F412203

General Info

Members Datasets Scaffolds Average Seq Length
335 231 670 216

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100182034|Ga0075429_1001820342
Length 216
Sequence VTITITAFELSPDGGQGLARDTRVRWALEEVGQPYEVRLVSFRAMKEPAHLALHPFGQIPTYEEGDLALFETGAIVLHIAGRHTAGLLPKDPNARARAITWMFAAVNTLEPPILELANAKLLEGDRPWNRDRLPLVEDRVRNRMGQLARRLGDADWLEGAFSAGDLMMASVLLRLRSSGMLDEYPKLAAYVARGEARPAYKRAFAAQLAVNKRGSP

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
148 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
149 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
150 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
151 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
154 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
155 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
162 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
163 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
170 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
171 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
221 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
222 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
226 2738543024 Aminobacter sp. AP02 Isolate Unclassified
227 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
228 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
229 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
230 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
231 2906610324

Type Distribution

Type Percentage (%)
Metagenomes 98.2
Metatranscriptomes 0
Isolates 1.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.78
Nodule 0.3
Rhizoplane 0.9
Rhizosphere 89.55
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100182034 3300006880 Bacteria 1841
2 rootL2_10264288 3300003322 Bacteria 2884
3 Ga0065707_10087099 3300005295 Bacteria 5165
4 Ga0070658_10001781 3300005327 Bacteria 18132
5 Ga0070658_10049503 3300005327 Bacteria 3404
6 Ga0070690_100004936 3300005330 Bacteria 7464
7 Ga0068869_100087570 3300005334 Bacteria 2336
8 Ga0068869_100338127 3300005334 Bacteria 1225
9 Ga0070680_100008738 3300005336 Bacteria 7767
10 Ga0070682_100037781 3300005337 Bacteria 2958
11 Ga0068868_100002469 3300005338 Bacteria 12824
12 Ga0068868_100007039 3300005338 Bacteria 7995
13 Ga0070689_100011173 3300005340 Bacteria 6424
14 Ga0070691_10014365 3300005341 Bacteria 3631
15 Ga0070687_100002786 3300005343 Bacteria 6648
16 Ga0070661_100026454 3300005344 Bacteria 4173
17 Ga0070692_10008219 3300005345 Bacteria 4645
18 Ga0070692_10044898 3300005345 Bacteria 2278
19 Ga0070692_10210959 3300005345 Bacteria 1142
20 Ga0070669_100004771 3300005353 Bacteria 9777
21 Ga0070709_10000425 3300005434 Bacteria 25583
22 Ga0070709_10039995 3300005434 Bacteria 2880
23 Ga0070713_100000007 3300005436 Bacteria 186402
24 Ga0070701_10008745 3300005438 Bacteria 4397
25 Ga0070711_100012501 3300005439 Bacteria 5307
26 Ga0070705_100001196 3300005440 Bacteria 14119
27 Ga0070705_100108779 3300005440 Bacteria 1766
28 Ga0070700_100023108 3300005441 Bacteria 3635
29 Ga0070694_100004615 3300005444 Bacteria 8289
30 Ga0070694_100028561 3300005444 Bacteria 3631
31 Ga0070694_100230828 3300005444 Bacteria 1392
32 Ga0070678_100248129 3300005456 Bacteria 1492
33 Ga0070678_100302842 3300005456 Bacteria 1359
34 Ga0070662_100218470 3300005457 Bacteria 1520
35 Ga0070681_10000186 3300005458 Bacteria 47903
36 Ga0068867_100027259 3300005459 Bacteria 4104
37 Ga0068867_100041412 3300005459 Bacteria 3366
38 Ga0068867_100121590 3300005459 Bacteria 2019
39 Ga0068867_100130498 3300005459 Bacteria 1952
40 Ga0070679_100000209 3300005530 Bacteria 47903
41 Ga0070679_100005379 3300005530 Bacteria 11859
42 Ga0070679_100224515 3300005530 Bacteria 1839
43 Ga0068853_100003904 3300005539 Bacteria 11430
44 Ga0070672_100298282 3300005543 Bacteria 1366
45 Ga0070686_100254809 3300005544 Bacteria 1283
46 Ga0070695_100007502 3300005545 Bacteria 6460
47 Ga0070695_100037101 3300005545 Bacteria 3070
48 Ga0070696_100024509 3300005546 Bacteria 4101
49 Ga0070696_100167400 3300005546 Bacteria 1623
50 Ga0070693_100091431 3300005547 Bacteria 1835
51 Ga0070693_100161836 3300005547 Bacteria 1426
52 Ga0070665_100000177 3300005548 Bacteria 113201
53 Ga0070704_100044939 3300005549 Bacteria 3072
54 Ga0070704_100047727 3300005549 Bacteria 2995
55 Ga0068855_100379468 3300005563 Bacteria 1552
56 Ga0068857_100001679 3300005577 Bacteria 17799
57 Ga0068854_100051486 3300005578 Bacteria 2950
58 Ga0068856_100001033 3300005614 Bacteria 29595
59 Ga0068856_100037039 3300005614 Bacteria 4785
60 Ga0068856_100097027 3300005614 Bacteria 2936
61 Ga0070702_100075029 3300005615 Bacteria 2008
62 Ga0068852_100391919 3300005616 Bacteria 1364
63 Ga0068859_100073597 3300005617 Bacteria 3455
64 Ga0068859_100075145 3300005617 Bacteria 3419
65 Ga0068861_100003769 3300005719 Bacteria 10119
66 Ga0068861_100070450 3300005719 Bacteria 2707
67 Ga0068863_100113623 3300005841 Bacteria 2580
68 Ga0068858_100054416 3300005842 Bacteria 3700
69 Ga0068860_100050090 3300005843 Bacteria 3977
70 Ga0068862_100008599 3300005844 Bacteria 8448
71 Ga0068862_100054049 3300005844 Bacteria 3438
72 Ga0068862_100147999 3300005844 Bacteria 2089
73 Ga0081540_1011962 3300005983 Bacteria 5755
74 Ga0075365_10042243 3300006038 Bacteria 2980
75 Ga0075363_100010821 3300006048 Bacteria 4349
76 Ga0075363_100126206 3300006048 Bacteria 1433
77 Ga0075432_10052209 3300006058 Bacteria 1444
78 Ga0070716_100014997 3300006173 Bacteria 3976
79 Ga0070712_100000015 3300006175 Bacteria 106593
80 Ga0075362_10003750 3300006177 Bacteria 5373
81 Ga0075362_10054409 3300006177 Bacteria 1798
82 Ga0075367_10013666 3300006178 Bacteria 4372
83 Ga0075366_10084846 3300006195 Bacteria 1894
84 Ga0097621_100027924 3300006237 Bacteria 4444
85 Ga0097621_100034677 3300006237 Bacteria 4027
86 Ga0068871_100001839 3300006358 Bacteria 14339
87 Ga0068871_100110602 3300006358 Bacteria 2311
88 Ga0075428_100000602 3300006844 Bacteria 36732
89 Ga0075428_100150801 3300006844 Bacteria 2525
90 Ga0075428_100243855 3300006844 Bacteria 1938
91 Ga0075430_100106683 3300006846 Bacteria 2337
92 Ga0075431_100937281 3300006847 Bacteria 834
93 Ga0075434_100053562 3300006871 Bacteria 4008
94 Ga0075434_100073669 3300006871 Bacteria 3407
95 Ga0075429_100004662 3300006880 Bacteria 11801
96 Ga0068865_100097355 3300006881 Bacteria 2147
97 Ga0075436_100000024 3300006914 Bacteria 115057
98 Ga0075436_100021546 3300006914 Bacteria 4424
99 Ga0097620_100073597 3300006931 Bacteria 3455
100 Ga0097620_100075148 3300006931 Bacteria 3419
101 Ga0075435_100050964 3300007076 Bacteria 3333
102 Ga0105240_10008320 3300009093 Bacteria 14846
103 Ga0105240_10146795 3300009093 Bacteria 2814
104 Ga0105240_10560434 3300009093 Bacteria 1263
105 Ga0111539_10033914 3300009094 Bacteria 6194
106 Ga0111539_10105654 3300009094 Bacteria 3303
107 Ga0111539_10120120 3300009094 Bacteria 3079
108 Ga0111539_10177286 3300009094 Bacteria 2490
109 Ga0105245_10015653 3300009098 Bacteria 6615
110 Ga0114129_10001652 3300009147 Bacteria 30334
111 Ga0105243_10004481 3300009148 Bacteria 11041
112 Ga0105243_10023078 3300009148 Bacteria 4733
113 Ga0105243_10392854 3300009148 Bacteria 1286
114 Ga0105241_10135415 3300009174 Bacteria 1999
115 Ga0105241_10161773 3300009174 Bacteria 1841
116 Ga0105241_10168016 3300009174 Bacteria 1809
117 Ga0105242_10006099 3300009176 Bacteria 9292
118 Ga0105242_10173875 3300009176 Bacteria 1894
119 Ga0105248_10359203 3300009177 Bacteria 1640
120 Ga0105237_10012578 3300009545 Bacteria 8914
121 Ga0105238_10266284 3300009551 Bacteria 1694
122 Ga0105238_10291064 3300009551 Bacteria 1615
123 Ga0105249_10020455 3300009553 Bacteria 5917
124 Ga0105249_10089017 3300009553 Bacteria 2884
125 Ga0105249_10300934 3300009553 Bacteria 1609
126 Ga0105147_102904 3300009982 Bacteria 1426
127 Ga0105239_10104630 3300010375 Bacteria 3134
128 Ga0105239_10230763 3300010375 Bacteria 2076
129 Ga0157373_10021274 3300013100 Bacteria 4710
130 Ga0157370_10014300 3300013104 Bacteria 8122
131 Ga0157369_10125436 3300013105 Bacteria 2722
132 Ga0157374_10402464 3300013296 Bacteria 1366
133 Ga0157378_10019499 3300013297 Bacteria 5962
134 Ga0157372_10108954 3300013307 Bacteria 3171
135 Ga0157375_10139055 3300013308 Bacteria 2554
136 Ga0163163_10149944 3300014325 Bacteria 2376
137 Ga0157377_10186154 3300014745 Bacteria 1309
138 Ga0157379_10004054 3300014968 Bacteria 12495
139 Ga0157379_10276047 3300014968 Bacteria 1529
140 Ga0157376_10034849 3300014969 Bacteria 4067
141 Ga0157376_10138059 3300014969 Bacteria 2184
142 Ga0209566_105543 3300025225 Bacteria 1575
143 Ga0209646_1000087 3300025246 Bacteria 193273
144 Ga0209646_1004159 3300025246 Bacteria 2680
145 Ga0209759_1012805 3300025256 Bacteria 2303
146 Ga0207697_10065537 3300025315 Bacteria 1516
147 Ga0207699_10000188 3300025906 Bacteria 37593
148 Ga0207699_10052639 3300025906 Bacteria 2411
149 Ga0207705_10143094 3300025909 Bacteria 1787
150 Ga0207654_10233200 3300025911 Bacteria 1227
151 Ga0207707_10000168 3300025912 Bacteria 68834
152 Ga0207695_10012101 3300025913 Bacteria 10371
153 Ga0207695_10076659 3300025913 Bacteria 3398
154 Ga0207693_10000048 3300025915 Bacteria 100685
155 Ga0207663_10346924 3300025916 Bacteria 1123
156 Ga0207660_10000227 3300025917 Bacteria 36209
157 Ga0207660_10010122 3300025917 Bacteria 6109
158 Ga0207660_10055048 3300025917 Bacteria 2841
159 Ga0207660_10131575 3300025917 Bacteria 1905
160 Ga0207660_10148141 3300025917 Bacteria 1801
161 Ga0207662_10001351 3300025918 Bacteria 11846
162 Ga0207649_10074195 3300025920 Bacteria 2182
163 Ga0207652_10000158 3300025921 Bacteria 73781
164 Ga0207652_10008132 3300025921 Bacteria 8422
165 Ga0207652_10090119 3300025921 Bacteria 2694
166 Ga0207681_10028515 3300025923 Bacteria 3616
167 Ga0207694_10044033 3300025924 Bacteria 3446
168 Ga0207694_10118911 3300025924 Bacteria 2108
169 Ga0207694_10170786 3300025924 Bacteria 1760
170 Ga0207700_10000014 3300025928 Bacteria 229475
171 Ga0207706_10341888 3300025933 Bacteria 1302
172 Ga0207686_10026092 3300025934 Bacteria 3406
173 Ga0207686_10165523 3300025934 Bacteria 1554
174 Ga0207686_10327730 3300025934 Bacteria 1146
175 Ga0207709_10002403 3300025935 Bacteria 11783
176 Ga0207709_10009375 3300025935 Bacteria 5386
177 Ga0207670_10059573 3300025936 Bacteria 2597
178 Ga0207704_10083882 3300025938 Bacteria 2069
179 Ga0207704_10176928 3300025938 Bacteria 1537
180 Ga0207665_10024105 3300025939 Bacteria 4010
181 Ga0207691_10027481 3300025940 Bacteria 5333
182 Ga0207711_10722484 3300025941 Bacteria 929
183 Ga0207689_10011736 3300025942 Bacteria 7510
184 Ga0207689_10634683 3300025942 Bacteria 899
185 Ga0207667_10068822 3300025949 Bacteria 3685
186 Ga0207712_10080668 3300025961 Bacteria 2367
187 Ga0207640_10020488 3300025981 Bacteria 3928
188 Ga0207640_10401338 3300025981 Bacteria 1117
189 Ga0207677_10002899 3300026023 Bacteria 9057
190 Ga0207677_10045430 3300026023 Bacteria 2933
191 Ga0207708_10063944 3300026075 Bacteria 2811
192 Ga0207708_10175695 3300026075 Bacteria 1698
193 Ga0207702_10000011 3300026078 Bacteria 284514
194 Ga0207702_10069876 3300026078 Bacteria 3019
195 Ga0207702_10115343 3300026078 Bacteria 2395
196 Ga0207641_10135857 3300026088 Bacteria 2213
197 Ga0207641_10167519 3300026088 Bacteria 2002
198 Ga0207648_10002687 3300026089 Bacteria 18922
199 Ga0207648_10004721 3300026089 Bacteria 13925
200 Ga0207648_10011599 3300026089 Bacteria 8298
201 Ga0207648_10193640 3300026089 Bacteria 1802
202 Ga0207676_10113849 3300026095 Bacteria 2269
203 Ga0207676_10313004 3300026095 Bacteria 1438
204 Ga0207674_10000002 3300026116 Bacteria 279738
205 Ga0207675_100008410 3300026118 Bacteria 9726
206 Ga0207675_100090812 3300026118 Bacteria 2872
207 Ga0207683_10046770 3300026121 Bacteria 3788
208 Ga0207683_10065625 3300026121 Bacteria 3200
209 Ga0209967_1009842 3300027364 Bacteria 1327
210 Ga0210000_1000344 3300027462 Bacteria 6616
211 Ga0209999_1010612 3300027543 Bacteria 1665
212 Ga0209982_1019105 3300027552 Bacteria 1050
213 Ga0209983_1019293 3300027665 Bacteria 1417
214 Ga0207428_10048729 3300027907 Bacteria 3397
215 Ga0207428_10155719 3300027907 Bacteria 1738
216 Ga0207428_10449967 3300027907 Bacteria 939
217 Ga0268266_10001008 3300028379 Bacteria 35458
218 Ga0268265_10172421 3300028380 Bacteria 1850
219 Ga0268265_10916168 3300028380 Bacteria 861
220 Ga0268264_10085554 3300028381 Bacteria 2706
221 Ga0268264_10265512 3300028381 Bacteria 1601
222 Ga0307515_10109056 3300028794 Bacteria 3255
223 Ga0307513_10004198 3300031456 Bacteria 19268
224 Ga0307513_10559567 3300031456 Bacteria 855
225 Ga0307408_100138990 3300031548 Bacteria 1905
226 Ga0307408_100369085 3300031548 Bacteria 1223
227 Ga0307516_10086526 3300031730 Bacteria 2970
228 Ga0307409_100798176 3300031995 Bacteria 951
229 Ga0307416_100894999 3300032002 Bacteria 987
230 Ga0307414_10231923 3300032004 Bacteria 1522
231 Ga0307415_100375755 3300032126 Bacteria 1205
232 Ga0373948_0002090 3300034817 Bacteria 2900
233 Ga0373950_0055179 3300034818 Bacteria 787
234 Ga0373928_0022779 3300035084 Bacteria 1331
235 Ga0373929_0024088 3300035085 Bacteria 1255
236 Ga0373940_0003292 3300035088 Bacteria 3278
237 Ga0373940_0052743 3300035088 Bacteria 1146
238 Ga0373932_0002270 3300035112 Bacteria 4913
239 Ga0373941_0017735 3300035115 Bacteria 1956
240 Ga0373960_0016643 3300035121 Bacteria 1895
241 Ga0373962_0003890 3300035242 Bacteria 3596
242 Ga0373931_0000479 3300035691 Bacteria 16290
243 Ga0373931_0099898 3300035691 Bacteria 1630
244 Ga0373935_0098935 3300035692 Bacteria 1920
245 Ga0373925_0317315 3300037068 Bacteria 1260
246 Ga0395905_0019373 3300037471 Bacteria 6450
247 Ga0395901_0459962 3300038443 Bacteria 1300
248 Ga0395901_0498668 3300038443 Bacteria 1240
249 Ga0395901_0751712 3300038443 Bacteria 968
250 Ga0439434_0009525 3300042435 Bacteria 2857
251 Ga0439444_0001836 3300042437 Bacteria 2816
252 Ga0439460_0066210 3300042461 Bacteria 1111
253 Ga0451577_0211165 3300042876 Bacteria 1753
254 Ga0453684_0539867 3300044712 Bacteria 1286
255 Ga0466959_0026108 3300045049 Bacteria 4332
256 Ga0451576_0013103 3300045051 Bacteria 9285
257 Ga0451576_0013530 3300045051 Bacteria 9127
258 Ga0451576_0042556 3300045051 Bacteria 4794
259 Ga0495629_0310204 3300046459 Bacteria 1079
260 Ga0495644_0162218 3300046523 Bacteria 857
261 Ga0495598_0191157 3300046537 Bacteria 735
262 Ga0495621_0043053 3300046539 Bacteria 1592
263 Ga0495625_0178873 3300046660 Bacteria 1412
264 Ga0495581_0023198 3300047315 Bacteria 3595
265 Ga0495636_0020548 3300047318 Bacteria 2661
266 Ga0496100_0416899 3300048903 Bacteria 1025
267 Ga0496102_0135449 3300048905 Bacteria 2308
268 Ga0496114_0690596 3300048917 Bacteria 896
269 Ga0496118_0025084 3300048921 Bacteria 5125
270 Ga0496124_0038367 3300048927 Bacteria 4161
271 Ga0496125_0044360 3300048928 Bacteria 3762
272 Ga0496126_0051944 3300048929 Bacteria 3729
273 Ga0501032_0209046 3300049569 Bacteria 1273
274 Ga0501033_0228417 3300049570 Bacteria 1323
275 Ga0501037_0270881 3300049573 Bacteria 1185
276 Ga0501038_0468242 3300049574 Bacteria 967
277 Ga0501039_0702434 3300049575 Bacteria 791
278 Ga0501040_0058379 3300049576 Bacteria 2650
279 Ga0501043_0108115 3300049579 Bacteria 2185
280 Ga0501047_0376824 3300049581 Bacteria 1254
281 Ga0501047_0588677 3300049581 Bacteria 935
282 Ga0501067_0084552 3300049583 Bacteria 1760
283 Ga0501067_0105652 3300049583 Bacteria 1565
284 Ga0501068_0117878 3300049584 Bacteria 1654
285 Ga0501069_0018443 3300049585 Bacteria 3765
286 Ga0501071_0206717 3300049587 Bacteria 1476
287 Ga0501071_0591795 3300049587 Bacteria 853
288 Ga0501072_0294203 3300049588 Bacteria 1291
289 Ga0501073_0072969 3300049589 Bacteria 2390
290 Ga0501074_0085015 3300049590 Bacteria 2267
291 Ga0501075_0179127 3300049591 Bacteria 1617
292 Ga0501075_0232210 3300049591 Bacteria 1407
293 Ga0501076_0047390 3300049592 Bacteria 3398
294 Ga0501076_0135234 3300049592 Bacteria 2001
295 Ga0501077_0426826 3300049593 Bacteria 848
296 Ga0501249_013579 3300049679 Bacteria 1733
297 Ga0501079_0403569 3300049741 Bacteria 1072
298 Ga0501080_0105506 3300049742 Bacteria 2612
299 Ga0501080_0521101 3300049742 Bacteria 1061
300 Ga0501083_0106234 3300049744 Bacteria 1848
301 Ga0501241_094753 3300049758 Unclassified 636
302 Ga0501035_0159139 3300049822 Bacteria 1956
303 Ga0501044_0174963 3300049823 Bacteria 2116
304 Ga0501045_0093720 3300049824 Bacteria 2221
305 nmdc:mga0yw44_157578_c1 3300050492 Bacteria 1485
306 nmdc:mga0k408_111233_c1 3300050493 Bacteria 1619
307 nmdc:mga06z11_143858_c1 3300050494 Bacteria 1350
308 nmdc:mga04h51_241863_c1 3300050495 Bacteria 721
309 nmdc:mga05p37_2170_c1 3300050507 Bacteria 22883
310 nmdc:mga09592_193_c1 3300050508 Bacteria 43770
311 nmdc:mga09592_54062_c1 3300050508 Bacteria 3392
312 nmdc:mga0qj67_120375_c1 3300050509 Bacteria 2123
313 nmdc:mga06r32_1425_c1 3300050510 Bacteria 21581
314 nmdc:mga08y16_159710_c1 3300050511 Bacteria 2342
315 nmdc:mga08y16_262_c1 3300050511 Bacteria 47546
316 nmdc:mga08y16_649076_c1 3300050511 Bacteria 1060
317 nmdc:mga08y16_67384_c1 3300050511 Bacteria 3734
318 nmdc:mga08y16_850006_c1 3300050511 Bacteria 902
319 nmdc:mga0n895_51565_c1 3300050512 Bacteria 4037
320 nmdc:mga0rr50_42756_c1 3300050513 Bacteria 3311
321 nmdc:mga08x19_29848_c1 3300050514 Bacteria 3422
322 nmdc:mga08x19_86_c1 3300050514 Bacteria 83486
323 Ga0500583_0000358 3300053092 Bacteria 15015
324 Ga0500641_0001149 3300053096 Bacteria 9411
325 Ga0500592_027465 3300053116 Bacteria 918
326 Ga0500616_0000006 3300053153 Bacteria 944738
327 Ga0501082_0131735 3300060353 Bacteria 2170
328 Ga0501082_0934193 3300060353 Bacteria 759
329 2585336430 2582581316 Bacteria 7774528
330 2739306575 2738543024 Bacteria 5603683
331 2852105742 2852103415 Bacteria 5193810
332 2874129913 2874123672 Bacteria 7238285
333 2883359165 2883354860 Bacteria 5865246
334 2885416276 2885409591 Bacteria 9235467
335 2906617305
336 Ga0075429_100182034
337 rootL2_10264288
338 Ga0065707_10087099
339 Ga0070658_10001781
340 Ga0070658_10049503
341 Ga0070690_100004936
342 Ga0068869_100087570
343 Ga0068869_100338127
344 Ga0070680_100008738
345 Ga0070682_100037781
346 Ga0068868_100002469
347 Ga0068868_100007039
348 Ga0070689_100011173
349 Ga0070691_10014365
350 Ga0070687_100002786
351 Ga0070661_100026454
352 Ga0070692_10008219
353 Ga0070692_10044898
354 Ga0070692_10210959
355 Ga0070669_100004771
356 Ga0070709_10000425
357 Ga0070709_10039995
358 Ga0070713_100000007
359 Ga0070701_10008745
360 Ga0070711_100012501
361 Ga0070705_100001196
362 Ga0070705_100108779
363 Ga0070700_100023108
364 Ga0070694_100004615
365 Ga0070694_100028561
366 Ga0070694_100230828
367 Ga0070678_100248129
368 Ga0070678_100302842
369 Ga0070662_100218470
370 Ga0070681_10000186
371 Ga0068867_100027259
372 Ga0068867_100041412
373 Ga0068867_100121590
374 Ga0068867_100130498
375 Ga0070679_100000209
376 Ga0070679_100005379
377 Ga0070679_100224515
378 Ga0068853_100003904
379 Ga0070672_100298282
380 Ga0070686_100254809
381 Ga0070695_100007502
382 Ga0070695_100037101
383 Ga0070696_100024509
384 Ga0070696_100167400
385 Ga0070693_100091431
386 Ga0070693_100161836
387 Ga0070665_100000177
388 Ga0070704_100044939
389 Ga0070704_100047727
390 Ga0068855_100379468
391 Ga0068857_100001679
392 Ga0068854_100051486
393 Ga0068856_100001033
394 Ga0068856_100037039
395 Ga0068856_100097027
396 Ga0070702_100075029
397 Ga0068852_100391919
398 Ga0068859_100073597
399 Ga0068859_100075145
400 Ga0068861_100003769
401 Ga0068861_100070450
402 Ga0068863_100113623
403 Ga0068858_100054416
404 Ga0068860_100050090
405 Ga0068862_100008599
406 Ga0068862_100054049
407 Ga0068862_100147999
408 Ga0081540_1011962
409 Ga0075365_10042243
410 Ga0075363_100010821
411 Ga0075363_100126206
412 Ga0075432_10052209
413 Ga0070716_100014997
414 Ga0070712_100000015
415 Ga0075362_10003750
416 Ga0075362_10054409
417 Ga0075367_10013666
418 Ga0075366_10084846
419 Ga0097621_100027924
420 Ga0097621_100034677
421 Ga0068871_100001839
422 Ga0068871_100110602
423 Ga0075428_100000602
424 Ga0075428_100150801
425 Ga0075428_100243855
426 Ga0075430_100106683
427 Ga0075431_100937281
428 Ga0075434_100053562
429 Ga0075434_100073669
430 Ga0075429_100004662
431 Ga0068865_100097355
432 Ga0075436_100000024
433 Ga0075436_100021546
434 Ga0097620_100073597
435 Ga0097620_100075148
436 Ga0075435_100050964
437 Ga0105240_10008320
438 Ga0105240_10146795
439 Ga0105240_10560434
440 Ga0111539_10033914
441 Ga0111539_10105654
442 Ga0111539_10120120
443 Ga0111539_10177286
444 Ga0105245_10015653
445 Ga0114129_10001652
446 Ga0105243_10004481
447 Ga0105243_10023078
448 Ga0105243_10392854
449 Ga0105241_10135415
450 Ga0105241_10161773
451 Ga0105241_10168016
452 Ga0105242_10006099
453 Ga0105242_10173875
454 Ga0105248_10359203
455 Ga0105237_10012578
456 Ga0105238_10266284
457 Ga0105238_10291064
458 Ga0105249_10020455
459 Ga0105249_10089017
460 Ga0105249_10300934
461 Ga0105147_102904
462 Ga0105239_10104630
463 Ga0105239_10230763
464 Ga0157373_10021274
465 Ga0157370_10014300
466 Ga0157369_10125436
467 Ga0157374_10402464
468 Ga0157378_10019499
469 Ga0157372_10108954
470 Ga0157375_10139055
471 Ga0163163_10149944
472 Ga0157377_10186154
473 Ga0157379_10004054
474 Ga0157379_10276047
475 Ga0157376_10034849
476 Ga0157376_10138059
477 Ga0209566_105543
478 Ga0209646_1000087
479 Ga0209646_1004159
480 Ga0209759_1012805
481 Ga0207697_10065537
482 Ga0207699_10000188
483 Ga0207699_10052639
484 Ga0207705_10143094
485 Ga0207654_10233200
486 Ga0207707_10000168
487 Ga0207695_10012101
488 Ga0207695_10076659
489 Ga0207693_10000048
490 Ga0207663_10346924
491 Ga0207660_10000227
492 Ga0207660_10010122
493 Ga0207660_10055048
494 Ga0207660_10131575
495 Ga0207660_10148141
496 Ga0207662_10001351
497 Ga0207649_10074195
498 Ga0207652_10000158
499 Ga0207652_10008132
500 Ga0207652_10090119
501 Ga0207681_10028515
502 Ga0207694_10044033
503 Ga0207694_10118911
504 Ga0207694_10170786
505 Ga0207700_10000014
506 Ga0207706_10341888
507 Ga0207686_10026092
508 Ga0207686_10165523
509 Ga0207686_10327730
510 Ga0207709_10002403
511 Ga0207709_10009375
512 Ga0207670_10059573
513 Ga0207704_10083882
514 Ga0207704_10176928
515 Ga0207665_10024105
516 Ga0207691_10027481
517 Ga0207711_10722484
518 Ga0207689_10011736
519 Ga0207689_10634683
520 Ga0207667_10068822
521 Ga0207712_10080668
522 Ga0207640_10020488
523 Ga0207640_10401338
524 Ga0207677_10002899
525 Ga0207677_10045430
526 Ga0207708_10063944
527 Ga0207708_10175695
528 Ga0207702_10000011
529 Ga0207702_10069876
530 Ga0207702_10115343
531 Ga0207641_10135857
532 Ga0207641_10167519
533 Ga0207648_10002687
534 Ga0207648_10004721
535 Ga0207648_10011599
536 Ga0207648_10193640
537 Ga0207676_10113849
538 Ga0207676_10313004
539 Ga0207674_10000002
540 Ga0207675_100008410
541 Ga0207675_100090812
542 Ga0207683_10046770
543 Ga0207683_10065625
544 Ga0209967_1009842
545 Ga0210000_1000344
546 Ga0209999_1010612
547 Ga0209982_1019105
548 Ga0209983_1019293
549 Ga0207428_10048729
550 Ga0207428_10155719
551 Ga0207428_10449967
552 Ga0268266_10001008
553 Ga0268265_10172421
554 Ga0268265_10916168
555 Ga0268264_10085554
556 Ga0268264_10265512
557 Ga0307515_10109056
558 Ga0307513_10004198
559 Ga0307513_10559567
560 Ga0307408_100138990
561 Ga0307408_100369085
562 Ga0307516_10086526
563 Ga0307409_100798176
564 Ga0307416_100894999
565 Ga0307414_10231923
566 Ga0307415_100375755
567 Ga0373948_0002090
568 Ga0373950_0055179
569 Ga0373928_0022779
570 Ga0373929_0024088
571 Ga0373940_0003292
572 Ga0373940_0052743
573 Ga0373932_0002270
574 Ga0373941_0017735
575 Ga0373960_0016643
576 Ga0373962_0003890
577 Ga0373931_0000479
578 Ga0373931_0099898
579 Ga0373935_0098935
580 Ga0373925_0317315
581 Ga0395905_0019373
582 Ga0395901_0459962
583 Ga0395901_0498668
584 Ga0395901_0751712
585 Ga0439434_0009525
586 Ga0439444_0001836
587 Ga0439460_0066210
588 Ga0451577_0211165
589 Ga0453684_0539867
590 Ga0466959_0026108
591 Ga0451576_0013103
592 Ga0451576_0013530
593 Ga0451576_0042556
594 Ga0495629_0310204
595 Ga0495644_0162218
596 Ga0495598_0191157
597 Ga0495621_0043053
598 Ga0495625_0178873
599 Ga0495581_0023198
600 Ga0495636_0020548
601 Ga0496100_0416899
602 Ga0496102_0135449
603 Ga0496114_0690596
604 Ga0496118_0025084
605 Ga0496124_0038367
606 Ga0496125_0044360
607 Ga0496126_0051944
608 Ga0501032_0209046
609 Ga0501033_0228417
610 Ga0501037_0270881
611 Ga0501038_0468242
612 Ga0501039_0702434
613 Ga0501040_0058379
614 Ga0501043_0108115
615 Ga0501047_0376824
616 Ga0501047_0588677
617 Ga0501067_0084552
618 Ga0501067_0105652
619 Ga0501068_0117878
620 Ga0501069_0018443
621 Ga0501071_0206717
622 Ga0501071_0591795
623 Ga0501072_0294203
624 Ga0501073_0072969
625 Ga0501074_0085015
626 Ga0501075_0179127
627 Ga0501075_0232210
628 Ga0501076_0047390
629 Ga0501076_0135234
630 Ga0501077_0426826
631 Ga0501249_013579
632 Ga0501079_0403569
633 Ga0501080_0105506
634 Ga0501080_0521101
635 Ga0501083_0106234
636 Ga0501241_094753
637 Ga0501035_0159139
638 Ga0501044_0174963
639 Ga0501045_0093720
640 nmdc:mga0yw44_157578_c1
641 nmdc:mga0k408_111233_c1
642 nmdc:mga06z11_143858_c1
643 nmdc:mga04h51_241863_c1
644 nmdc:mga05p37_2170_c1
645 nmdc:mga09592_193_c1
646 nmdc:mga09592_54062_c1
647 nmdc:mga0qj67_120375_c1
648 nmdc:mga06r32_1425_c1
649 nmdc:mga08y16_159710_c1
650 nmdc:mga08y16_262_c1
651 nmdc:mga08y16_649076_c1
652 nmdc:mga08y16_67384_c1
653 nmdc:mga08y16_850006_c1
654 nmdc:mga0n895_51565_c1
655 nmdc:mga0rr50_42756_c1
656 nmdc:mga08x19_29848_c1
657 nmdc:mga08x19_86_c1
658 Ga0500583_0000358
659 Ga0500641_0001149
660 Ga0500592_027465
661 Ga0500616_0000006
662 Ga0501082_0131735
663 Ga0501082_0934193
664 2585336430
665 2739306575
666 2852105742
667 2874129913
668 2883359165
669 2885416276
670 2906617305

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

22

86

0.93

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

15

81

0.92

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

113

193

0.91

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

22

82

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ycd-assembly1.cif.gz_A-2 structure of a novel glutathione transferase from agrobacterium tumefaciens. 0.9718 2 211
3lq7-assembly1.cif.gz_B crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.965 1 213
3lq7-assembly1.cif.gz_A crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9628 1 213
3lq7-assembly1.cif.gz_A crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9582 1 213
3lq7-assembly1.cif.gz_B crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9555 1 213
ID Description Score Start End Superfamily
2ycdA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.989 2 87 3.40.30.10
3lq7A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9865 2 87 3.40.30.10
2ycdA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9778 2 87 3.40.30.10
3lq7A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9737 2 87 3.40.30.10
2ycdA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9438 88 204 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A527H6A2-F1-model_v4 Glutathione S-transferase 0.9952 1 148 GO:0016740
AF-A0A529NGU8-F1-model_v4 Glutathione S-transferase 0.9943 1 108 GO:0016740
AF-A0A086P651-F1-model_v4 Glutathione S-transferase 0.9912 1 109 GO:0016740
AF-A0A527A1T9-F1-model_v4 Glutathione S-transferase 0.9894 1 78 GO:0016740
AF-A0A529NGU8-F1-model_v4 Glutathione S-transferase 0.9853 1 108 GO:0016740

Map