F412147

General Info

Members Datasets Scaffolds Average Seq Length
335 234 670 222

Family's Representative Sequence

Representative Sequence 3300005543|Ga0070672_100000104|Ga0070672_10000010417
Length 230
Sequence MIRPMAELNLVLLGPPGSGKGTQGERLNEDLRLPYYATGDILRAAVREETELGRAAKEYMDRGDLVPDEVIVAVIAERIGSSEALDGFILDGFPRTTPQAEALDAKLSELGRGVTAVLLIDVADDEVVRRLGGRRTCEANGHVFHVEFEPPKEEGVCDIDGSRLIVRDDDKPEVIRKRLETYHEKTEPLVSYYDSRGVLRRIEGEAAPEEVAEQIRRTLATMRMEQDEAV

Samples

Sample ID Description Type Environment
1 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
119 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
126 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
127 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
128 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
129 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
130 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
131 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
132 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
226 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
227 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
230 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
231 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.6
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.39
Nodule 0
Rhizoplane 7.76
Rhizosphere 86.57
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070672_100000104 3300005543 Bacteria 42077
2 JGI24746J21847_1000007 3300001977 Bacteria 20037
3 Ga0065707_10087143 3300005295 Bacteria 5147
4 Ga0070658_10019454 3300005327 Bacteria 5437
5 Ga0070683_100011264 3300005329 Bacteria 7719
6 Ga0070683_100103396 3300005329 Bacteria 2684
7 Ga0070683_100162836 3300005329 Bacteria 2117
8 Ga0068869_100201096 3300005334 Bacteria 1571
9 Ga0070666_10073588 3300005335 Bacteria 2327
10 Ga0070682_100000032 3300005337 Bacteria 155141
11 Ga0068868_100008360 3300005338 Bacteria 7408
12 Ga0070689_100344263 3300005340 Bacteria 1249
13 Ga0070691_10004069 3300005341 Bacteria 6629
14 Ga0070661_100000236 3300005344 Bacteria 45535
15 Ga0070661_100208553 3300005344 Bacteria 1495
16 Ga0070661_100455963 3300005344 Bacteria 1018
17 Ga0070692_10208773 3300005345 Bacteria 1148
18 Ga0070668_100012523 3300005347 Bacteria 6316
19 Ga0070668_100043738 3300005347 Bacteria 3435
20 Ga0070675_100003153 3300005354 Bacteria 12477
21 Ga0070671_100453109 3300005355 Bacteria 1101
22 Ga0070688_100000168 3300005365 Bacteria 35364
23 Ga0070688_100000562 3300005365 Bacteria 18826
24 Ga0070688_100145408 3300005365 Bacteria 1615
25 Ga0070659_100140970 3300005366 Bacteria 1963
26 Ga0070667_100001611 3300005367 Bacteria 20202
27 Ga0070667_100051933 3300005367 Bacteria 3457
28 Ga0070714_100036840 3300005435 Bacteria 4106
29 Ga0070713_100000171 3300005436 Bacteria 43503
30 Ga0070713_100102600 3300005436 Bacteria 2481
31 Ga0070701_10080489 3300005438 Bacteria 1762
32 Ga0070700_100074204 3300005441 Bacteria 2179
33 Ga0070663_100024140 3300005455 Bacteria 4087
34 Ga0070663_100778605 3300005455 Bacteria 819
35 Ga0070678_100023357 3300005456 Bacteria 4119
36 Ga0070685_10000246 3300005466 Bacteria 35364
37 Ga0070685_10001063 3300005466 Bacteria 14725
38 Ga0070679_100000832 3300005530 Bacteria 26815
39 Ga0070684_100065586 3300005535 Bacteria 3187
40 Ga0070684_100067227 3300005535 Bacteria 3147
41 Ga0070684_100098552 3300005535 Bacteria 2608
42 Ga0070665_100051471 3300005548 Bacteria 4130
43 Ga0070665_100065177 3300005548 Bacteria 3654
44 Ga0070665_100276946 3300005548 Bacteria 1680
45 Ga0070664_100085966 3300005564 Bacteria 2717
46 Ga0070664_100153083 3300005564 Bacteria 2037
47 Ga0068857_100311195 3300005577 Bacteria 1453
48 Ga0068854_100000939 3300005578 Bacteria 17543
49 Ga0068856_100007857 3300005614 Bacteria 10417
50 Ga0068852_100000024 3300005616 Bacteria 120479
51 Ga0068859_101102345 3300005617 Bacteria 873
52 Ga0068866_10010127 3300005718 Bacteria 4031
53 Ga0068851_10007702 3300005834 Bacteria 4952
54 Ga0068851_10018801 3300005834 Bacteria 3334
55 Ga0068863_100008951 3300005841 Bacteria 9775
56 Ga0068863_100302345 3300005841 Bacteria 1552
57 Ga0068858_100360906 3300005842 Bacteria 1392
58 Ga0068860_100076698 3300005843 Bacteria 3179
59 Ga0068862_100001247 3300005844 Bacteria 23931
60 Ga0081455_10063685 3300005937 Bacteria 3092
61 Ga0081540_1000281 3300005983 Bacteria 52990
62 Ga0081540_1045901 3300005983 Bacteria 2212
63 Ga0081539_10002195 3300005985 Bacteria 28613
64 Ga0075363_100308305 3300006048 Bacteria 919
65 Ga0070715_10248864 3300006163 Bacteria 928
66 Ga0070712_100333416 3300006175 Bacteria 1237
67 Ga0075370_10367529 3300006353 Bacteria 861
68 Ga0075430_100043648 3300006846 Bacteria 3790
69 Ga0075433_10004429 3300006852 Bacteria 10932
70 Ga0075434_100992962 3300006871 Bacteria 853
71 Ga0068865_100000024 3300006881 Bacteria 94969
72 Ga0097620_101102450 3300006931 Bacteria 873
73 Ga0105240_10402473 3300009093 Bacteria 1541
74 Ga0105245_10000528 3300009098 Bacteria 35016
75 Ga0105245_10019614 3300009098 Bacteria 5924
76 Ga0105247_10019328 3300009101 Bacteria 4089
77 Ga0105247_10193652 3300009101 Bacteria 1362
78 Ga0105243_10006175 3300009148 Bacteria 9263
79 Ga0105241_10287652 3300009174 Bacteria 1406
80 Ga0105242_10000123 3300009176 Bacteria 56900
81 Ga0105242_10003277 3300009176 Bacteria 12618
82 Ga0105248_10001735 3300009177 Bacteria 24226
83 Ga0105238_10322187 3300009551 Bacteria 1532
84 Ga0105238_10432182 3300009551 Bacteria 1312
85 Ga0105030_108643 3300009987 Bacteria 867
86 Ga0105239_10032561 3300010375 Bacteria 5728
87 Ga0105239_10183680 3300010375 Bacteria 2340
88 Ga0105239_10320952 3300010375 Bacteria 1746
89 Ga0157370_10213556 3300013104 Bacteria 1788
90 Ga0157369_10000068 3300013105 Bacteria 144274
91 Ga0157378_10048351 3300013297 Bacteria 3782
92 Ga0157378_10104189 3300013297 Bacteria 2593
93 Ga0157378_10233477 3300013297 Bacteria 1754
94 Ga0163162_10088547 3300013306 Bacteria 3175
95 Ga0163162_11207412 3300013306 Bacteria 858
96 Ga0157372_10000809 3300013307 Bacteria 33940
97 Ga0157375_10016258 3300013308 Bacteria 6675
98 Ga0157375_10600233 3300013308 Bacteria 1260
99 Ga0163163_10471068 3300014325 Bacteria 1317
100 Ga0157380_10000326 3300014326 Bacteria 28781
101 Ga0157379_10025779 3300014968 Bacteria 5226
102 Ga0157376_10060903 3300014969 Bacteria 3172
103 Ga0157376_10067012 3300014969 Bacteria 3036
104 Ga0157376_10334933 3300014969 Bacteria 1443
105 Ga0206354_11410537 3300020081 Bacteria 1114
106 Ga0224712_10004702 3300022467 Bacteria 3712
107 Ga0207656_10000374 3300025321 Bacteria 15006
108 Ga0207656_10001048 3300025321 Bacteria 9048
109 Ga0207642_10007311 3300025899 Bacteria 3722
110 Ga0207710_10000220 3300025900 Bacteria 50023
111 Ga0207710_10034933 3300025900 Bacteria 2211
112 Ga0207680_10010652 3300025903 Bacteria 4610
113 Ga0207680_10163663 3300025903 Bacteria 1494
114 Ga0207705_10014343 3300025909 Bacteria 5703
115 Ga0207649_10000166 3300025920 Bacteria 53758
116 Ga0207649_10384407 3300025920 Bacteria 1047
117 Ga0207652_10000917 3300025921 Bacteria 27806
118 Ga0207694_10380094 3300025924 Bacteria 1172
119 Ga0207659_10000138 3300025926 Bacteria 42755
120 Ga0207687_10000025 3300025927 Bacteria 175177
121 Ga0207687_10002690 3300025927 Bacteria 12023
122 Ga0207700_10000019 3300025928 Bacteria 183117
123 Ga0207664_10013567 3300025929 Bacteria 5855
124 Ga0207644_10501598 3300025931 Bacteria 1001
125 Ga0207690_10003914 3300025932 Bacteria 8802
126 Ga0207686_10000066 3300025934 Bacteria 95095
127 Ga0207686_10001614 3300025934 Bacteria 12622
128 Ga0207709_10002223 3300025935 Bacteria 12376
129 Ga0207670_10297906 3300025936 Bacteria 1262
130 Ga0207704_10000308 3300025938 Bacteria 22892
131 Ga0207691_10000430 3300025940 Bacteria 41789
132 Ga0207711_10000011 3300025941 Bacteria 518817
133 Ga0207689_10251183 3300025942 Bacteria 1462
134 Ga0207661_10000518 3300025944 Bacteria 24943
135 Ga0207661_10000616 3300025944 Bacteria 22858
136 Ga0207661_10009756 3300025944 Bacteria 6896
137 Ga0207661_10153591 3300025944 Bacteria 1992
138 Ga0207679_10006381 3300025945 Bacteria 7448
139 Ga0207712_10809954 3300025961 Bacteria 824
140 Ga0207668_10011784 3300025972 Bacteria 5327
141 Ga0207668_10028292 3300025972 Bacteria 3663
142 Ga0207640_10000821 3300025981 Bacteria 17670
143 Ga0207658_10000840 3300025986 Bacteria 25652
144 Ga0207658_10109895 3300025986 Bacteria 2177
145 Ga0207677_10001476 3300026023 Bacteria 12436
146 Ga0207703_10533339 3300026035 Bacteria 1105
147 Ga0207678_10244452 3300026067 Bacteria 1537
148 Ga0207678_10300116 3300026067 Bacteria 1380
149 Ga0207708_10156105 3300026075 Bacteria 1800
150 Ga0207702_10002042 3300026078 Bacteria 19546
151 Ga0207641_10015727 3300026088 Bacteria 6200
152 Ga0207641_10105321 3300026088 Bacteria 2491
153 Ga0207674_10330824 3300026116 Bacteria 1473
154 Ga0207675_100664139 3300026118 Bacteria 1049
155 Ga0207683_10038808 3300026121 Bacteria 4154
156 Ga0207698_10000014 3300026142 Bacteria 240703
157 Ga0207698_10032167 3300026142 Bacteria 3797
158 Ga0268266_10001628 3300028379 Bacteria 26120
159 Ga0268266_10018264 3300028379 Bacteria 5979
160 Ga0268266_10055970 3300028379 Bacteria 3392
161 Ga0268265_10000667 3300028380 Bacteria 34047
162 Ga0268264_10846754 3300028381 Bacteria 916
163 Ga0265319_1000030 3300028563 Bacteria 129742
164 Ga0265338_10000156 3300028800 Bacteria 125065
165 Ga0316181_1236952 3300030744 Bacteria 1363
166 Ga0316182_1103924 3300030745 Bacteria 6246
167 Ga0265325_10010101 3300031241 Bacteria 5483
168 Ga0265327_10102824 3300031251 Bacteria 1376
169 Ga0316575_10179342 3300031665 Unclassified 879
170 Ga0307405_10581697 3300031731 Bacteria 911
171 Ga0307412_10547488 3300031911 Bacteria 971
172 Ga0439465_0153680 3300041413 Bacteria 823
173 Ga0451807_2709994 3300041486 Bacteria 1126
174 Ga0451833_0601880 3300041491 Bacteria 3363
175 Ga0451833_0895723 3300041491 Bacteria 2705
176 Ga0451837_1001135 3300041494 Bacteria 6440
177 Ga0451845_0823628 3300041501 Bacteria 1919
178 Ga0451853_0406739 3300041512 Bacteria 1125
179 Ga0439445_0028057 3300042004 Bacteria 1449
180 Ga0439445_0032745 3300042004 Bacteria 1356
181 Ga0439432_007856 3300042006 Bacteria 3762
182 Ga0451577_0000328 3300042876 Bacteria 88518
183 Ga0451577_0087004 3300042876 Bacteria 2788
184 Ga0451577_0126618 3300042876 Bacteria 2289
185 Ga0451577_0158136 3300042876 Bacteria 2040
186 Ga0453683_0000002 3300044673 Bacteria 1244396
187 Ga0453683_0000848 3300044673 Bacteria 29516
188 Ga0453683_0003668 3300044673 Bacteria 11245
189 Ga0453683_0030691 3300044673 Bacteria 3397
190 Ga0453684_0000950 3300044712 Bacteria 95538
191 Ga0453684_0005204 3300044712 Bacteria 26125
192 Ga0453684_0028025 3300044712 Bacteria 8053
193 Ga0466957_0004792 3300044842 Bacteria 7572
194 Ga0466957_0043709 3300044842 Bacteria 2714
195 Ga0466960_0059318 3300044901 Bacteria 1872
196 Ga0451576_0000151 3300045051 Bacteria 176466
197 Ga0451576_0005912 3300045051 Bacteria 15170
198 Ga0451576_0417213 3300045051 Bacteria 1408
199 Ga0466958_0138861 3300045836 Bacteria 1529
200 Ga0466967_0000003 3300045976 Bacteria 169144
201 Ga0495592_0130275 3300046454 Bacteria 1760
202 Ga0495592_0219027 3300046454 Bacteria 1274
203 Ga0495629_0000543 3300046459 Bacteria 31107
204 Ga0495629_0033292 3300046459 Bacteria 3646
205 Ga0495629_0140631 3300046459 Bacteria 1679
206 Ga0495641_0023186 3300046461 Bacteria 3089
207 Ga0495651_0050048 3300046462 Bacteria 3225
208 Ga0495653_0067045 3300046463 Bacteria 2697
209 Ga0495594_0000001 3300046499 Bacteria 293051
210 Ga0495606_0000283 3300046507 Bacteria 88309
211 Ga0495608_0000010 3300046511 Bacteria 258660
212 Ga0495628_0000864 3300046516 Bacteria 28036
213 Ga0495628_0176466 3300046516 Bacteria 1618
214 Ga0495630_0000148 3300046517 Bacteria 54619
215 Ga0495630_0000395 3300046517 Bacteria 34351
216 Ga0495630_0028236 3300046517 Bacteria 4169
217 Ga0495652_0000009 3300046529 Bacteria 311000
218 Ga0495640_0009674 3300046533 Bacteria 7495
219 Ga0495587_0029873 3300046536 Bacteria 3307
220 Ga0495587_0054221 3300046536 Bacteria 2363
221 Ga0495587_0256387 3300046536 Bacteria 983
222 Ga0495645_0004698 3300046543 Bacteria 9326
223 Ga0495622_0000069 3300046557 Bacteria 89759
224 Ga0495667_0010689 3300046559 Bacteria 6207
225 Ga0495625_0000109 3300046660 Bacteria 125064
226 Ga0495625_0118853 3300046660 Bacteria 1800
227 Ga0495635_0087861 3300046663 Bacteria 2127
228 Ga0495588_0000175 3300046674 Bacteria 80911
229 Ga0495657_0000005 3300046675 Bacteria 254860
230 Ga0495657_0014713 3300046675 Bacteria 5742
231 Ga0495647_0000114 3300046681 Bacteria 20349
232 Ga0495658_0006678 3300046683 Bacteria 5671
233 Ga0495613_0000087 3300046689 Bacteria 88644
234 Ga0495624_0000429 3300046690 Bacteria 33305
235 Ga0495600_0019425 3300046809 Bacteria 4339
236 Ga0495660_0144283 3300046810 Bacteria 1181
237 Ga0495604_0000322 3300047317 Bacteria 42966
238 Ga0495674_0000141 3300047319 Bacteria 55539
239 Ga0495672_0116441 3300047320 Bacteria 1427
240 Ga0495676_0000522 3300047321 Bacteria 31518
241 Ga0495676_0034901 3300047321 Bacteria 4214
242 Ga0495680_0075724 3300047322 Bacteria 2553
243 Ga0495680_0091590 3300047322 Bacteria 2279
244 Ga0495675_0000398 3300047444 Bacteria 30075
245 Ga0495684_0141338 3300047471 Bacteria 1805
246 Ga0495686_0217173 3300047472 Bacteria 1089
247 Ga0495602_0000038 3300048088 Bacteria 130758
248 Ga0495602_0003702 3300048088 Bacteria 15861
249 Ga0495602_0037972 3300048088 Bacteria 4460
250 Ga0495602_0223358 3300048088 Bacteria 1420
251 Ga0496100_0000028 3300048903 Bacteria 113912
252 Ga0496101_0000005 3300048904 Bacteria 331455
253 Ga0496102_0000021 3300048905 Bacteria 246920
254 Ga0496102_0176450 3300048905 Bacteria 2012
255 Ga0496103_0000001 3300048906 Bacteria 643471
256 Ga0496104_0000029 3300048907 Bacteria 202968
257 Ga0496104_0037414 3300048907 Bacteria 4539
258 Ga0496104_0056802 3300048907 Bacteria 3703
259 Ga0496105_0000002 3300048908 Bacteria 753215
260 Ga0496106_0000070 3300048909 Bacteria 82770
261 Ga0496106_0218603 3300048909 Bacteria 1519
262 Ga0496107_0000004 3300048910 Bacteria 297680
263 Ga0496107_0017709 3300048910 Bacteria 5013
264 Ga0496108_0000042 3300048911 Bacteria 146397
265 Ga0496108_0002451 3300048911 Bacteria 14838
266 Ga0496109_0000034 3300048912 Bacteria 160397
267 Ga0496109_0000062 3300048912 Bacteria 112843
268 Ga0496110_0000325 3300048913 Bacteria 31707
269 Ga0496110_0077462 3300048913 Bacteria 2958
270 Ga0496111_0000171 3300048914 Bacteria 29367
271 Ga0496112_0017988 3300048915 Bacteria 6650
272 Ga0496113_0000002 3300048916 Bacteria 220193
273 Ga0496114_0000097 3300048917 Bacteria 63410
274 Ga0496114_0137030 3300048917 Bacteria 2117
275 Ga0496115_0000151 3300048918 Bacteria 64493
276 Ga0496119_0015147 3300048922 Bacteria 5967
277 Ga0496119_0188351 3300048922 Bacteria 1077
278 Ga0496121_0029534 3300048924 Bacteria 5066
279 Ga0496124_0203023 3300048927 Bacteria 1506
280 Ga0496124_0293280 3300048927 Bacteria 1179
281 Ga0501031_0016044 3300049568 Bacteria 4863
282 Ga0501032_0223940 3300049569 Bacteria 1224
283 Ga0501032_0294038 3300049569 Bacteria 1050
284 Ga0501034_0009432 3300049571 Bacteria 10214
285 Ga0501034_0738539 3300049571 Bacteria 880
286 Ga0501036_0197014 3300049572 Bacteria 1695
287 Ga0501037_0141622 3300049573 Bacteria 1720
288 Ga0501038_0178030 3300049574 Bacteria 1717
289 Ga0501039_0185534 3300049575 Bacteria 1636
290 Ga0501039_0187959 3300049575 Bacteria 1624
291 Ga0501040_0148635 3300049576 Bacteria 1652
292 Ga0501042_0020760 3300049578 Bacteria 4573
293 Ga0501043_0004838 3300049579 Bacteria 10893
294 Ga0501043_0635300 3300049579 Bacteria 785
295 Ga0501046_0001288 3300049580 Bacteria 24284
296 Ga0501047_0006076 3300049581 Bacteria 11348
297 Ga0501047_0031813 3300049581 Bacteria 5090
298 Ga0501047_0231925 3300049581 Bacteria 1699
299 Ga0501048_0020228 3300049582 Bacteria 4878
300 Ga0501067_0074750 3300049583 Bacteria 1878
301 Ga0501068_0159494 3300049584 Bacteria 1421
302 Ga0501068_0574508 3300049584 Bacteria 734
303 Ga0501069_0175114 3300049585 Bacteria 1239
304 Ga0501070_0000267 3300049586 Bacteria 49167
305 Ga0501070_0064865 3300049586 Bacteria 3024
306 Ga0501073_0121466 3300049589 Bacteria 1810
307 Ga0501079_0110131 3300049741 Bacteria 2139
308 Ga0501080_0349922 3300049742 Bacteria 1334
309 Ga0501080_0671530 3300049742 Bacteria 915
310 Ga0501083_0018653 3300049744 Bacteria 4833
311 Ga0501035_0000877 3300049822 Bacteria 31897
312 Ga0501044_0001422 3300049823 Bacteria 28073
313 Ga0501045_0174664 3300049824 Bacteria 1600
314 nmdc:mga03n38_295362_c1 3300050490 Bacteria 869
315 nmdc:mga00v17_209932_c1 3300050491 Bacteria 1260
316 nmdc:mga07m45_229969_c1 3300050496 Bacteria 1079
317 nmdc:mga0qj67_251582_c1 3300050509 Bacteria 1434
318 nmdc:mga0a205_15_c2 3300050515 Bacteria 75060
319 Ga0495601_0000698 3300053077 Bacteria 18035
320 Ga0495601_0090130 3300053077 Bacteria 1972
321 Ga0495612_0001451 3300053078 Bacteria 9769
322 Ga0495655_0000013 3300053083 Bacteria 63264
323 Ga0495655_0000120 3300053083 Bacteria 14477
324 Ga0495595_0000005 3300053084 Bacteria 258660
325 Ga0495595_0309950 3300053084 Bacteria 794
326 Ga0495619_0000036 3300053085 Bacteria 125188
327 Ga0495619_0000069 3300053085 Bacteria 82755
328 Ga0495619_0000489 3300053085 Bacteria 26595
329 Ga0495619_0001945 3300053085 Bacteria 13767
330 Ga0500566_0013929 3300053094 Bacteria 4727
331 Ga0500641_0008993 3300053096 Bacteria 3580
332 Ga0500628_000045 3300053129 Bacteria 45042
333 Ga0501084_0215435 3300054114 Bacteria 1620
334 Ga0501082_0235196 3300060353 Bacteria 1594
335 2645723815 2643221962 Bacteria 3874254
336 Ga0070672_100000104
337 JGI24746J21847_1000007
338 Ga0065707_10087143
339 Ga0070658_10019454
340 Ga0070683_100011264
341 Ga0070683_100103396
342 Ga0070683_100162836
343 Ga0068869_100201096
344 Ga0070666_10073588
345 Ga0070682_100000032
346 Ga0068868_100008360
347 Ga0070689_100344263
348 Ga0070691_10004069
349 Ga0070661_100000236
350 Ga0070661_100208553
351 Ga0070661_100455963
352 Ga0070692_10208773
353 Ga0070668_100012523
354 Ga0070668_100043738
355 Ga0070675_100003153
356 Ga0070671_100453109
357 Ga0070688_100000168
358 Ga0070688_100000562
359 Ga0070688_100145408
360 Ga0070659_100140970
361 Ga0070667_100001611
362 Ga0070667_100051933
363 Ga0070714_100036840
364 Ga0070713_100000171
365 Ga0070713_100102600
366 Ga0070701_10080489
367 Ga0070700_100074204
368 Ga0070663_100024140
369 Ga0070663_100778605
370 Ga0070678_100023357
371 Ga0070685_10000246
372 Ga0070685_10001063
373 Ga0070679_100000832
374 Ga0070684_100065586
375 Ga0070684_100067227
376 Ga0070684_100098552
377 Ga0070665_100051471
378 Ga0070665_100065177
379 Ga0070665_100276946
380 Ga0070664_100085966
381 Ga0070664_100153083
382 Ga0068857_100311195
383 Ga0068854_100000939
384 Ga0068856_100007857
385 Ga0068852_100000024
386 Ga0068859_101102345
387 Ga0068866_10010127
388 Ga0068851_10007702
389 Ga0068851_10018801
390 Ga0068863_100008951
391 Ga0068863_100302345
392 Ga0068858_100360906
393 Ga0068860_100076698
394 Ga0068862_100001247
395 Ga0081455_10063685
396 Ga0081540_1000281
397 Ga0081540_1045901
398 Ga0081539_10002195
399 Ga0075363_100308305
400 Ga0070715_10248864
401 Ga0070712_100333416
402 Ga0075370_10367529
403 Ga0075430_100043648
404 Ga0075433_10004429
405 Ga0075434_100992962
406 Ga0068865_100000024
407 Ga0097620_101102450
408 Ga0105240_10402473
409 Ga0105245_10000528
410 Ga0105245_10019614
411 Ga0105247_10019328
412 Ga0105247_10193652
413 Ga0105243_10006175
414 Ga0105241_10287652
415 Ga0105242_10000123
416 Ga0105242_10003277
417 Ga0105248_10001735
418 Ga0105238_10322187
419 Ga0105238_10432182
420 Ga0105030_108643
421 Ga0105239_10032561
422 Ga0105239_10183680
423 Ga0105239_10320952
424 Ga0157370_10213556
425 Ga0157369_10000068
426 Ga0157378_10048351
427 Ga0157378_10104189
428 Ga0157378_10233477
429 Ga0163162_10088547
430 Ga0163162_11207412
431 Ga0157372_10000809
432 Ga0157375_10016258
433 Ga0157375_10600233
434 Ga0163163_10471068
435 Ga0157380_10000326
436 Ga0157379_10025779
437 Ga0157376_10060903
438 Ga0157376_10067012
439 Ga0157376_10334933
440 Ga0206354_11410537
441 Ga0224712_10004702
442 Ga0207656_10000374
443 Ga0207656_10001048
444 Ga0207642_10007311
445 Ga0207710_10000220
446 Ga0207710_10034933
447 Ga0207680_10010652
448 Ga0207680_10163663
449 Ga0207705_10014343
450 Ga0207649_10000166
451 Ga0207649_10384407
452 Ga0207652_10000917
453 Ga0207694_10380094
454 Ga0207659_10000138
455 Ga0207687_10000025
456 Ga0207687_10002690
457 Ga0207700_10000019
458 Ga0207664_10013567
459 Ga0207644_10501598
460 Ga0207690_10003914
461 Ga0207686_10000066
462 Ga0207686_10001614
463 Ga0207709_10002223
464 Ga0207670_10297906
465 Ga0207704_10000308
466 Ga0207691_10000430
467 Ga0207711_10000011
468 Ga0207689_10251183
469 Ga0207661_10000518
470 Ga0207661_10000616
471 Ga0207661_10009756
472 Ga0207661_10153591
473 Ga0207679_10006381
474 Ga0207712_10809954
475 Ga0207668_10011784
476 Ga0207668_10028292
477 Ga0207640_10000821
478 Ga0207658_10000840
479 Ga0207658_10109895
480 Ga0207677_10001476
481 Ga0207703_10533339
482 Ga0207678_10244452
483 Ga0207678_10300116
484 Ga0207708_10156105
485 Ga0207702_10002042
486 Ga0207641_10015727
487 Ga0207641_10105321
488 Ga0207674_10330824
489 Ga0207675_100664139
490 Ga0207683_10038808
491 Ga0207698_10000014
492 Ga0207698_10032167
493 Ga0268266_10001628
494 Ga0268266_10018264
495 Ga0268266_10055970
496 Ga0268265_10000667
497 Ga0268264_10846754
498 Ga0265319_1000030
499 Ga0265338_10000156
500 Ga0316181_1236952
501 Ga0316182_1103924
502 Ga0265325_10010101
503 Ga0265327_10102824
504 Ga0316575_10179342
505 Ga0307405_10581697
506 Ga0307412_10547488
507 Ga0439465_0153680
508 Ga0451807_2709994
509 Ga0451833_0601880
510 Ga0451833_0895723
511 Ga0451837_1001135
512 Ga0451845_0823628
513 Ga0451853_0406739
514 Ga0439445_0028057
515 Ga0439445_0032745
516 Ga0439432_007856
517 Ga0451577_0000328
518 Ga0451577_0087004
519 Ga0451577_0126618
520 Ga0451577_0158136
521 Ga0453683_0000002
522 Ga0453683_0000848
523 Ga0453683_0003668
524 Ga0453683_0030691
525 Ga0453684_0000950
526 Ga0453684_0005204
527 Ga0453684_0028025
528 Ga0466957_0004792
529 Ga0466957_0043709
530 Ga0466960_0059318
531 Ga0451576_0000151
532 Ga0451576_0005912
533 Ga0451576_0417213
534 Ga0466958_0138861
535 Ga0466967_0000003
536 Ga0495592_0130275
537 Ga0495592_0219027
538 Ga0495629_0000543
539 Ga0495629_0033292
540 Ga0495629_0140631
541 Ga0495641_0023186
542 Ga0495651_0050048
543 Ga0495653_0067045
544 Ga0495594_0000001
545 Ga0495606_0000283
546 Ga0495608_0000010
547 Ga0495628_0000864
548 Ga0495628_0176466
549 Ga0495630_0000148
550 Ga0495630_0000395
551 Ga0495630_0028236
552 Ga0495652_0000009
553 Ga0495640_0009674
554 Ga0495587_0029873
555 Ga0495587_0054221
556 Ga0495587_0256387
557 Ga0495645_0004698
558 Ga0495622_0000069
559 Ga0495667_0010689
560 Ga0495625_0000109
561 Ga0495625_0118853
562 Ga0495635_0087861
563 Ga0495588_0000175
564 Ga0495657_0000005
565 Ga0495657_0014713
566 Ga0495647_0000114
567 Ga0495658_0006678
568 Ga0495613_0000087
569 Ga0495624_0000429
570 Ga0495600_0019425
571 Ga0495660_0144283
572 Ga0495604_0000322
573 Ga0495674_0000141
574 Ga0495672_0116441
575 Ga0495676_0000522
576 Ga0495676_0034901
577 Ga0495680_0075724
578 Ga0495680_0091590
579 Ga0495675_0000398
580 Ga0495684_0141338
581 Ga0495686_0217173
582 Ga0495602_0000038
583 Ga0495602_0003702
584 Ga0495602_0037972
585 Ga0495602_0223358
586 Ga0496100_0000028
587 Ga0496101_0000005
588 Ga0496102_0000021
589 Ga0496102_0176450
590 Ga0496103_0000001
591 Ga0496104_0000029
592 Ga0496104_0037414
593 Ga0496104_0056802
594 Ga0496105_0000002
595 Ga0496106_0000070
596 Ga0496106_0218603
597 Ga0496107_0000004
598 Ga0496107_0017709
599 Ga0496108_0000042
600 Ga0496108_0002451
601 Ga0496109_0000034
602 Ga0496109_0000062
603 Ga0496110_0000325
604 Ga0496110_0077462
605 Ga0496111_0000171
606 Ga0496112_0017988
607 Ga0496113_0000002
608 Ga0496114_0000097
609 Ga0496114_0137030
610 Ga0496115_0000151
611 Ga0496119_0015147
612 Ga0496119_0188351
613 Ga0496121_0029534
614 Ga0496124_0203023
615 Ga0496124_0293280
616 Ga0501031_0016044
617 Ga0501032_0223940
618 Ga0501032_0294038
619 Ga0501034_0009432
620 Ga0501034_0738539
621 Ga0501036_0197014
622 Ga0501037_0141622
623 Ga0501038_0178030
624 Ga0501039_0185534
625 Ga0501039_0187959
626 Ga0501040_0148635
627 Ga0501042_0020760
628 Ga0501043_0004838
629 Ga0501043_0635300
630 Ga0501046_0001288
631 Ga0501047_0006076
632 Ga0501047_0031813
633 Ga0501047_0231925
634 Ga0501048_0020228
635 Ga0501067_0074750
636 Ga0501068_0159494
637 Ga0501068_0574508
638 Ga0501069_0175114
639 Ga0501070_0000267
640 Ga0501070_0064865
641 Ga0501073_0121466
642 Ga0501079_0110131
643 Ga0501080_0349922
644 Ga0501080_0671530
645 Ga0501083_0018653
646 Ga0501035_0000877
647 Ga0501044_0001422
648 Ga0501045_0174664
649 nmdc:mga03n38_295362_c1
650 nmdc:mga00v17_209932_c1
651 nmdc:mga07m45_229969_c1
652 nmdc:mga0qj67_251582_c1
653 nmdc:mga0a205_15_c2
654 Ga0495601_0000698
655 Ga0495601_0090130
656 Ga0495612_0001451
657 Ga0495655_0000013
658 Ga0495655_0000120
659 Ga0495595_0000005
660 Ga0495595_0309950
661 Ga0495619_0000036
662 Ga0495619_0000069
663 Ga0495619_0000489
664 Ga0495619_0001945
665 Ga0500566_0013929
666 Ga0500641_0008993
667 Ga0500628_000045
668 Ga0501084_0215435
669 Ga0501082_0235196
670 2645723815

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00406

ADK

Adenylate kinase

12

198

0.99

PF05191

ADK_lid

Adenylate kinase, active site lid

134

169

0.98

PF13207

AAA_17

AAA domain

13

141

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qbg-assembly1.cif.gz_B crystal structure of a stable adenylate kinase variant aklse4 0.9736 4 220
4qbg-assembly1.cif.gz_B crystal structure of a stable adenylate kinase variant aklse4 0.9692 4 220
1zip-assembly1.cif.gz_A bacillus stearothermophilus adenylate kinase 0.9684 4 220
4mkh-assembly1.cif.gz_A crystal structure of a stable adenylate kinase variant akv18 0.9682 4 220
4tyq-assembly2.cif.gz_B crystal structure of an adenylate kinase mutant--akm2 0.9656 4 217
ID Description Score Start End Superfamily
af_P9WKF5_1_180_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9676 4 215 3.40.50.300
af_P9WKF5_1_180_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9571 4 215 3.40.50.300
4ikeB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9341 4 215 3.40.50.300
4typB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9312 4 213 3.40.50.300
af_B4FL09_65_286_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.923 3 219 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7V9WN85-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9863 1 193 GO:0004017
GO:0005524
GO:0005737
AF-A0A2G4G650-F1-model_v4 Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) 0.9821 4 215 GO:0004017
GO:0005524
GO:0005737
GO:0008270
GO:0044209
AF-A0A6J4T9P4-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9816 2 218 GO:0004017
GO:0005524
GO:0005737
AF-A0A7V2PJM8-F1-model_v4 Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) 0.9813 3 219 GO:0004017
GO:0005524
GO:0005737
GO:0008270
GO:0044209
AF-A0A7V9WN85-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9813 1 193 GO:0004017
GO:0005524
GO:0005737

Map