
277 Ga0495587_0083358 3300046536 Bacteria 1852
278 Ga0495598_0004706 3300046537 Bacteria 2976
279 Ga0495598_0007326 3300046537 Unclassified 2527
280 Ga0495645_0104108 3300046543 Bacteria 2016
281 Ga0495634_0055150 3300046642 Bacteria 2658
282 Ga0495659_0006107 3300046664 Unclassified 3807
283 Ga0495646_0176158 3300046680 Bacteria 1176
284 Ga0495647_0088954 3300046681 Unclassified 1263
285 Ga0495669_0008615 3300046684 Unclassified 4292
286 Ga0495613_0081251 3300046689 Bacteria 2355
287 Ga0495680_0254318 3300047322 Bacteria 1244
288 Ga0495675_0002212 3300047444 Bacteria 11606
289 Ga0495684_0006537 3300047471 Bacteria 9046
290 Ga0496101_0261650 3300048904 Bacteria 1349
291 Ga0496102_0053557 3300048905 Bacteria 3677
292 Ga0496103_0079925 3300048906 Unclassified 2055
293 Ga0496104_0053007 3300048907 Bacteria 3832
294 Ga0496105_0069624 3300048908 Unclassified 2908
295 Ga0496105_0230259 3300048908 Unclassified 1506
296 Ga0496106_0005798 3300048909 Bacteria 9129
297 Ga0496107_0024772 3300048910 Bacteria 4246
298 Ga0496108_0031615 3300048911 Bacteria 4393
299 Ga0496109_0107747 3300048912 Unclassified 2589
300 Ga0496109_0181797 3300048912 Archaea 1975
301 Ga0496109_0567619 3300048912 Bacteria 1070
302 Ga0496110_0107289 3300048913 Unclassified 2507
303 Ga0496110_0155963 3300048913 Unclassified 2068
304 Ga0496111_0297795 3300048914 Archaea 1196
305 Ga0496112_0016862 3300048915 Bacteria 6854
306 Ga0496112_0061497 3300048915 Unclassified 3702
307 Ga0496112_0346238 3300048915 Bacteria 1429
308 Ga0496113_0093072 3300048916 Bacteria 2326
309 Ga0496115_0010100 3300048918 Bacteria 7040
310 Ga0496115_0015920 3300048918 Bacteria 5715
311 Ga0501032_0004461 3300049569 Bacteria 10551
312 Ga0501033_0000010 3300049570 Bacteria 270511
313 Ga0501198_004525 3300049649 Bacteria 1932
314 Ga0501227_000310 3300049665 Bacteria 10134
315 nmdc:mga03683_91_c1 3300050489 Bacteria 32928
316 nmdc:mga03n38_39369_c1 3300050490 Unclassified 2050
317 nmdc:mga0k408_139_c1 3300050493 Bacteria 36706
318 nmdc:mga0k408_172065_c1 3300050493 Bacteria 1291
319 nmdc:mga0k408_334_c1 3300050493 Bacteria 25735
320 nmdc:mga07m45_12608_c2 3300050496 Bacteria 3111
321 nmdc:mga08y16_106499_c1 3300050511 Bacteria 2918
322 nmdc:mga0n895_479756_c1 3300050512 Unclassified 1254
323 nmdc:mga08x19_69877_c1 3300050514 Bacteria 2287
324 Ga0495601_0004912 3300053077 Bacteria 7762
325 Ga0495655_0001034 3300053083 Unclassified 4297
326 Ga0495595_0028026 3300053084 Bacteria 2513
327 Ga0500555_000257 3300053103 Bacteria 23409
328 Ga0500556_0000156 3300053104 Bacteria 57165
329 Ga0500658_0070897 3300053134 Unclassified 1470
330 Ga0500559_0004322 3300053136 Bacteria 6776
331 Ga0500559_0031750 3300053136 Bacteria 2266
332 Ga0500568_0001983 3300053139 Bacteria 12474
333 Ga0500616_0043959 3300053153 Bacteria 2385
334 Ga0500645_009811 3300053730 Bacteria 3203
335 Ga0500645_049969 3300053730 Bacteria 1222
336 Ga0070671_100048167
337 SwRhRL2b_contig_736758
338 CNXas_1000098
339 JGI24744J21845_10007701
340 JGI24033J26618_1000014
341 rootH2_10000114
342 Ga0065704_10002826
343 Ga0065712_10004304
344 Ga0065707_10010793
345 Ga0070658_10004555
346 Ga0070658_10053769
347 Ga0070658_10057689
348 Ga0070676_10000524
349 Ga0070676_10003120
350 Ga0070690_100099365
351 Ga0070670_100088733
352 Ga0070670_100354377
353 Ga0070666_10002500
354 Ga0070666_10009998
355 Ga0068868_100027783
356 Ga0068868_100039352
357 Ga0070660_100064030
358 Ga0070661_100001159
359 Ga0070668_100002535
360 Ga0070668_100006269
361 Ga0070668_100022255
362 Ga0070668_100189657
363 Ga0070675_100002782
364 Ga0070675_100067730
365 Ga0070675_100256160
366 Ga0070671_100002816
367 Ga0070671_100092913
368 Ga0070674_100001445
369 Ga0070674_100082704
370 Ga0070673_100004315
371 Ga0070673_100022953
372 Ga0070688_100025833
373 Ga0070659_100018749
374 Ga0070667_100018981
375 Ga0070667_100191183
376 Ga0070709_10192248
377 Ga0070714_100284154
378 Ga0070713_100004516
379 Ga0070713_100321889
380 Ga0070710_10054199
381 Ga0070710_10077004
382 Ga0070711_100008874
383 Ga0070711_100197180
384 Ga0070705_100101289
385 Ga0070678_100031467
386 Ga0068867_100000238
387 Ga0068867_100079298
388 Ga0068867_100113346
389 Ga0070706_100002546
390 Ga0070706_100004217
391 Ga0070706_100066485
392 Ga0070706_100263778
393 Ga0070706_100382895
394 Ga0070706_100578560
395 Ga0070707_100035525
396 Ga0070707_100094466
397 Ga0070707_100270768
398 Ga0070707_100350087
399 Ga0070698_100000343
400 Ga0070698_100005638
401 Ga0070698_100056617
402 Ga0070698_100256256
403 Ga0070699_100092244
404 Ga0070699_100257311
405 Ga0070697_100006834
406 Ga0070697_100008344
407 Ga0070697_100053749
408 Ga0070697_100108627
409 Ga0068853_100000010
410 Ga0070672_100004200
411 Ga0070672_100019454
412 Ga0070696_100024743
413 Ga0070693_100140152
414 Ga0070665_100096124
415 Ga0070665_100123921
416 Ga0070664_100001295
417 Ga0068857_100106721
418 Ga0070702_100027829
419 Ga0068852_100180983
420 Ga0068866_10011930
421 Ga0068863_100039851
422 Ga0068863_100375351
423 Ga0068858_100043223
424 Ga0068860_100000107
425 Ga0068860_100371137
426 Ga0068862_100150510
427 Ga0068862_100152265
428 Ga0081540_1000380
429 Ga0081540_1048504
430 Ga0081539_10065818
431 Ga0070717_10002602
432 Ga0070717_10256468
433 Ga0075363_100016200
434 Ga0070715_10075844
435 Ga0070712_100014127
436 Ga0070712_100171830
437 Ga0075362_10000170
438 Ga0097621_100033099
439 Ga0075370_10026954
440 Ga0068871_100245803
441 Ga0068871_100283424
442 Ga0075434_100087002
443 Ga0075434_100218087
444 Ga0068865_100030735
445 Ga0068865_100126250
446 Ga0075435_100251602
447 Ga0105240_10000026
448 Ga0105245_10101455
449 Ga0105245_10169086
450 Ga0105247_10269908
451 Ga0105243_10000253
452 Ga0157373_10007527
453 Ga0157371_10183247
454 Ga0157370_10000735
455 Ga0157374_10000030
456 Ga0157374_10048868
457 Ga0157374_10058964
458 Ga0157378_10003406
459 Ga0157378_10016705
460 Ga0157378_10095438
461 Ga0157378_10299320
462 Ga0163162_10010592
463 Ga0163162_10011221
464 Ga0163162_10505371
465 Ga0157372_10004490
466 Ga0157372_10012764
467 Ga0157372_10477923
468 Ga0157375_10007535
469 Ga0157375_10212264
470 Ga0157375_10288097
471 Ga0163163_10064720
472 Ga0157376_10000110
473 Ga0157376_10079625
474 Ga0163161_10025407
475 Ga0163161_10061620
476 Ga0213876_10000896
477 Ga0213876_10001388
478 Ga0213876_10005257
479 Ga0213876_10049730
480 Ga0207673_1004598
481 Ga0207697_10000199
482 Ga0207697_10000391
483 Ga0207697_10001557
484 Ga0207697_10027976
485 Ga0207682_10019342
486 Ga0207692_10075749
487 Ga0207642_10006665
488 Ga0207688_10000927
489 Ga0207688_10001043
490 Ga0207680_10036165
491 Ga0207685_10078049
492 Ga0207699_10020017
493 Ga0207645_10001104
494 Ga0207645_10004708
495 Ga0207645_10021276
496 Ga0207645_10076637
497 Ga0207705_10158894
498 Ga0207684_10012463
499 Ga0207684_10287492
500 Ga0207695_10000246
501 Ga0207693_10001095
502 Ga0207663_10011119
503 Ga0207649_10001634
504 Ga0207649_10002706
505 Ga0207646_10036180
506 Ga0207646_10043900
507 Ga0207646_10124450
508 Ga0207681_10085881
509 Ga0207650_10021725
510 Ga0207650_10159483
511 Ga0207650_10236585
512 Ga0207659_10004701
513 Ga0207659_10043327
514 Ga0207659_10072994
515 Ga0207659_10168253
516 Ga0207687_10073625
517 Ga0207700_10008854
518 Ga0207664_10253054
519 Ga0207644_10016927
520 Ga0207644_10025249
521 Ga0207690_10011659
522 Ga0207709_10000268
523 Ga0207669_10003417
524 Ga0207669_10024944
525 Ga0207669_10227425
526 Ga0207704_10028885
527 Ga0207665_10058367
528 Ga0207665_10060075
529 Ga0207691_10000297
530 Ga0207691_10005220
531 Ga0207679_10001370
532 Ga0207651_10121020
533 Ga0207677_10205414
534 Ga0207639_10000018
535 Ga0207641_10081137
536 Ga0207648_10000759
537 Ga0207648_10386728
538 Ga0207683_10017330
539 Ga0207683_10025998
540 Ga0207683_10035278
541 Ga0207683_10070764
542 Ga0268266_10019994
543 Ga0268264_10000807
544 Ga0268264_10439701
545 Ga0268264_10502719
546 Ga0265325_10067353
547 Ga0265327_10002819
548 Ga0265327_10012885
549 Ga0307408_100000036
550 Ga0307408_100003268
551 Ga0307408_100036404
552 Ga0307410_10137883
553 Ga0307406_10000366
554 Ga0307407_10000061
555 Ga0307407_10024163
556 Ga0307412_10000070
557 Ga0307414_10000044
558 Ga0307414_10033201
559 Ga0307411_10220143
560 Ga0373943_0012708
561 Ga0373943_0086732
562 Ga0373946_0084773
563 Ga0373955_0074486
564 Ga0373931_0051075
565 Ga0373935_0114333
566 Ga0373935_0123428
567 Ga0373927_0145071
568 Ga0373933_0042474
569 Ga0373947_0072980
570 Ga0373947_0169855
571 Ga0373937_0009765
572 Ga0373937_0133636
573 Ga0373925_0140260
574 Ga0373925_0155978
575 Ga0373925_0250120
576 Ga0395900_0069039
577 Ga0395905_0301112
578 Ga0436364_0251776
579 Ga0436364_0834308
580 Ga0395901_0151221
581 Ga0395901_0326602
582 Ga0436365_0589557
583 Ga0436365_0709130
584 Ga0436365_1094202
585 Ga0436365_1166744
586 Ga0436365_1667651
587 Ga0436365_1668993
588 Ga0436360_0607018
589 Ga0436360_0657450
590 Ga0436361_0310948
591 Ga0436361_0626131
592 Ga0436361_1010188
593 Ga0436361_1019012
594 Ga0436361_1029113
595 Ga0436361_1051797
596 Ga0436363_1473531
597 Ga0439453_0000478
598 Ga0450890_000055
599 Ga0450890_011718
600 Ga0450891_003000
601 Ga0450892_000099
602 Ga0450893_0000240
603 Ga0451576_0002928
604 Ga0495651_0013541
605 Ga0495580_0239333
606 Ga0495664_0059917
607 Ga0495608_0041582
608 Ga0495618_0020660
609 Ga0495628_0074304
610 Ga0495642_0007963
611 Ga0495652_0033778
612 Ga0495587_0083358
613 Ga0495598_0004706
614 Ga0495598_0007326
615 Ga0495645_0104108
616 Ga0495634_0055150
617 Ga0495659_0006107
618 Ga0495646_0176158
619 Ga0495647_0088954
620 Ga0495669_0008615
621 Ga0495613_0081251
622 Ga0495680_0254318
623 Ga0495675_0002212
624 Ga0495684_0006537
625 Ga0496101_0261650
626 Ga0496102_0053557
627 Ga0496103_0079925
628 Ga0496104_0053007
629 Ga0496105_0069624
630 Ga0496105_0230259
631 Ga0496106_0005798
632 Ga0496107_0024772
633 Ga0496108_0031615
634 Ga0496109_0107747
635 Ga0496109_0181797
636 Ga0496109_0567619
637 Ga0496110_0107289
638 Ga0496110_0155963
639 Ga0496111_0297795
640 Ga0496112_0016862
641 Ga0496112_0061497
642 Ga0496112_0346238
643 Ga0496113_0093072
644 Ga0496115_0010100
645 Ga0496115_0015920
646 Ga0501032_0004461
647 Ga0501033_0000010
648 Ga0501198_004525
649 Ga0501227_000310
650 nmdc:mga03683_91_c1
651 nmdc:mga03n38_39369_c1
652 nmdc:mga0k408_139_c1
653 nmdc:mga0k408_172065_c1
654 nmdc:mga0k408_334_c1
655 nmdc:mga07m45_12608_c2
656 nmdc:mga08y16_106499_c1
657 nmdc:mga0n895_479756_c1
658 nmdc:mga08x19_69877_c1
659 Ga0495601_0004912
660 Ga0495655_0001034
661 Ga0495595_0028026
662 Ga0500555_000257
663 Ga0500556_0000156
664 Ga0500658_0070897
665 Ga0500559_0004322
666 Ga0500559_0031750
667 Ga0500568_0001983
668 Ga0500616_0043959
669 Ga0500645_009811
670 Ga0500645_049969

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01207

Dus

Dihydrouridine synthase (Dus)

35

347

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vhn-assembly1.cif.gz_A crystal structure of a putative flavin oxidoreductase with flavin 0.9374 13 321
6ei9-assembly2.cif.gz_B crystal structure of e. coli trna-dihydrouridine synthase b (dusb) 0.9231 1 321
1vhn-assembly1.cif.gz_A crystal structure of a putative flavin oxidoreductase with flavin 0.9168 13 321
6ei9-assembly2.cif.gz_B crystal structure of e. coli trna-dihydrouridine synthase b (dusb) 0.9064 1 321
3w9z-assembly1.cif.gz_A crystal structure of dusc 0.8454 13 320
ID Description Score Start End Superfamily
af_Q9VIS4_253_495_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9694 13 243 3.20.20.70
af_P0ABT5_6_247_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9635 14 251 3.20.20.70
af_Q9TYN2_201_445_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9576 13 243 3.20.20.70
af_P9WNS7_19_267_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9468 13 243 3.20.20.70
1vhnA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9412 13 252 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3D2UG72-F1-model_v4 tRNA dihydrouridine synthase DusB 0.9881 9 102 GO:0003723
GO:0017150
AF-A0A381GYA8-F1-model_v4 deleted 0.9806 139 254
AF-A0A3M8BMD3-F1-model_v4 tRNA dihydrouridine synthase DusB 0.9714 125 251 GO:0003723
GO:0017150
AF-J9F967-F1-model_v4 tRNA-dihydrouridine synthase (EC 1.-.-.-) 0.9708 44 197 GO:0003723
GO:0017150
GO:0050660
AF-A0A1G7IXL2-F1-model_v4 tRNA-dihydrouridine synthase (EC 1.3.1.-) 0.9703 9 320 GO:0000049
GO:0017150
GO:0050660

Map