F412156

General Info

Members Datasets Scaffolds Average Seq Length
335 170 671 278

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100060467|Ga0068854_1000604673
Length 325
Sequence MQTTEELKDLVREKYSAIALQDKETNQSSCCGSGCCSNEVYNIMTDDYSNLEGYNAEADLGLGCGLPTQFAQIKKGDVVIDLGSGAGNDCFVARAETGETGKVIGIDFTPAMIDKARANAEKLGFNNVEFRQGDIERMPVTAGVADVIVSNCVLNLVPDKEAVFREIFRVLKPGGHFSISDIVLAGELPGKIREAAELYAGCVAGAIQQSSYMGLISAEGFGNVVIQKEKRIVLPDDILSQYLGAEEIAAFRASGAGIYSITVYAEKPKAEACCAPXXXSQTPSSHENRALFGYTCQSSGAGGLLRQSRAAKTRCRLLPGRPGRL

Samples

Sample ID Description Type Environment
1 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
61 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
95 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
96 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
107 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
114 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
115 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
116 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
155 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
156 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
157 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
158 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
159 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
160 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
161 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
162 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
163 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
164 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
165 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
166 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
167 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
168 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
169 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
170 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.01
Metatranscriptomes 0.3
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.58
Nodule 0
Rhizoplane 0
Rhizosphere 91.64
Stem 0
Stem Tuber 0
Unclassified 9.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068854_100060467 3300005578 Bacteria 2741
2 JGI24740J21852_10030199 3300001979 Bacteria 1768
3 JGI25406J46586_10007860 3300003203 Bacteria 4852
4 rootH1_10056706 3300003316 Bacteria 1165
5 rootH2_10005790 3300003320 Bacteria 74217
6 rootL2_10135777 3300003322 Bacteria 7046
7 rootH1_10020455 3300003316 Bacteria 7263
8 rootH1_10020455 3300003323 Bacteria 13860
9 rootH1_10053784 3300003323 Bacteria 3067
10 rootH1_10086585 3300003323 Bacteria 15734
11 rootH1_10237376 3300003323 Bacteria 3376
12 Ga0070658_10026226 3300005327 Bacteria 4675
13 Ga0070658_10042691 3300005327 Bacteria 3663
14 Ga0070658_10223266 3300005327 Bacteria 1594
15 Ga0070676_10057307 3300005328 Bacteria 2305
16 Ga0070683_100024487 3300005329 Bacteria 5408
17 Ga0070690_100093474 3300005330 Bacteria 1984
18 Ga0068869_100093388 3300005334 Unclassified 2267
19 Ga0070680_100027733 3300005336 Bacteria 4537
20 Ga0070680_100184488 3300005336 Bacteria 1757
21 Ga0070680_100339082 3300005336 Bacteria 1277
22 Ga0070660_100028312 3300005339 Bacteria 4191
23 Ga0070660_100078079 3300005339 Bacteria 2596
24 Ga0070660_100169115 3300005339 Bacteria 1765
25 Ga0070691_10015049 3300005341 Bacteria 3553
26 Ga0070687_100004972 3300005343 Bacteria 5345
27 Ga0070673_100035011 3300005364 Bacteria 3805
28 Ga0070659_100001238 3300005366 Bacteria 18539
29 Ga0070659_100014292 3300005366 Bacteria 5928
30 Ga0070659_100075476 3300005366 Bacteria 2687
31 Ga0070663_100011905 3300005455 Bacteria 5485
32 Ga0070663_100020487 3300005455 Bacteria 4380
33 Ga0070681_10007952 3300005458 Bacteria 10380
34 Ga0070681_10044228 3300005458 Bacteria 4456
35 Ga0070681_10048847 3300005458 Bacteria 4226
36 Ga0070681_10097788 3300005458 Unclassified 2882
37 Ga0070679_100012320 3300005530 Bacteria 8168
38 Ga0070679_100018424 3300005530 Bacteria 6775
39 Ga0070679_100089545 3300005530 Bacteria 3064
40 Ga0070679_100435272 3300005530 Unclassified 1256
41 Ga0070684_100006927 3300005535 Bacteria 8806
42 Ga0070684_100218345 3300005535 Bacteria 1739
43 Ga0068853_100028149 3300005539 Bacteria 4724
44 Ga0068853_100037849 3300005539 Bacteria 4107
45 Ga0068853_100335384 3300005539 Bacteria 1404
46 Ga0070686_100309897 3300005544 Bacteria 1173
47 Ga0070665_100000189 3300005548 Bacteria 109948
48 Ga0068855_100000226 3300005563 Bacteria 72130
49 Ga0068855_100009031 3300005563 Bacteria 12044
50 Ga0068855_100048332 3300005563 Bacteria 5021
51 Ga0068855_100050232 3300005563 Bacteria 4916
52 Ga0068855_100183292 3300005563 Bacteria 2366
53 Ga0068855_100786561 3300005563 Bacteria 1012
54 Ga0068857_100021263 3300005577 Bacteria 5711
55 Ga0068854_100107485 3300005578 Bacteria 2100
56 Ga0068854_100516050 3300005578 Unclassified 1008
57 Ga0068856_100002800 3300005614 Bacteria 17855
58 Ga0068856_100013747 3300005614 Bacteria 7827
59 Ga0068856_100079012 3300005614 Bacteria 3262
60 Ga0068856_100134736 3300005614 Bacteria 2475
61 Ga0070702_100048453 3300005615 Bacteria 2419
62 Ga0068852_100069192 3300005616 Unclassified 3093
63 Ga0068852_100154534 3300005616 Bacteria 2136
64 Ga0068859_100814661 3300005617 Unclassified 1021
65 Ga0068864_100073638 3300005618 Bacteria 2978
66 Ga0068864_100504844 3300005618 Unclassified 1164
67 Ga0068861_100107511 3300005719 Bacteria 2230
68 Ga0068858_100207795 3300005842 Bacteria 1852
69 Ga0068858_100500539 3300005842 Bacteria 1174
70 Ga0068860_100000005 3300005843 Bacteria 472349
71 Ga0068860_100002921 3300005843 Bacteria 17692
72 Ga0068860_100027661 3300005843 Bacteria 5460
73 Ga0081539_10000876 3300005985 Bacteria 57659
74 Ga0097621_100147590 3300006237 Bacteria 2015
75 Ga0068871_100171667 3300006358 Bacteria 1859
76 Ga0097620_100814764 3300006931 Unclassified 1021
77 Ga0105240_10000023 3300009093 Bacteria 385028
78 Ga0105240_10000276 3300009093 Bacteria 101817
79 Ga0105240_10002010 3300009093 Bacteria 33532
80 Ga0105240_10002198 3300009093 Bacteria 31833
81 Ga0105240_10044728 3300009093 Bacteria 5623
82 Ga0105240_10128920 3300009093 Bacteria 3036
83 Ga0105240_10154853 3300009093 Bacteria 2727
84 Ga0111539_10010834 3300009094 Bacteria 11477
85 Ga0105241_10002217 3300009174 Bacteria 14614
86 Ga0105241_10002608 3300009174 Bacteria 13519
87 Ga0105241_10006070 3300009174 Bacteria 8913
88 Ga0105242_10028342 3300009176 Bacteria 4457
89 Ga0105242_10513154 3300009176 Unclassified 1142
90 Ga0105237_10000143 3300009545 Bacteria 101515
91 Ga0105237_10002459 3300009545 Bacteria 22992
92 Ga0105237_10003402 3300009545 Bacteria 18918
93 Ga0105237_10026390 3300009545 Bacteria 5937
94 Ga0105237_10029828 3300009545 Bacteria 5540
95 Ga0105237_10695262 3300009545 Bacteria 1023
96 Ga0105238_10016912 3300009551 Bacteria 7401
97 Ga0105238_10036985 3300009551 Bacteria 4963
98 Ga0105238_10312615 3300009551 Bacteria 1556
99 Ga0105238_10395708 3300009551 Bacteria 1374
100 Ga0105249_10113036 3300009553 Bacteria 2569
101 Ga0105249_10277460 3300009553 Unclassified 1672
102 Ga0105239_10000195 3300010375 Bacteria 88195
103 Ga0105239_10000267 3300010375 Bacteria 77181
104 Ga0105239_10000433 3300010375 Bacteria 61072
105 Ga0105239_10003037 3300010375 Bacteria 20874
106 Ga0105239_10005136 3300010375 Bacteria 15457
107 Ga0105239_10010145 3300010375 Bacteria 10555
108 Ga0105239_10068134 3300010375 Bacteria 3911
109 Ga0157373_10001468 3300013100 Bacteria 18026
110 Ga0157373_10065607 3300013100 Bacteria 2569
111 Ga0157371_10004775 3300013102 Bacteria 11681
112 Ga0157371_10005627 3300013102 Bacteria 10521
113 Ga0157371_10006480 3300013102 Bacteria 9650
114 Ga0157371_10018706 3300013102 Bacteria 5119
115 Ga0157371_10233346 3300013102 Unclassified 1323
116 Ga0157370_10002875 3300013104 Bacteria 20517
117 Ga0157370_10088078 3300013104 Bacteria 2915
118 Ga0157370_10245118 3300013104 Unclassified 1658
119 Ga0157370_10288137 3300013104 Bacteria 1517
120 Ga0157369_10001726 3300013105 Bacteria 26600
121 Ga0157369_10039461 3300013105 Bacteria 5159
122 Ga0157369_10275980 3300013105 Bacteria 1751
123 Ga0157374_10029851 3300013296 Bacteria 4945
124 Ga0157374_10182996 3300013296 Bacteria 2048
125 Ga0157378_10078718 3300013297 Bacteria 2974
126 Ga0163162_10001420 3300013306 Bacteria 22262
127 Ga0163162_10006637 3300013306 Bacteria 11216
128 Ga0163162_10075859 3300013306 Bacteria 3423
129 Ga0163162_10520204 3300013306 Unclassified 1319
130 Ga0163162_10587444 3300013306 Bacteria 1240
131 Ga0163162_10641148 3300013306 Unclassified 1186
132 Ga0163162_10971103 3300013306 Unclassified 960
133 Ga0157372_10000286 3300013307 Bacteria 56140
134 Ga0157372_10007012 3300013307 Bacteria 12004
135 Ga0157372_10019863 3300013307 Bacteria 7240
136 Ga0157372_10020219 3300013307 Bacteria 7179
137 Ga0157372_10046901 3300013307 Unclassified 4798
138 Ga0157372_10060798 3300013307 Bacteria 4227
139 Ga0157372_10153282 3300013307 Bacteria 2661
140 Ga0157372_10291011 3300013307 Bacteria 1900
141 Ga0157372_10696600 3300013307 Bacteria 1182
142 Ga0163163_10001834 3300014325 Bacteria 17938
143 Ga0163163_10113557 3300014325 Bacteria 2739
144 Ga0182008_10056523 3300014497 Bacteria 1939
145 Ga0157377_10035707 3300014745 Bacteria 2729
146 Ga0157376_10662454 3300014969 Unclassified 1045
147 Ga0182007_10017619 3300015262 Unclassified 2604
148 Ga0182007_10021687 3300015262 Bacteria 2277
149 Ga0209258_100234 3300025242 Bacteria 103648
150 Ga0209148_1000234 3300025254 Bacteria 90627
151 Ga0207688_10102854 3300025901 Bacteria 1651
152 Ga0207645_10172103 3300025907 Bacteria 1420
153 Ga0207705_10000028 3300025909 Bacteria 240636
154 Ga0207705_10016642 3300025909 Bacteria 5266
155 Ga0207705_10032752 3300025909 Bacteria 3714
156 Ga0207705_10214371 3300025909 Bacteria 1461
157 Ga0207654_10001489 3300025911 Bacteria 12377
158 Ga0207654_10053127 3300025911 Bacteria 2337
159 Ga0207654_10069601 3300025911 Bacteria 2086
160 Ga0207707_10019673 3300025912 Bacteria 5892
161 Ga0207707_10034681 3300025912 Bacteria 4414
162 Ga0207707_10150766 3300025912 Bacteria 2033
163 Ga0207707_10306956 3300025912 Unclassified 1371
164 Ga0207695_10000016 3300025913 Bacteria 771991
165 Ga0207695_10000183 3300025913 Bacteria 181350
166 Ga0207695_10000645 3300025913 Bacteria 69294
167 Ga0207695_10001186 3300025913 Bacteria 44969
168 Ga0207695_10033140 3300025913 Bacteria 5641
169 Ga0207695_10046630 3300025913 Unclassified 4593
170 Ga0207671_10000968 3300025914 Bacteria 35551
171 Ga0207671_10009918 3300025914 Bacteria 7916
172 Ga0207671_10012172 3300025914 Bacteria 6940
173 Ga0207671_10043401 3300025914 Bacteria 3325
174 Ga0207671_10108665 3300025914 Bacteria 2108
175 Ga0207660_10013397 3300025917 Bacteria 5375
176 Ga0207662_10013013 3300025918 Bacteria 4647
177 Ga0207657_10039235 3300025919 Bacteria 4211
178 Ga0207657_10047382 3300025919 Bacteria 3759
179 Ga0207657_10130471 3300025919 Bacteria 2060
180 Ga0207652_10002727 3300025921 Bacteria 14815
181 Ga0207652_10108913 3300025921 Bacteria 2455
182 Ga0207652_10201667 3300025921 Bacteria 1790
183 Ga0207694_10013767 3300025924 Bacteria 6097
184 Ga0207694_10227431 3300025924 Bacteria 1523
185 Ga0207644_10221948 3300025931 Bacteria 1498
186 Ga0207690_10000943 3300025932 Bacteria 18615
187 Ga0207690_10364605 3300025932 Bacteria 1145
188 Ga0207691_10165280 3300025940 Bacteria 1940
189 Ga0207689_10053493 3300025942 Bacteria 3326
190 Ga0207661_10028570 3300025944 Bacteria 4273
191 Ga0207661_10045002 3300025944 Bacteria 3491
192 Ga0207667_10000039 3300025949 Bacteria 278843
193 Ga0207667_10003030 3300025949 Bacteria 20857
194 Ga0207667_10026916 3300025949 Bacteria 6274
195 Ga0207668_10492974 3300025972 Bacteria 1053
196 Ga0207640_10400959 3300025981 Bacteria 1117
197 Ga0207677_10070738 3300026023 Unclassified 2460
198 Ga0207639_10171435 3300026041 Bacteria 1838
199 Ga0207639_10264070 3300026041 Bacteria 1507
200 Ga0207639_10335144 3300026041 Bacteria 1347
201 Ga0207678_10004778 3300026067 Bacteria 12159
202 Ga0207678_10040879 3300026067 Bacteria 4020
203 Ga0207708_10373405 3300026075 Bacteria 1174
204 Ga0207702_10013769 3300026078 Bacteria 6718
205 Ga0207702_10059282 3300026078 Bacteria 3260
206 Ga0207702_10093792 3300026078 Bacteria 2633
207 Ga0207702_10103012 3300026078 Bacteria 2524
208 Ga0207702_10169685 3300026078 Bacteria 2000
209 Ga0207648_10017157 3300026089 Bacteria 6598
210 Ga0207674_10026166 3300026116 Bacteria 6207
211 Ga0207674_10099864 3300026116 Bacteria 2884
212 Ga0207698_10535497 3300026142 Bacteria 1145
213 Ga0207428_10071036 3300027907 Unclassified 2735
214 Ga0268266_10000180 3300028379 Bacteria 112295
215 Ga0268264_10000012 3300028381 Bacteria 521740
216 Ga0268264_10005051 3300028381 Bacteria 11170
217 Ga0268264_10019504 3300028381 Bacteria 5540
218 Ga0265326_10019548 3300028558 Bacteria 1945
219 Ga0265322_10000194 3300028654 Bacteria 27357
220 Ga0307517_10017476 3300028786 Bacteria 9348
221 Ga0265338_10122514 3300028800 Bacteria 2069
222 Ga0265327_10000452 3300031251 Bacteria 73846
223 Ga0265327_10002929 3300031251 Bacteria 17084
224 Ga0265327_10003081 3300031251 Bacteria 16450
225 Ga0265327_10035519 3300031251 Bacteria 2753
226 Ga0265327_10041643 3300031251 Bacteria 2474
227 Ga0307513_10208962 3300031456 Unclassified 1785
228 Ga0307508_10000926 3300031616 Bacteria 34077
229 Ga0316576_10046101 3300031727 Bacteria 3154
230 Ga0316578_10011406 3300031728 Unclassified 4648
231 Ga0307405_10040053 3300031731 Bacteria 2836
232 Ga0307412_10024756 3300031911 Bacteria 3709
233 Ga0307414_10080650 3300032004 Bacteria 2380
234 Ga0316574_0093436 3300035398 Bacteria 1920
235 Ga0316582_0360286 3300036647 Bacteria 1001
236 Ga0395899_0000434 3300037312 Bacteria 48146
237 Ga0395899_0009943 3300037312 Bacteria 7296
238 Ga0395899_0053701 3300037312 Bacteria 2982
239 Ga0395900_0018116 3300037418 Bacteria 7186
240 Ga0395900_0043955 3300037418 Bacteria 4604
241 Ga0395898_0059145 3300037466 Bacteria 3729
242 Ga0395898_0436515 3300037466 Unclassified 1247
243 Ga0395905_0183036 3300037471 Unclassified 1967
244 Ga0395905_0218449 3300037471 Unclassified 1784
245 Ga0395901_0077500 3300038443 Bacteria 3469
246 Ga0395901_0256363 3300038443 Bacteria 1821
247 Ga0400483_001423 3300039062 Bacteria 2577
248 Ga0400489_16674 3300039093 Bacteria 1424
249 Ga0436361_0672383 3300039447 Bacteria 9246
250 Ga0451837_1487179 3300041494 Bacteria 4085
251 Ga0451577_0000425 3300042876 Bacteria 75871
252 Ga0451577_0046471 3300042876 Bacteria 3884
253 Ga0451577_0126628 3300042876 Bacteria 2289
254 Ga0451577_0337559 3300042876 Unclassified 1367
255 Ga0466969_0014294 3300044656 Bacteria 4174
256 Ga0466972_0011885 3300044658 Bacteria 4373
257 Ga0453683_0064660 3300044673 Bacteria 2287
258 Ga0466966_0003138 3300044684 Bacteria 10876
259 Ga0466966_0111171 3300044684 Bacteria 1689
260 Ga0466961_0054087 3300044693 Bacteria 2561
261 Ga0466964_0231937 3300044706 Bacteria 901
262 Ga0453684_0001108 3300044712 Bacteria 84688
263 Ga0453684_0001159 3300044712 Bacteria 82240
264 Ga0453684_0001781 3300044712 Bacteria 57459
265 Ga0453684_0007351 3300044712 Bacteria 20336
266 Ga0453684_0007675 3300044712 Bacteria 19728
267 Ga0453684_0049711 3300044712 Bacteria 5525
268 Ga0453684_0054284 3300044712 Bacteria 5221
269 Ga0453684_0083666 3300044712 Bacteria 3970
270 Ga0453684_0128799 3300044712 Bacteria 3040
271 Ga0453684_0203772 3300044712 Bacteria 2304
272 Ga0453684_0319175 3300044712 Bacteria 1760
273 Ga0453684_0522962 3300044712 Bacteria 1310
274 Ga0453684_0745349 3300044712 Bacteria 1061
275 Ga0466968_0049949 3300044735 Bacteria 1783
276 Ga0466960_0025091 3300044901 Bacteria 2695
277 Ga0466959_0001248 3300045049 Bacteria 15359
278 Ga0466959_0172271 3300045049 Bacteria 1518
279 Ga0451576_0000002 3300045051 Bacteria 1670975
280 Ga0451576_0000991 3300045051 Bacteria 52576
281 Ga0451576_0070212 3300045051 Bacteria 3646
282 Ga0451576_0211941 3300045051 Bacteria 2023
283 Ga0451576_0574472 3300045051 Bacteria 1184
284 Ga0466958_0196383 3300045836 Bacteria 1283
285 Ga0495648_0001914 3300046524 Bacteria 19837
286 Ga0495611_0101222 3300046648 Unclassified 1338
287 Ga0495672_0012233 3300047320 Bacteria 6001
288 Ga0495687_005139 3300047443 Bacteria 8471
289 Ga0495686_0062033 3300047472 Bacteria 2319
290 Ga0501335_002643 3300049551 Bacteria 1465
291 Ga0501031_0008646 3300049568 Bacteria 6620
292 Ga0501031_0069170 3300049568 Bacteria 2300
293 Ga0501033_0000061 3300049570 Bacteria 103115
294 Ga0501034_0002106 3300049571 Bacteria 24838
295 Ga0501034_0003261 3300049571 Bacteria 18539
296 Ga0501036_0086630 3300049572 Bacteria 2647
297 Ga0501037_0359541 3300049573 Bacteria 1003
298 Ga0501039_0015357 3300049575 Bacteria 5862
299 Ga0501039_0116646 3300049575 Bacteria 2090
300 Ga0501043_0015222 3300049579 Bacteria 6023
301 Ga0501043_0039397 3300049579 Bacteria 3714
302 Ga0501046_0216840 3300049580 Bacteria 1419
303 Ga0501048_0162014 3300049582 Bacteria 1583
304 Ga0501070_0001260 3300049586 Bacteria 22710
305 Ga0501070_0155151 3300049586 Bacteria 1888
306 Ga0501072_0116108 3300049588 Bacteria 2132
307 Ga0501073_0257294 3300049589 Bacteria 1205
308 Ga0501240_003748 3300049673 Bacteria 1721
309 Ga0501080_0082415 3300049742 Bacteria 2988
310 Ga0501080_0250850 3300049742 Bacteria 1614
311 Ga0501035_0003787 3300049822 Bacteria 14412
312 Ga0501044_0003358 3300049823 Bacteria 18047
313 Ga0501044_0100439 3300049823 Bacteria 2911
314 Ga0501044_0304593 3300049823 Bacteria 1521
315 Ga0501044_0437452 3300049823 Bacteria 1216
316 Ga0501045_0000008 3300049824 Bacteria 76934
317 nmdc:mga08y16_453985_c1 3300050511 Bacteria 1307
318 Ga0500644_0000222 3300053088 Bacteria 32776
319 Ga0500646_0017593 3300053090 Unclassified 1876
320 Ga0500583_0001005 3300053092 Bacteria 8013
321 Ga0500583_0032644 3300053092 Bacteria 2298
322 Ga0500651_0121868 3300053093 Unclassified 1583
323 Ga0500589_099300 3300053147 Bacteria 1267
324 Ga0500622_0000686 3300053156 Bacteria 29937
325 Ga0500634_0043398 3300053161 Bacteria 2437
326 Ga0500636_0042452 3300053177 Bacteria 2688
327 Ga0500637_0238801 3300053178 Bacteria 1020
328 2524006996 2523533629 Bacteria 2982326
329 2819679429 2818991460 Bacteria 7595395
330 2849282074 2849281842 Bacteria 6065644
331 2910245980 2910245624 Bacteria 6935613
332 2910251083 2910245624 Bacteria 6935613
333 2919696492 2919692658 Bacteria 5943958
334 2929243156 2929239360 Bacteria 7745570
335 2929925829 2929921140 Bacteria 8649150
336 2932082913 2932082852 Bacteria 6563563
337 Ga0068854_100060467
338 JGI24740J21852_10030199
339 JGI25406J46586_10007860
340 rootH1_10056706
341 rootH2_10005790
342 rootL2_10135777
343 rootH1_10020455
344 rootH1_10053784
345 rootH1_10086585
346 rootH1_10237376
347 Ga0070658_10026226
348 Ga0070658_10042691
349 Ga0070658_10223266
350 Ga0070676_10057307
351 Ga0070683_100024487
352 Ga0070690_100093474
353 Ga0068869_100093388
354 Ga0070680_100027733
355 Ga0070680_100184488
356 Ga0070680_100339082
357 Ga0070660_100028312
358 Ga0070660_100078079
359 Ga0070660_100169115
360 Ga0070691_10015049
361 Ga0070687_100004972
362 Ga0070673_100035011
363 Ga0070659_100001238
364 Ga0070659_100014292
365 Ga0070659_100075476
366 Ga0070663_100011905
367 Ga0070663_100020487
368 Ga0070681_10007952
369 Ga0070681_10044228
370 Ga0070681_10048847
371 Ga0070681_10097788
372 Ga0070679_100012320
373 Ga0070679_100018424
374 Ga0070679_100089545
375 Ga0070679_100435272
376 Ga0070684_100006927
377 Ga0070684_100218345
378 Ga0068853_100028149
379 Ga0068853_100037849
380 Ga0068853_100335384
381 Ga0070686_100309897
382 Ga0070665_100000189
383 Ga0068855_100000226
384 Ga0068855_100009031
385 Ga0068855_100048332
386 Ga0068855_100050232
387 Ga0068855_100183292
388 Ga0068855_100786561
389 Ga0068857_100021263
390 Ga0068854_100107485
391 Ga0068854_100516050
392 Ga0068856_100002800
393 Ga0068856_100013747
394 Ga0068856_100079012
395 Ga0068856_100134736
396 Ga0070702_100048453
397 Ga0068852_100069192
398 Ga0068852_100154534
399 Ga0068859_100814661
400 Ga0068864_100073638
401 Ga0068864_100504844
402 Ga0068861_100107511
403 Ga0068858_100207795
404 Ga0068858_100500539
405 Ga0068860_100000005
406 Ga0068860_100002921
407 Ga0068860_100027661
408 Ga0081539_10000876
409 Ga0097621_100147590
410 Ga0068871_100171667
411 Ga0097620_100814764
412 Ga0105240_10000023
413 Ga0105240_10000276
414 Ga0105240_10002010
415 Ga0105240_10002198
416 Ga0105240_10044728
417 Ga0105240_10128920
418 Ga0105240_10154853
419 Ga0111539_10010834
420 Ga0105241_10002217
421 Ga0105241_10002608
422 Ga0105241_10006070
423 Ga0105242_10028342
424 Ga0105242_10513154
425 Ga0105237_10000143
426 Ga0105237_10002459
427 Ga0105237_10003402
428 Ga0105237_10026390
429 Ga0105237_10029828
430 Ga0105237_10695262
431 Ga0105238_10016912
432 Ga0105238_10036985
433 Ga0105238_10312615
434 Ga0105238_10395708
435 Ga0105249_10113036
436 Ga0105249_10277460
437 Ga0105239_10000195
438 Ga0105239_10000267
439 Ga0105239_10000433
440 Ga0105239_10003037
441 Ga0105239_10005136
442 Ga0105239_10010145
443 Ga0105239_10068134
444 Ga0157373_10001468
445 Ga0157373_10065607
446 Ga0157371_10004775
447 Ga0157371_10005627
448 Ga0157371_10006480
449 Ga0157371_10018706
450 Ga0157371_10233346
451 Ga0157370_10002875
452 Ga0157370_10088078
453 Ga0157370_10245118
454 Ga0157370_10288137
455 Ga0157369_10001726
456 Ga0157369_10039461
457 Ga0157369_10275980
458 Ga0157374_10029851
459 Ga0157374_10182996
460 Ga0157378_10078718
461 Ga0163162_10001420
462 Ga0163162_10006637
463 Ga0163162_10075859
464 Ga0163162_10520204
465 Ga0163162_10587444
466 Ga0163162_10641148
467 Ga0163162_10971103
468 Ga0157372_10000286
469 Ga0157372_10007012
470 Ga0157372_10019863
471 Ga0157372_10020219
472 Ga0157372_10046901
473 Ga0157372_10060798
474 Ga0157372_10153282
475 Ga0157372_10291011
476 Ga0157372_10696600
477 Ga0163163_10001834
478 Ga0163163_10113557
479 Ga0182008_10056523
480 Ga0157377_10035707
481 Ga0157376_10662454
482 Ga0182007_10017619
483 Ga0182007_10021687
484 Ga0209258_100234
485 Ga0209148_1000234
486 Ga0207688_10102854
487 Ga0207645_10172103
488 Ga0207705_10000028
489 Ga0207705_10016642
490 Ga0207705_10032752
491 Ga0207705_10214371
492 Ga0207654_10001489
493 Ga0207654_10053127
494 Ga0207654_10069601
495 Ga0207707_10019673
496 Ga0207707_10034681
497 Ga0207707_10150766
498 Ga0207707_10306956
499 Ga0207695_10000016
500 Ga0207695_10000183
501 Ga0207695_10000645
502 Ga0207695_10001186
503 Ga0207695_10033140
504 Ga0207695_10046630
505 Ga0207671_10000968
506 Ga0207671_10009918
507 Ga0207671_10012172
508 Ga0207671_10043401
509 Ga0207671_10108665
510 Ga0207660_10013397
511 Ga0207662_10013013
512 Ga0207657_10039235
513 Ga0207657_10047382
514 Ga0207657_10130471
515 Ga0207652_10002727
516 Ga0207652_10108913
517 Ga0207652_10201667
518 Ga0207694_10013767
519 Ga0207694_10227431
520 Ga0207644_10221948
521 Ga0207690_10000943
522 Ga0207690_10364605
523 Ga0207691_10165280
524 Ga0207689_10053493
525 Ga0207661_10028570
526 Ga0207661_10045002
527 Ga0207667_10000039
528 Ga0207667_10003030
529 Ga0207667_10026916
530 Ga0207668_10492974
531 Ga0207640_10400959
532 Ga0207677_10070738
533 Ga0207639_10171435
534 Ga0207639_10264070
535 Ga0207639_10335144
536 Ga0207678_10004778
537 Ga0207678_10040879
538 Ga0207708_10373405
539 Ga0207702_10013769
540 Ga0207702_10059282
541 Ga0207702_10093792
542 Ga0207702_10103012
543 Ga0207702_10169685
544 Ga0207648_10017157
545 Ga0207674_10026166
546 Ga0207674_10099864
547 Ga0207698_10535497
548 Ga0207428_10071036
549 Ga0268266_10000180
550 Ga0268264_10000012
551 Ga0268264_10005051
552 Ga0268264_10019504
553 Ga0265326_10019548
554 Ga0265322_10000194
555 Ga0307517_10017476
556 Ga0265338_10122514
557 Ga0265327_10000452
558 Ga0265327_10002929
559 Ga0265327_10003081
560 Ga0265327_10035519
561 Ga0265327_10041643
562 Ga0307513_10208962
563 Ga0307508_10000926
564 Ga0316576_10046101
565 Ga0316578_10011406
566 Ga0307405_10040053
567 Ga0307412_10024756
568 Ga0307414_10080650
569 Ga0316574_0093436
570 Ga0316582_0360286
571 Ga0395899_0000434
572 Ga0395899_0009943
573 Ga0395899_0053701
574 Ga0395900_0018116
575 Ga0395900_0043955
576 Ga0395898_0059145
577 Ga0395898_0436515
578 Ga0395905_0183036
579 Ga0395905_0218449
580 Ga0395901_0077500
581 Ga0395901_0256363
582 Ga0400483_001423
583 Ga0400489_16674
584 Ga0436361_0672383
585 Ga0451837_1487179
586 Ga0451577_0000425
587 Ga0451577_0046471
588 Ga0451577_0126628
589 Ga0451577_0337559
590 Ga0466969_0014294
591 Ga0466972_0011885
592 Ga0453683_0064660
593 Ga0466966_0003138
594 Ga0466966_0111171
595 Ga0466961_0054087
596 Ga0466964_0231937
597 Ga0453684_0001108
598 Ga0453684_0001159
599 Ga0453684_0001781
600 Ga0453684_0007351
601 Ga0453684_0007675
602 Ga0453684_0049711
603 Ga0453684_0054284
604 Ga0453684_0083666
605 Ga0453684_0128799
606 Ga0453684_0203772
607 Ga0453684_0319175
608 Ga0453684_0522962
609 Ga0453684_0745349
610 Ga0466968_0049949
611 Ga0466960_0025091
612 Ga0466959_0001248
613 Ga0466959_0172271
614 Ga0451576_0000002
615 Ga0451576_0000991
616 Ga0451576_0070212
617 Ga0451576_0211941
618 Ga0451576_0574472
619 Ga0466958_0196383
620 Ga0495648_0001914
621 Ga0495611_0101222
622 Ga0495672_0012233
623 Ga0495687_005139
624 Ga0495686_0062033
625 Ga0501335_002643
626 Ga0501031_0008646
627 Ga0501031_0069170
628 Ga0501033_0000061
629 Ga0501034_0002106
630 Ga0501034_0003261
631 Ga0501036_0086630
632 Ga0501037_0359541
633 Ga0501039_0015357
634 Ga0501039_0116646
635 Ga0501043_0015222
636 Ga0501043_0039397
637 Ga0501046_0216840
638 Ga0501048_0162014
639 Ga0501070_0001260
640 Ga0501070_0155151
641 Ga0501072_0116108
642 Ga0501073_0257294
643 Ga0501240_003748
644 Ga0501080_0082415
645 Ga0501080_0250850
646 Ga0501035_0003787
647 Ga0501044_0003358
648 Ga0501044_0100439
649 Ga0501044_0304593
650 Ga0501044_0437452
651 Ga0501045_0000008
652 nmdc:mga08y16_453985_c1
653 Ga0500644_0000222
654 Ga0500646_0017593
655 Ga0500583_0001005
656 Ga0500583_0032644
657 Ga0500651_0121868
658 Ga0500589_099300
659 Ga0500622_0000686
660 Ga0500634_0043398
661 Ga0500636_0042452
662 Ga0500637_0238801
663 2524006996
664 2819679429
665 2849282074
666 2910245980
667 2910251083
668 2919696492
669 2929243156
670 2929925829
671 2932082913

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

80

179

0.96

PF13649

Methyltransf_25

Methyltransferase domain

79

175

0.95

PF13847

Methyltransf_31

Methyltransferase domain

73

231

0.94

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

67

203

0.93

PF01170

UPF0020

RMKL-like, methyltransferase domain

71

153

0.89

PF08242

Methyltransf_12

Methyltransferase domain

80

177

0.88

PF13489

Methyltransf_23

Methyltransferase domain

54

211

0.87

PF01728

FtsJ

FtsJ-like methyltransferase

65

183

0.81

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

66

195

0.81

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

47

179

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yxe-assembly1.cif.gz_B crystal structure of l-isoaspartyl protein carboxyl methyltranferase 0.8793 68 180
1dl5-assembly1.cif.gz_A protein-l-isoaspartate o-methyltransferase 0.8489 68 179
5evj-assembly2.cif.gz_B x-ray crystal structure of crarsm, an arsenic (iii) s-adenosylmethionine methyltransferase from chlamydomonas reinhardtii 0.844 75 268
6ec3-assembly2.cif.gz_B crystal structure of evdmo1 0.8271 76 267
4pyj-assembly1.cif.gz_A human apo-comt, single domain swap 0.8205 78 150
ID Description Score Start End Superfamily
af_Q4E3J0_145_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9456 75 138 3.40.50.150
af_C7J169_1_82_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9441 69 128 3.40.50.150
af_Q55DF6_53_245_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9306 73 134 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9271 71 136 3.40.50.150
af_K7LTE4_237_888_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9262 69 136 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2H0AUX0-F1-model_v4 Methyltransferase domain-containing protein 0.9642 68 132 GO:0016020
AF-A0A7W1W703-F1-model_v4 Methyltransferase domain-containing protein 0.9454 68 172 GO:0008168
GO:0032259
AF-A0A536VRK7-F1-model_v4 Class I SAM-dependent methyltransferase 0.9347 67 175 GO:0008168
GO:0032259
AF-J7T967-F1-model_v4 deleted 0.9335 61 201
AF-A0A2Z5JPE9-F1-model_v4 Methyltransferase domain-containing protein 0.9217 72 170 GO:0008168
GO:0009058

Map