F412158

General Info

Members Datasets Scaffolds Average Seq Length
335 228 671 461

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100000938|Ga0068856_10000093822
Length 511
Sequence MRELHSVPGKLGGALVRARNIVRALAFPVHPPDAPHPTWSKARLMTNPASDALVFFGATGDLAYKQIFPALLAMVARDGLDVPIIGVAHAGWSDEQLRQRAHDSVAEAAKKAGKGVDEAAFAKLSARLQYVDGDYNDAATFAQLKQALGAAKAPLHYLAIPPSLFGTVVTSLKAAGCADDARVVVEKPFGRDLASAQALNRTLHTVFPEASIFRIDHYLGKEAVQNLLYFRFANSVLEPVWNNRYVDRVQITMAEEFGVDGRGSFYEGVGAIRDVLQNHLLQVTSLLAMDAPIGSDPAALSAEKLRLFRAMRPLTPADVVRGQFRGYREVPGVAADSDVETFVALRLAIDTWRWSGVPFLIRAGKKLPLTTTQVMVDMKAPPLSVFDTIGAAQSNYFRFRLSPQVVIAEGMRVKLPGEALRGEPVELIARHHSGVEMAPYERLLGDALRGDNALFTSDECVEAAWRVVDQVLEHKNAARPYEPGSWGPSEAVALAGEEGWHDPQPEATPPC

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
162 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
163 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
164 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
220 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
221 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
222 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
223 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
224 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
225 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
226 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
227 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
228 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.01
Metatranscriptomes 0.9
Isolates 2.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.67
Nodule 0
Rhizoplane 2.99
Rhizosphere 85.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100000938 3300005614 Bacteria 31227
2 JGI24746J21847_1005180 3300001977 Bacteria 2040
3 JGI25162J39368_1000784 3300002737 Bacteria 21348
4 JGI25162J39368_1002011 3300002737 Bacteria 9033
5 JGI25157J39369_1000938 3300002741 Bacteria 13774
6 JGI25157J39369_1000987 3300002741 Bacteria 13315
7 JGI25164J39214_1000681 3300002772 Bacteria 13486
8 JGI25164J39214_1000745 3300002772 Bacteria 12110
9 JGI25165J46597_1000539 3300003214 Bacteria 34949
10 JGI25165J46597_1002802 3300003214 Bacteria 5048
11 rootH1_10040552 3300003316 Bacteria 2012
12 rootH1_10040552 3300003323 Bacteria 4661
13 Ga0070676_10042462 3300005328 Bacteria 2640
14 Ga0070683_100030913 3300005329 Bacteria 4865
15 Ga0070690_100020592 3300005330 Bacteria 4019
16 Ga0070666_10003743 3300005335 Bacteria 9221
17 Ga0070666_10037737 3300005335 Bacteria 3214
18 Ga0070666_10158162 3300005335 Bacteria 1583
19 Ga0070680_100000220 3300005336 Bacteria 37754
20 Ga0068868_100000202 3300005338 Bacteria 40069
21 Ga0068868_100026288 3300005338 Bacteria 4434
22 Ga0070660_100020120 3300005339 Bacteria 4901
23 Ga0070660_100056495 3300005339 Bacteria 3037
24 Ga0070660_100086275 3300005339 Bacteria 2470
25 Ga0070689_100005189 3300005340 Bacteria 8869
26 Ga0070691_10058836 3300005341 Bacteria 1846
27 Ga0070661_100014212 3300005344 Bacteria 5608
28 Ga0070661_100125582 3300005344 Bacteria 1924
29 Ga0070668_100127263 3300005347 Bacteria 2041
30 Ga0070668_100132407 3300005347 Bacteria 2002
31 Ga0070669_100009009 3300005353 Bacteria 7119
32 Ga0070669_100168058 3300005353 Bacteria 1708
33 Ga0070675_100004301 3300005354 Bacteria 10853
34 Ga0070671_100077587 3300005355 Bacteria 2776
35 Ga0070674_100008188 3300005356 Bacteria 6207
36 Ga0070673_100000377 3300005364 Bacteria 23358
37 Ga0070673_100096289 3300005364 Bacteria 2429
38 Ga0070673_100107434 3300005364 Bacteria 2308
39 Ga0070688_100001928 3300005365 Bacteria 10420
40 Ga0070688_100023224 3300005365 Bacteria 3646
41 Ga0070667_100027462 3300005367 Bacteria 4735
42 Ga0070709_10001941 3300005434 Bacteria 11249
43 Ga0070714_100001937 3300005435 Bacteria 15113
44 Ga0070713_100004662 3300005436 Bacteria 9252
45 Ga0070701_10033023 3300005438 Bacteria 2582
46 Ga0070705_100005128 3300005440 Bacteria 6361
47 Ga0070705_100080751 3300005440 Bacteria 1996
48 Ga0070700_100019432 3300005441 Bacteria 3920
49 Ga0070694_100054107 3300005444 Bacteria 2718
50 Ga0070694_100065969 3300005444 Bacteria 2482
51 Ga0070708_100048884 3300005445 Bacteria 3741
52 Ga0070708_100078252 3300005445 Bacteria 2989
53 Ga0070708_100285139 3300005445 Bacteria 1554
54 Ga0070663_100026618 3300005455 Bacteria 3920
55 Ga0070663_100067569 3300005455 Bacteria 2593
56 Ga0070678_100000729 3300005456 Bacteria 16373
57 Ga0070678_100007672 3300005456 Bacteria 6414
58 Ga0070678_100019989 3300005456 Bacteria 4383
59 Ga0070662_100047643 3300005457 Bacteria 3084
60 Ga0070681_10031228 3300005458 Bacteria 5346
61 Ga0068867_100007191 3300005459 Bacteria 7866
62 Ga0068867_100089035 3300005459 Bacteria 2340
63 Ga0070685_10006763 3300005466 Bacteria 5849
64 Ga0070706_100028417 3300005467 Bacteria 5149
65 Ga0070707_100008897 3300005468 Bacteria 9315
66 Ga0070707_100009424 3300005468 Bacteria 9063
67 Ga0070698_100020219 3300005471 Bacteria 6980
68 Ga0070699_100002829 3300005518 Bacteria 15479
69 Ga0070679_100091190 3300005530 Bacteria 3035
70 Ga0070679_100093761 3300005530 Bacteria 2989
71 Ga0070679_100116787 3300005530 Bacteria 2653
72 Ga0070684_100017942 3300005535 Bacteria 5818
73 Ga0070697_100022741 3300005536 Bacteria 4981
74 Ga0070697_100134137 3300005536 Bacteria 2078
75 Ga0068853_100003057 3300005539 Bacteria 12776
76 Ga0068853_100139813 3300005539 Bacteria 2173
77 Ga0070672_100024713 3300005543 Bacteria 4445
78 Ga0070686_100110268 3300005544 Bacteria 1873
79 Ga0070695_100001337 3300005545 Bacteria 13653
80 Ga0070696_100000786 3300005546 Bacteria 20403
81 Ga0070696_100002370 3300005546 Bacteria 12457
82 Ga0070693_100000831 3300005547 Bacteria 13705
83 Ga0070693_100018660 3300005547 Bacteria 3627
84 Ga0070665_100002599 3300005548 Bacteria 19719
85 Ga0070665_100009331 3300005548 Bacteria 9931
86 Ga0070665_100036277 3300005548 Bacteria 4960
87 Ga0068855_100172023 3300005563 Bacteria 2453
88 Ga0070664_100048052 3300005564 Bacteria 3606
89 Ga0068857_100043609 3300005577 Bacteria 3978
90 Ga0068857_100049418 3300005577 Bacteria 3731
91 Ga0068854_100000142 3300005578 Bacteria 49834
92 Ga0068854_100000264 3300005578 Bacteria 35701
93 Ga0068854_100013768 3300005578 Bacteria 5317
94 Ga0068856_100009026 3300005614 Bacteria 9700
95 Ga0068859_100035319 3300005617 Bacteria 5016
96 Ga0068864_100005445 3300005618 Bacteria 10438
97 Ga0068866_10013598 3300005718 Bacteria 3576
98 Ga0068861_100005634 3300005719 Bacteria 8492
99 Ga0068861_100082429 3300005719 Bacteria 2520
100 Ga0068851_10000162 3300005834 Bacteria 34956
101 Ga0068851_10004176 3300005834 Bacteria 6507
102 Ga0068863_100080638 3300005841 Bacteria 3082
103 Ga0068858_100017112 3300005842 Bacteria 6804
104 Ga0068860_100022678 3300005843 Bacteria 6069
105 Ga0068860_100128171 3300005843 Bacteria 2433
106 Ga0068862_100025784 3300005844 Bacteria 4937
107 Ga0081455_10072972 3300005937 Bacteria 2839
108 Ga0070716_100101321 3300006173 Bacteria 1766
109 Ga0070712_100001597 3300006175 Bacteria 13845
110 Ga0097621_100168176 3300006237 Bacteria 1888
111 Ga0068865_100048400 3300006881 Bacteria 2925
112 Ga0097620_100035320 3300006931 Bacteria 5016
113 Ga0105240_10004145 3300009093 Bacteria 22207
114 Ga0105240_10008300 3300009093 Bacteria 14861
115 Ga0105240_10011667 3300009093 Bacteria 12212
116 Ga0111539_10004596 3300009094 Bacteria 18040
117 Ga0111539_10232982 3300009094 Bacteria 2144
118 Ga0105245_10154655 3300009098 Bacteria 2171
119 Ga0114129_10305324 3300009147 Bacteria 2120
120 Ga0105241_10012437 3300009174 Bacteria 6238
121 Ga0105248_10000978 3300009177 Bacteria 31743
122 Ga0105248_10013783 3300009177 Bacteria 8898
123 Ga0105248_10114886 3300009177 Bacteria 3036
124 Ga0105248_10271609 3300009177 Bacteria 1909
125 Ga0105237_10002537 3300009545 Bacteria 22597
126 Ga0105237_10008967 3300009545 Bacteria 10767
127 Ga0105237_10042297 3300009545 Bacteria 4595
128 Ga0105238_10004156 3300009551 Bacteria 14369
129 Ga0105238_10056962 3300009551 Bacteria 3920
130 Ga0105249_10085820 3300009553 Bacteria 2934
131 Ga0105239_10062630 3300010375 Bacteria 4082
132 Ga0157373_10001606 3300013100 Bacteria 17258
133 Ga0157373_10004173 3300013100 Bacteria 10896
134 Ga0157371_10002661 3300013102 Bacteria 16890
135 Ga0157370_10059095 3300013104 Bacteria 3644
136 Ga0157370_10067154 3300013104 Bacteria 3390
137 Ga0157369_10005501 3300013105 Bacteria 14717
138 Ga0157369_10042979 3300013105 Bacteria 4927
139 Ga0157369_10297683 3300013105 Bacteria 1679
140 Ga0157374_10057516 3300013296 Bacteria 3632
141 Ga0163162_10070485 3300013306 Bacteria 3547
142 Ga0157372_10149861 3300013307 Bacteria 2691
143 Ga0157372_10343293 3300013307 Bacteria 1739
144 Ga0157375_10003097 3300013308 Bacteria 14440
145 Ga0157375_10006216 3300013308 Bacteria 10402
146 Ga0157375_10205667 3300013308 Bacteria 2125
147 Ga0163163_10007009 3300014325 Bacteria 9900
148 Ga0157380_10084012 3300014326 Bacteria 2610
149 Ga0157379_10018708 3300014968 Bacteria 6108
150 Ga0157376_10028916 3300014969 Bacteria 4412
151 Ga0182007_10006487 3300015262 Bacteria 5019
152 Ga0163161_10159866 3300017792 Bacteria 1717
153 Ga0197907_10721088 3300020069 Bacteria 2205
154 Ga0206350_10418641 3300020080 Bacteria 4271
155 Ga0206353_12041072 3300020082 Bacteria 1964
156 Ga0213876_10000006 3300021384 Bacteria 700803
157 Ga0213876_10000076 3300021384 Bacteria 116109
158 Ga0209566_101647 3300025225 Bacteria 5723
159 Ga0209674_101759 3300025226 Bacteria 5259
160 Ga0207427_100119 3300025231 Bacteria 101986
161 Ga0207427_100141 3300025231 Bacteria 83903
162 Ga0209437_100005 3300025233 Bacteria 1071596
163 Ga0209437_100253 3300025233 Bacteria 83916
164 Ga0209437_103474 3300025233 Bacteria 2847
165 Ga0209026_1000113 3300025250 Bacteria 139047
166 Ga0209759_1002305 3300025256 Bacteria 8583
167 Ga0209759_1008346 3300025256 Bacteria 3237
168 Ga0209233_1000011 3300025261 Bacteria 1071611
169 Ga0209233_1000046 3300025261 Bacteria 470971
170 Ga0209455_1000189 3300025272 Bacteria 92877
171 Ga0207697_10000097 3300025315 Bacteria 39643
172 Ga0207682_10000069 3300025893 Bacteria 45399
173 Ga0207682_10000606 3300025893 Bacteria 16672
174 Ga0207642_10068168 3300025899 Bacteria 1682
175 Ga0207688_10000116 3300025901 Bacteria 32495
176 Ga0207680_10028835 3300025903 Bacteria 3110
177 Ga0207645_10000751 3300025907 Bacteria 26990
178 Ga0207645_10005445 3300025907 Bacteria 9223
179 Ga0207643_10000178 3300025908 Bacteria 43423
180 Ga0207705_10009273 3300025909 Bacteria 7157
181 Ga0207705_10071811 3300025909 Bacteria 2510
182 Ga0207684_10040976 3300025910 Bacteria 3927
183 Ga0207684_10088694 3300025910 Bacteria 2635
184 Ga0207707_10000829 3300025912 Bacteria 30323
185 Ga0207695_10010992 3300025913 Bacteria 10997
186 Ga0207695_10034205 3300025913 Bacteria 5531
187 Ga0207695_10037617 3300025913 Bacteria 5220
188 Ga0207671_10000697 3300025914 Bacteria 43453
189 Ga0207671_10102713 3300025914 Bacteria 2167
190 Ga0207671_10156011 3300025914 Bacteria 1766
191 Ga0207693_10003271 3300025915 Bacteria 13875
192 Ga0207693_10092323 3300025915 Bacteria 2373
193 Ga0207660_10006881 3300025917 Bacteria 7363
194 Ga0207662_10010198 3300025918 Bacteria 5181
195 Ga0207657_10032691 3300025919 Bacteria 4697
196 Ga0207657_10036198 3300025919 Bacteria 4419
197 Ga0207649_10020731 3300025920 Bacteria 3772
198 Ga0207649_10031476 3300025920 Bacteria 3153
199 Ga0207652_10003524 3300025921 Bacteria 12905
200 Ga0207646_10019221 3300025922 Bacteria 6353
201 Ga0207681_10005375 3300025923 Bacteria 7869
202 Ga0207650_10001884 3300025925 Bacteria 14810
203 Ga0207664_10000640 3300025929 Bacteria 24316
204 Ga0207664_10001143 3300025929 Bacteria 17641
205 Ga0207644_10012025 3300025931 Bacteria 5740
206 Ga0207644_10122313 3300025931 Bacteria 1982
207 Ga0207690_10101519 3300025932 Bacteria 2055
208 Ga0207706_10001631 3300025933 Bacteria 22262
209 Ga0207670_10016782 3300025936 Bacteria 4411
210 Ga0207669_10015156 3300025937 Bacteria 3880
211 Ga0207704_10005583 3300025938 Bacteria 5801
212 Ga0207665_10169915 3300025939 Bacteria 1574
213 Ga0207691_10000497 3300025940 Bacteria 39141
214 Ga0207691_10038398 3300025940 Bacteria 4432
215 Ga0207691_10053479 3300025940 Bacteria 3686
216 Ga0207711_10012224 3300025941 Bacteria 7140
217 Ga0207711_10052575 3300025941 Bacteria 3492
218 Ga0207711_10128307 3300025941 Bacteria 2271
219 Ga0207689_10000289 3300025942 Bacteria 45719
220 Ga0207689_10018045 3300025942 Bacteria 5959
221 Ga0207679_10018194 3300025945 Bacteria 4703
222 Ga0207667_10000040 3300025949 Bacteria 275827
223 Ga0207667_10004951 3300025949 Bacteria 16270
224 Ga0207667_10018212 3300025949 Bacteria 7881
225 Ga0207651_10029453 3300025960 Bacteria 3479
226 Ga0207651_10037668 3300025960 Bacteria 3170
227 Ga0207651_10053431 3300025960 Bacteria 2761
228 Ga0207712_10035130 3300025961 Bacteria 3402
229 Ga0207640_10000009 3300025981 Bacteria 283101
230 Ga0207677_10008353 3300026023 Bacteria 5779
231 Ga0207639_10018687 3300026041 Bacteria 4929
232 Ga0207639_10049644 3300026041 Bacteria 3183
233 Ga0207639_10076061 3300026041 Bacteria 2642
234 Ga0207678_10003785 3300026067 Bacteria 13604
235 Ga0207678_10007845 3300026067 Bacteria 9419
236 Ga0207678_10035534 3300026067 Bacteria 4339
237 Ga0207708_10000888 3300026075 Bacteria 22477
238 Ga0207702_10000068 3300026078 Bacteria 116478
239 Ga0207641_10021420 3300026088 Bacteria 5312
240 Ga0207648_10001782 3300026089 Bacteria 23591
241 Ga0207648_10004502 3300026089 Bacteria 14289
242 Ga0207648_10116516 3300026089 Bacteria 2348
243 Ga0207676_10013431 3300026095 Bacteria 5882
244 Ga0207674_10031555 3300026116 Bacteria 5564
245 Ga0207674_10054463 3300026116 Bacteria 4072
246 Ga0207675_100031438 3300026118 Bacteria 4945
247 Ga0207683_10000009 3300026121 Bacteria 150281
248 Ga0207683_10000797 3300026121 Bacteria 28789
249 Ga0207683_10002366 3300026121 Bacteria 16474
250 Ga0207683_10005272 3300026121 Bacteria 11094
251 Ga0209998_10001640 3300027717 Bacteria 5363
252 Ga0209974_10003014 3300027876 Bacteria 6093
253 Ga0209974_10031060 3300027876 Bacteria 1768
254 Ga0268264_10113669 3300028381 Bacteria 2375
255 Ga0265338_10017275 3300028800 Bacteria 7787
256 Ga0265338_10047644 3300028800 Bacteria 3912
257 Ga0265332_10046198 3300031238 Bacteria 1875
258 Ga0265325_10000525 3300031241 Bacteria 27638
259 Ga0265339_10002769 3300031249 Bacteria 12459
260 Ga0265339_10010934 3300031249 Bacteria 5610
261 Ga0265331_10000502 3300031250 Bacteria 36921
262 Ga0265331_10000685 3300031250 Bacteria 29060
263 Ga0307408_100007245 3300031548 Bacteria 7337
264 Ga0265313_10001208 3300031595 Bacteria 24677
265 Ga0265313_10006735 3300031595 Bacteria 8037
266 Ga0265314_10001701 3300031711 Bacteria 23896
267 Ga0265314_10007550 3300031711 Bacteria 9424
268 Ga0265342_10006036 3300031712 Bacteria 9094
269 Ga0307405_10057172 3300031731 Bacteria 2450
270 Ga0307413_10019625 3300031824 Bacteria 3577
271 Ga0307410_10028297 3300031852 Bacteria 3553
272 Ga0307409_100003835 3300031995 Bacteria 8300
273 Ga0307416_100007413 3300032002 Bacteria 6974
274 Ga0307411_10004738 3300032005 Bacteria 6576
275 Ga0373956_0000484 3300035119 Bacteria 16354
276 Ga0373931_0062136 3300035691 Bacteria 2016
277 Ga0373935_0006076 3300035692 Bacteria 7181
278 Ga0373927_0000371 3300035695 Bacteria 34777
279 Ga0373927_0018050 3300035695 Bacteria 4640
280 Ga0373947_0003332 3300035725 Bacteria 9515
281 Ga0373937_0075398 3300036401 Bacteria 3114
282 Ga0373937_0097591 3300036401 Bacteria 2726
283 Ga0373925_0000649 3300037068 Bacteria 32703
284 Ga0395901_0010728 3300038443 Bacteria 9288
285 Ga0436365_0695157 3300039437 Bacteria 511493
286 Ga0436365_1893186 3300039437 Bacteria 48707
287 Ga0466972_0002971 3300044658 Bacteria 8393
288 Ga0466970_0000034 3300044765 Bacteria 50551
289 Ga0466959_0002286 3300045049 Bacteria 12223
290 Ga0495638_0000076 3300046460 Bacteria 158799
291 Ga0495650_0001060 3300046471 Bacteria 30515
292 Ga0495580_0004583 3300046472 Bacteria 11600
293 Ga0495582_0000213 3300046473 Bacteria 32186
294 Ga0495639_0009665 3300046475 Bacteria 4138
295 Ga0495665_0000168 3300046531 Bacteria 33008
296 Ga0495647_0000124 3300046681 Bacteria 19840
297 Ga0495658_0000586 3300046683 Bacteria 19914
298 Ga0495613_0003362 3300046689 Bacteria 11958
299 Ga0495581_0000059 3300047315 Bacteria 42676
300 Ga0495684_0000895 3300047471 Bacteria 24103
301 Ga0495684_0132576 3300047471 Bacteria 1870
302 Ga0496100_0045010 3300048903 Bacteria 2830
303 Ga0496102_0014018 3300048905 Bacteria 6961
304 Ga0496102_0020925 3300048905 Bacteria 5784
305 Ga0496106_0033492 3300048909 Bacteria 3833
306 Ga0496107_0015286 3300048910 Bacteria 5380
307 Ga0496108_0011314 3300048911 Bacteria 7249
308 Ga0496109_0032780 3300048912 Bacteria 4672
309 Ga0496111_0008093 3300048914 Bacteria 6943
310 Ga0496114_0042968 3300048917 Bacteria 3747
311 Ga0496114_0084430 3300048917 Bacteria 2689
312 Ga0496117_0078330 3300048920 Bacteria 2182
313 Ga0496118_0000953 3300048921 Bacteria 45266
314 Ga0496118_0002146 3300048921 Bacteria 27521
315 Ga0496126_0096969 3300048929 Bacteria 2584
316 Ga0501032_0061537 3300049569 Bacteria 2516
317 Ga0501034_0104812 3300049571 Bacteria 2821
318 Ga0501043_0049564 3300049579 Bacteria 3302
319 Ga0501046_0060126 3300049580 Bacteria 2974
320 Ga0501035_0021848 3300049822 Bacteria 5880
321 Ga0501035_0086669 3300049822 Bacteria 2759
322 Ga0501044_0006400 3300049823 Bacteria 13016
323 nmdc:mga09592_223579_c1 3300050508 Bacteria 1631
324 nmdc:mga08y16_77333_c1 3300050511 Bacteria 3470
325 nmdc:mga0n895_194228_c1 3300050512 Bacteria 2061
326 Ga0495619_0003976 3300053085 Bacteria 9479
327 Ga0500651_0000690 3300053093 Bacteria 16757
328 Ga0500555_007541 3300053103 Bacteria 3091
329 Ga0500593_042860 3300053117 Bacteria 2021
330 2538835082 2537561836 Bacteria 3910579
331 2643828451 2643221562 Bacteria 4048635
332 2643896252 2643221577 Bacteria 3710843
333 2644478469 2643221685 Bacteria 3673288
334 2687582195 2687453130 Bacteria 4227172
335 2895397841 2895395659 Bacteria 3983269
336 2939613750 2939611941 Bacteria 3892017
337 Ga0068856_100000938
338 JGI24746J21847_1005180
339 JGI25162J39368_1000784
340 JGI25162J39368_1002011
341 JGI25157J39369_1000938
342 JGI25157J39369_1000987
343 JGI25164J39214_1000681
344 JGI25164J39214_1000745
345 JGI25165J46597_1000539
346 JGI25165J46597_1002802
347 rootH1_10040552
348 Ga0070676_10042462
349 Ga0070683_100030913
350 Ga0070690_100020592
351 Ga0070666_10003743
352 Ga0070666_10037737
353 Ga0070666_10158162
354 Ga0070680_100000220
355 Ga0068868_100000202
356 Ga0068868_100026288
357 Ga0070660_100020120
358 Ga0070660_100056495
359 Ga0070660_100086275
360 Ga0070689_100005189
361 Ga0070691_10058836
362 Ga0070661_100014212
363 Ga0070661_100125582
364 Ga0070668_100127263
365 Ga0070668_100132407
366 Ga0070669_100009009
367 Ga0070669_100168058
368 Ga0070675_100004301
369 Ga0070671_100077587
370 Ga0070674_100008188
371 Ga0070673_100000377
372 Ga0070673_100096289
373 Ga0070673_100107434
374 Ga0070688_100001928
375 Ga0070688_100023224
376 Ga0070667_100027462
377 Ga0070709_10001941
378 Ga0070714_100001937
379 Ga0070713_100004662
380 Ga0070701_10033023
381 Ga0070705_100005128
382 Ga0070705_100080751
383 Ga0070700_100019432
384 Ga0070694_100054107
385 Ga0070694_100065969
386 Ga0070708_100048884
387 Ga0070708_100078252
388 Ga0070708_100285139
389 Ga0070663_100026618
390 Ga0070663_100067569
391 Ga0070678_100000729
392 Ga0070678_100007672
393 Ga0070678_100019989
394 Ga0070662_100047643
395 Ga0070681_10031228
396 Ga0068867_100007191
397 Ga0068867_100089035
398 Ga0070685_10006763
399 Ga0070706_100028417
400 Ga0070707_100008897
401 Ga0070707_100009424
402 Ga0070698_100020219
403 Ga0070699_100002829
404 Ga0070679_100091190
405 Ga0070679_100093761
406 Ga0070679_100116787
407 Ga0070684_100017942
408 Ga0070697_100022741
409 Ga0070697_100134137
410 Ga0068853_100003057
411 Ga0068853_100139813
412 Ga0070672_100024713
413 Ga0070686_100110268
414 Ga0070695_100001337
415 Ga0070696_100000786
416 Ga0070696_100002370
417 Ga0070693_100000831
418 Ga0070693_100018660
419 Ga0070665_100002599
420 Ga0070665_100009331
421 Ga0070665_100036277
422 Ga0068855_100172023
423 Ga0070664_100048052
424 Ga0068857_100043609
425 Ga0068857_100049418
426 Ga0068854_100000142
427 Ga0068854_100000264
428 Ga0068854_100013768
429 Ga0068856_100009026
430 Ga0068859_100035319
431 Ga0068864_100005445
432 Ga0068866_10013598
433 Ga0068861_100005634
434 Ga0068861_100082429
435 Ga0068851_10000162
436 Ga0068851_10004176
437 Ga0068863_100080638
438 Ga0068858_100017112
439 Ga0068860_100022678
440 Ga0068860_100128171
441 Ga0068862_100025784
442 Ga0081455_10072972
443 Ga0070716_100101321
444 Ga0070712_100001597
445 Ga0097621_100168176
446 Ga0068865_100048400
447 Ga0097620_100035320
448 Ga0105240_10004145
449 Ga0105240_10008300
450 Ga0105240_10011667
451 Ga0111539_10004596
452 Ga0111539_10232982
453 Ga0105245_10154655
454 Ga0114129_10305324
455 Ga0105241_10012437
456 Ga0105248_10000978
457 Ga0105248_10013783
458 Ga0105248_10114886
459 Ga0105248_10271609
460 Ga0105237_10002537
461 Ga0105237_10008967
462 Ga0105237_10042297
463 Ga0105238_10004156
464 Ga0105238_10056962
465 Ga0105249_10085820
466 Ga0105239_10062630
467 Ga0157373_10001606
468 Ga0157373_10004173
469 Ga0157371_10002661
470 Ga0157370_10059095
471 Ga0157370_10067154
472 Ga0157369_10005501
473 Ga0157369_10042979
474 Ga0157369_10297683
475 Ga0157374_10057516
476 Ga0163162_10070485
477 Ga0157372_10149861
478 Ga0157372_10343293
479 Ga0157375_10003097
480 Ga0157375_10006216
481 Ga0157375_10205667
482 Ga0163163_10007009
483 Ga0157380_10084012
484 Ga0157379_10018708
485 Ga0157376_10028916
486 Ga0182007_10006487
487 Ga0163161_10159866
488 Ga0197907_10721088
489 Ga0206350_10418641
490 Ga0206353_12041072
491 Ga0213876_10000006
492 Ga0213876_10000076
493 Ga0209566_101647
494 Ga0209674_101759
495 Ga0207427_100119
496 Ga0207427_100141
497 Ga0209437_100005
498 Ga0209437_100253
499 Ga0209437_103474
500 Ga0209026_1000113
501 Ga0209759_1002305
502 Ga0209759_1008346
503 Ga0209233_1000011
504 Ga0209233_1000046
505 Ga0209455_1000189
506 Ga0207697_10000097
507 Ga0207682_10000069
508 Ga0207682_10000606
509 Ga0207642_10068168
510 Ga0207688_10000116
511 Ga0207680_10028835
512 Ga0207645_10000751
513 Ga0207645_10005445
514 Ga0207643_10000178
515 Ga0207705_10009273
516 Ga0207705_10071811
517 Ga0207684_10040976
518 Ga0207684_10088694
519 Ga0207707_10000829
520 Ga0207695_10010992
521 Ga0207695_10034205
522 Ga0207695_10037617
523 Ga0207671_10000697
524 Ga0207671_10102713
525 Ga0207671_10156011
526 Ga0207693_10003271
527 Ga0207693_10092323
528 Ga0207660_10006881
529 Ga0207662_10010198
530 Ga0207657_10032691
531 Ga0207657_10036198
532 Ga0207649_10020731
533 Ga0207649_10031476
534 Ga0207652_10003524
535 Ga0207646_10019221
536 Ga0207681_10005375
537 Ga0207650_10001884
538 Ga0207664_10000640
539 Ga0207664_10001143
540 Ga0207644_10012025
541 Ga0207644_10122313
542 Ga0207690_10101519
543 Ga0207706_10001631
544 Ga0207670_10016782
545 Ga0207669_10015156
546 Ga0207704_10005583
547 Ga0207665_10169915
548 Ga0207691_10000497
549 Ga0207691_10038398
550 Ga0207691_10053479
551 Ga0207711_10012224
552 Ga0207711_10052575
553 Ga0207711_10128307
554 Ga0207689_10000289
555 Ga0207689_10018045
556 Ga0207679_10018194
557 Ga0207667_10000040
558 Ga0207667_10004951
559 Ga0207667_10018212
560 Ga0207651_10029453
561 Ga0207651_10037668
562 Ga0207651_10053431
563 Ga0207712_10035130
564 Ga0207640_10000009
565 Ga0207677_10008353
566 Ga0207639_10018687
567 Ga0207639_10049644
568 Ga0207639_10076061
569 Ga0207678_10003785
570 Ga0207678_10007845
571 Ga0207678_10035534
572 Ga0207708_10000888
573 Ga0207702_10000068
574 Ga0207641_10021420
575 Ga0207648_10001782
576 Ga0207648_10004502
577 Ga0207648_10116516
578 Ga0207676_10013431
579 Ga0207674_10031555
580 Ga0207674_10054463
581 Ga0207675_100031438
582 Ga0207683_10000009
583 Ga0207683_10000797
584 Ga0207683_10002366
585 Ga0207683_10005272
586 Ga0209998_10001640
587 Ga0209974_10003014
588 Ga0209974_10031060
589 Ga0268264_10113669
590 Ga0265338_10017275
591 Ga0265338_10047644
592 Ga0265332_10046198
593 Ga0265325_10000525
594 Ga0265339_10002769
595 Ga0265339_10010934
596 Ga0265331_10000502
597 Ga0265331_10000685
598 Ga0307408_100007245
599 Ga0265313_10001208
600 Ga0265313_10006735
601 Ga0265314_10001701
602 Ga0265314_10007550
603 Ga0265342_10006036
604 Ga0307405_10057172
605 Ga0307413_10019625
606 Ga0307410_10028297
607 Ga0307409_100003835
608 Ga0307416_100007413
609 Ga0307411_10004738
610 Ga0373956_0000484
611 Ga0373931_0062136
612 Ga0373935_0006076
613 Ga0373927_0000371
614 Ga0373927_0018050
615 Ga0373947_0003332
616 Ga0373937_0075398
617 Ga0373937_0097591
618 Ga0373925_0000649
619 Ga0395901_0010728
620 Ga0436365_0695157
621 Ga0436365_1893186
622 Ga0466972_0002971
623 Ga0466970_0000034
624 Ga0466959_0002286
625 Ga0495638_0000076
626 Ga0495650_0001060
627 Ga0495580_0004583
628 Ga0495582_0000213
629 Ga0495639_0009665
630 Ga0495665_0000168
631 Ga0495647_0000124
632 Ga0495658_0000586
633 Ga0495613_0003362
634 Ga0495581_0000059
635 Ga0495684_0000895
636 Ga0495684_0132576
637 Ga0496100_0045010
638 Ga0496102_0014018
639 Ga0496102_0020925
640 Ga0496106_0033492
641 Ga0496107_0015286
642 Ga0496108_0011314
643 Ga0496109_0032780
644 Ga0496111_0008093
645 Ga0496114_0042968
646 Ga0496114_0084430
647 Ga0496117_0078330
648 Ga0496118_0000953
649 Ga0496118_0002146
650 Ga0496126_0096969
651 Ga0501032_0061537
652 Ga0501034_0104812
653 Ga0501043_0049564
654 Ga0501046_0060126
655 Ga0501035_0021848
656 Ga0501035_0086669
657 Ga0501044_0006400
658 nmdc:mga09592_223579_c1
659 nmdc:mga08y16_77333_c1
660 nmdc:mga0n895_194228_c1
661 Ga0495619_0003976
662 Ga0500651_0000690
663 Ga0500555_007541
664 Ga0500593_042860
665 2538835082
666 2643828451
667 2643896252
668 2644478469
669 2687582195
670 2895397841
671 2939613750

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00479

G6PD_N

Glucose-6-phosphate dehydrogenase, NAD binding domain

54

226

0.95

PF02781

G6PD_C

Glucose-6-phosphate dehydrogenase, C-terminal domain

228

501

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xhl-assembly1.cif.gz_D complex structure of a glucose 6-phosphate dehydrogenase from zymomonas mobilis 0.9352 4 456
1h93-assembly1.cif.gz_A active mutant (s215->c) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides 0.9341 3 452
1dpg-assembly1.cif.gz_B glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides 0.9313 3 452
1e77-assembly1.cif.gz_A complex of active mutant (q365->c) of glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides with substrate 0.9278 3 452
4lgv-assembly1.cif.gz_D x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.9272 6 456
ID Description Score Start End Superfamily
af_P9WN71_8_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9586 6 163 3.40.50.720
af_P0AC53_13_173_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9477 11 164 3.40.50.720
af_P9WN73_32_206_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9449 11 168 3.40.50.720
af_P9WN71_8_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9355 6 163 3.40.50.720
af_O14137_172_472_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9354 166 445 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A5R2MZ40-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9943 72 163 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A6N9V909-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9898 206 322 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A659UKS1-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.986 192 304 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A528LVB6-F1-model_v4 Glucose-6-phosphate dehydrogenase (NADP(+)) 0.9779 1 334 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A0D8HCM9-F1-model_v4 Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49) 0.9742 1 139 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661

Map