F412221

General Info

Members Datasets Scaffolds Average Seq Length
335 235 670 281

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10167304|Ga0114129_101673042
Length 302
Sequence MTTSAPDLYRHTAARDAQSAAPTFPRSADVEAIVRLALAEDVGRGDLTTEATVDANATAIAELLQKAPGVLCGLPVVDEVFAQLDPRVRVIRLAHEGSSSDEPRRVVVRIEGPATAILTGERTALNFVQRLSGVATMSRRAAELVRGTQARVIDTRKTTPGMRVLEKYAVRIGGASNHRAGLDDGFLIKENHIRAAGGITRAVQAAELRAAPGQVVEVEVTNLDELEEALTAGARLILLDNFTEAGLRLAVVQTAGRARLEASGGITLDNLAAIAATGVDFISLGALTHSAGSLDFSLEVRP

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
105 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
171 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
189 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
190 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
191 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
192 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
193 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
194 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
195 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
234 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
235 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 5.07
Rhizosphere 86.27
Stem 0
Stem Tuber 0
Unclassified 1.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10167304 3300009147 Bacteria 2999
2 MBSR1b_contig_9199985 2162886012 Bacteria 1118
3 JGI24737J22298_10075327 3300001990 Bacteria 1006
4 Ga0070658_10000364 3300005327 Bacteria 39430
5 Ga0070676_10000047 3300005328 Bacteria 38146
6 Ga0070683_100122542 3300005329 Bacteria 2456
7 Ga0070690_100000098 3300005330 Bacteria 44551
8 Ga0070690_100041832 3300005330 Bacteria 2902
9 Ga0070670_100003364 3300005331 Bacteria 13247
10 Ga0070677_10000063 3300005333 Bacteria 33591
11 Ga0068869_100000030 3300005334 Bacteria 61018
12 Ga0070666_10000458 3300005335 Bacteria 24870
13 Ga0068868_100000118 3300005338 Bacteria 49828
14 Ga0070660_100000050 3300005339 Bacteria 68623
15 Ga0070689_100000415 3300005340 Bacteria 25092
16 Ga0070689_100161558 3300005340 Bacteria 1811
17 Ga0070691_10121190 3300005341 Unclassified 1317
18 Ga0070687_100000138 3300005343 Bacteria 25149
19 Ga0070661_100000117 3300005344 Bacteria 66096
20 Ga0070692_10017140 3300005345 Bacteria 3458
21 Ga0070668_100000051 3300005347 Bacteria 73027
22 Ga0070668_100036916 3300005347 Bacteria 3730
23 Ga0070669_100000325 3300005353 Bacteria 37285
24 Ga0070675_100000130 3300005354 Bacteria 45128
25 Ga0070671_100002282 3300005355 Bacteria 14795
26 Ga0070671_100197633 3300005355 Bacteria 1705
27 Ga0070674_100000572 3300005356 Bacteria 18557
28 Ga0070673_100036677 3300005364 Bacteria 3729
29 Ga0070688_100000060 3300005365 Bacteria 53765
30 Ga0070659_100000161 3300005366 Bacteria 51528
31 Ga0070659_100134903 3300005366 Bacteria 2007
32 Ga0070667_100000585 3300005367 Bacteria 35928
33 Ga0070709_10074039 3300005434 Bacteria 2206
34 Ga0070714_100313787 3300005435 Bacteria 1465
35 Ga0070701_10014361 3300005438 Bacteria 3629
36 Ga0070711_100116228 3300005439 Bacteria 1971
37 Ga0070705_100000326 3300005440 Bacteria 28155
38 Ga0070700_100036164 3300005441 Bacteria 2993
39 Ga0070708_100026355 3300005445 Bacteria 4974
40 Ga0070708_100053151 3300005445 Bacteria 3593
41 Ga0070708_100278520 3300005445 Bacteria 1574
42 Ga0070708_100469220 3300005445 Bacteria 1187
43 Ga0070663_100044656 3300005455 Bacteria 3126
44 Ga0070662_100000392 3300005457 Bacteria 26173
45 Ga0068867_100000317 3300005459 Bacteria 31905
46 Ga0068867_100085105 3300005459 Bacteria 2390
47 Ga0070685_10000091 3300005466 Bacteria 55498
48 Ga0070685_10055689 3300005466 Bacteria 2298
49 Ga0070706_100000006 3300005467 Bacteria 262251
50 Ga0070706_100045069 3300005467 Bacteria 4074
51 Ga0070706_100498462 3300005467 Bacteria 1133
52 Ga0070707_100102482 3300005468 Bacteria 2773
53 Ga0070707_100121696 3300005468 Bacteria 2534
54 Ga0070698_100156731 3300005471 Bacteria 2223
55 Ga0070698_100159356 3300005471 Bacteria 2201
56 Ga0070698_100530314 3300005471 Bacteria 1116
57 Ga0070699_100005296 3300005518 Bacteria 11314
58 Ga0070699_100013921 3300005518 Bacteria 6918
59 Ga0070699_100110565 3300005518 Bacteria 2412
60 Ga0070679_100029014 3300005530 Bacteria 5458
61 Ga0070679_100048090 3300005530 Bacteria 4251
62 Ga0070684_100026207 3300005535 Bacteria 4909
63 Ga0070697_100005087 3300005536 Bacteria 10100
64 Ga0070697_100236887 3300005536 Bacteria 1558
65 Ga0068853_100000168 3300005539 Bacteria 45251
66 Ga0070672_100000413 3300005543 Bacteria 24736
67 Ga0070686_100002752 3300005544 Bacteria 9682
68 Ga0070665_100062636 3300005548 Bacteria 3729
69 Ga0070665_100066052 3300005548 Bacteria 3629
70 Ga0070704_100010371 3300005549 Bacteria 5666
71 Ga0068855_100000205 3300005563 Bacteria 75775
72 Ga0070664_100456708 3300005564 Bacteria 1173
73 Ga0070664_100485754 3300005564 Bacteria 1137
74 Ga0068857_100000129 3300005577 Bacteria 45576
75 Ga0068857_100008573 3300005577 Bacteria 8842
76 Ga0068854_100000250 3300005578 Bacteria 36541
77 Ga0068856_100005213 3300005614 Bacteria 12828
78 Ga0070702_100031168 3300005615 Bacteria 2915
79 Ga0068852_100000245 3300005616 Bacteria 36948
80 Ga0068852_100062244 3300005616 Bacteria 3245
81 Ga0068859_100000218 3300005617 Bacteria 56857
82 Ga0068864_100000408 3300005618 Bacteria 37250
83 Ga0068866_10000026 3300005718 Bacteria 59473
84 Ga0068861_100000053 3300005719 Bacteria 53769
85 Ga0068861_100328534 3300005719 Bacteria 1334
86 Ga0068851_10000095 3300005834 Bacteria 48657
87 Ga0068851_10070709 3300005834 Bacteria 1805
88 Ga0068870_10000141 3300005840 Bacteria 25078
89 Ga0068863_100001172 3300005841 Bacteria 26170
90 Ga0068858_100001427 3300005842 Bacteria 24562
91 Ga0068860_100001481 3300005843 Bacteria 25356
92 Ga0068860_100025323 3300005843 Bacteria 5726
93 Ga0068862_100000535 3300005844 Bacteria 39698
94 Ga0081540_1001160 3300005983 Bacteria 23192
95 Ga0081540_1001298 3300005983 Bacteria 21828
96 Ga0081540_1002770 3300005983 Bacteria 14218
97 Ga0081539_10002491 3300005985 Bacteria 25867
98 Ga0070717_10001822 3300006028 Bacteria 14898
99 Ga0070717_10026299 3300006028 Bacteria 4641
100 Ga0070717_10034284 3300006028 Bacteria 4103
101 Ga0097621_100000570 3300006237 Bacteria 25924
102 Ga0068871_100000143 3300006358 Bacteria 46464
103 Ga0068871_100012870 3300006358 Bacteria 6194
104 Ga0075428_100065537 3300006844 Bacteria 3978
105 Ga0075430_100051422 3300006846 Bacteria 3472
106 Ga0075430_100137216 3300006846 Bacteria 2037
107 Ga0068865_100000077 3300006881 Bacteria 51600
108 Ga0068865_100056308 3300006881 Bacteria 2739
109 Ga0097620_100000218 3300006931 Bacteria 56857
110 Ga0105240_10014212 3300009093 Bacteria 10874
111 Ga0111539_10052273 3300009094 Bacteria 4864
112 Ga0111539_10055254 3300009094 Bacteria 4720
113 Ga0111539_10065301 3300009094 Bacteria 4301
114 Ga0105245_10000841 3300009098 Bacteria 27906
115 Ga0105247_10000615 3300009101 Bacteria 28678
116 Ga0114129_10050035 3300009147 Bacteria 5871
117 Ga0114129_10815042 3300009147 Bacteria 1190
118 Ga0105243_10000914 3300009148 Bacteria 27704
119 Ga0105241_10000444 3300009174 Bacteria 31192
120 Ga0105241_10157207 3300009174 Bacteria 1865
121 Ga0105241_10410902 3300009174 Bacteria 1189
122 Ga0105242_10000925 3300009176 Bacteria 22817
123 Ga0105242_10040566 3300009176 Bacteria 3751
124 Ga0105248_10000420 3300009177 Bacteria 48678
125 Ga0105237_10000339 3300009545 Bacteria 65782
126 Ga0105238_10000245 3300009551 Bacteria 60477
127 Ga0105249_10000229 3300009553 Bacteria 63587
128 Ga0105239_10001848 3300010375 Bacteria 27708
129 Ga0105239_10189580 3300010375 Unclassified 2302
130 Ga0157373_10000481 3300013100 Bacteria 31671
131 Ga0157371_10000743 3300013102 Bacteria 38074
132 Ga0157369_10000161 3300013105 Bacteria 94988
133 Ga0157374_10000342 3300013296 Bacteria 43128
134 Ga0157378_10000244 3300013297 Bacteria 53235
135 Ga0163162_10000138 3300013306 Bacteria 66425
136 Ga0157372_10001412 3300013307 Bacteria 25922
137 Ga0157372_10344260 3300013307 Bacteria 1737
138 Ga0157375_10001320 3300013308 Bacteria 21394
139 Ga0163163_10010443 3300014325 Bacteria 8354
140 Ga0163163_10176606 3300014325 Bacteria 2182
141 Ga0163163_10496185 3300014325 Bacteria 1283
142 Ga0157377_10000181 3300014745 Bacteria 36462
143 Ga0157379_10000195 3300014968 Bacteria 46895
144 Ga0157376_10001254 3300014969 Bacteria 16727
145 Ga0157376_10134880 3300014969 Bacteria 2208
146 Ga0182006_1003302 3300015261 Bacteria 8332
147 Ga0163161_10062100 3300017792 Bacteria 2721
148 Ga0206350_11127482 3300020080 Bacteria 3785
149 Ga0213873_10005691 3300021358 Bacteria 2407
150 Ga0213874_10000279 3300021377 Bacteria 9943
151 Ga0213874_10005782 3300021377 Bacteria 2899
152 Ga0213874_10014988 3300021377 Bacteria 2036
153 Ga0213876_10016047 3300021384 Bacteria 3961
154 Ga0213876_10064406 3300021384 Bacteria 1935
155 Ga0213876_10068759 3300021384 Bacteria 1871
156 Ga0213876_10120529 3300021384 Bacteria 1392
157 Ga0213875_10083081 3300021388 Bacteria 1494
158 Ga0207697_10000115 3300025315 Bacteria 37680
159 Ga0207656_10000277 3300025321 Bacteria 17723
160 Ga0207682_10000100 3300025893 Bacteria 38942
161 Ga0207692_10200498 3300025898 Bacteria 1173
162 Ga0207642_10000352 3300025899 Bacteria 13792
163 Ga0207710_10000530 3300025900 Bacteria 23407
164 Ga0207688_10000045 3300025901 Bacteria 43332
165 Ga0207680_10000355 3300025903 Bacteria 21937
166 Ga0207699_10019777 3300025906 Bacteria 3597
167 Ga0207645_10000086 3300025907 Bacteria 66756
168 Ga0207643_10000031 3300025908 Bacteria 95652
169 Ga0207705_10004478 3300025909 Bacteria 10558
170 Ga0207684_10037559 3300025910 Bacteria 4109
171 Ga0207684_10056547 3300025910 Bacteria 3328
172 Ga0207654_10025230 3300025911 Bacteria 3204
173 Ga0207654_10117355 3300025911 Bacteria 1665
174 Ga0207654_10247772 3300025911 Bacteria 1193
175 Ga0207695_10030157 3300025913 Bacteria 5974
176 Ga0207695_10496952 3300025913 Bacteria 1102
177 Ga0207671_10001358 3300025914 Bacteria 28581
178 Ga0207660_10286412 3300025917 Bacteria 1309
179 Ga0207662_10000056 3300025918 Bacteria 49440
180 Ga0207657_10000033 3300025919 Bacteria 128982
181 Ga0207649_10007446 3300025920 Bacteria 5954
182 Ga0207652_10114297 3300025921 Bacteria 2397
183 Ga0207652_10154858 3300025921 Bacteria 2053
184 Ga0207646_10013895 3300025922 Bacteria 7678
185 Ga0207646_10037566 3300025922 Bacteria 4365
186 Ga0207646_10151741 3300025922 Bacteria 2090
187 Ga0207681_10000166 3300025923 Bacteria 54482
188 Ga0207650_10000305 3300025925 Bacteria 48659
189 Ga0207659_10000103 3300025926 Bacteria 50400
190 Ga0207687_10001081 3300025927 Bacteria 18512
191 Ga0207644_10001343 3300025931 Bacteria 15806
192 Ga0207690_10004431 3300025932 Bacteria 8285
193 Ga0207706_10000303 3300025933 Bacteria 53405
194 Ga0207686_10005356 3300025934 Bacteria 6880
195 Ga0207686_10097211 3300025934 Bacteria 1958
196 Ga0207709_10001792 3300025935 Bacteria 14393
197 Ga0207670_10000082 3300025936 Bacteria 66331
198 Ga0207669_10000189 3300025937 Bacteria 27965
199 Ga0207704_10000087 3300025938 Bacteria 54736
200 Ga0207691_10000035 3300025940 Bacteria 110640
201 Ga0207711_10000208 3300025941 Bacteria 62806
202 Ga0207711_10100299 3300025941 Bacteria 2561
203 Ga0207689_10000012 3300025942 Bacteria 122873
204 Ga0207661_10000731 3300025944 Bacteria 21330
205 Ga0207679_10000253 3300025945 Bacteria 40824
206 Ga0207667_10003992 3300025949 Bacteria 18129
207 Ga0207651_10000029 3300025960 Bacteria 67124
208 Ga0207712_10000192 3300025961 Bacteria 62880
209 Ga0207668_10032574 3300025972 Bacteria 3445
210 Ga0207668_10318971 3300025972 Bacteria 1289
211 Ga0207640_10000569 3300025981 Bacteria 22011
212 Ga0207658_10000651 3300025986 Bacteria 30352
213 Ga0207658_10191633 3300025986 Bacteria 1700
214 Ga0207677_10000196 3300026023 Bacteria 48661
215 Ga0207677_10382153 3300026023 Bacteria 1189
216 Ga0207703_10000239 3300026035 Bacteria 62391
217 Ga0207639_10000227 3300026041 Bacteria 42131
218 Ga0207678_10001711 3300026067 Bacteria 20099
219 Ga0207708_10054395 3300026075 Bacteria 3052
220 Ga0207702_10001102 3300026078 Bacteria 27600
221 Ga0207702_10600666 3300026078 Unclassified 1080
222 Ga0207641_10001188 3300026088 Bacteria 26101
223 Ga0207648_10000315 3300026089 Bacteria 53058
224 Ga0207648_10026408 3300026089 Bacteria 5160
225 Ga0207648_10077059 3300026089 Bacteria 2906
226 Ga0207676_10000238 3300026095 Bacteria 48232
227 Ga0207676_10289494 3300026095 Bacteria 1491
228 Ga0207674_10000286 3300026116 Bacteria 63883
229 Ga0207674_10004855 3300026116 Bacteria 16099
230 Ga0207674_10440583 3300026116 Unclassified 1259
231 Ga0207675_100000026 3300026118 Bacteria 110515
232 Ga0207683_10000090 3300026121 Bacteria 72779
233 Ga0207698_10000210 3300026142 Bacteria 36586
234 Ga0207698_10046799 3300026142 Bacteria 3270
235 Ga0207428_10119586 3300027907 Bacteria 2021
236 Ga0268266_10000628 3300028379 Bacteria 47978
237 Ga0268265_10000533 3300028380 Bacteria 38830
238 Ga0268264_10000522 3300028381 Bacteria 48701
239 Ga0268264_10027133 3300028381 Bacteria 4678
240 Ga0265319_1000015 3300028563 Bacteria 176382
241 Ga0265320_10027177 3300031240 Unclassified 2987
242 Ga0265320_10043402 3300031240 Bacteria 2223
243 Ga0307405_10129724 3300031731 Bacteria 1740
244 Ga0316577_10002351 3300031733 Bacteria 9337
245 Ga0307407_10000041 3300031903 Bacteria 65180
246 Ga0307411_10621199 3300032005 Bacteria 932
247 Ga0373956_0001662 3300035119 Bacteria 9153
248 Ga0373955_0187368 3300035172 Bacteria 1229
249 Ga0373935_0214773 3300035692 Bacteria 1334
250 Ga0373927_0000009 3300035695 Bacteria 186799
251 Ga0373933_0003893 3300035724 Bacteria 8235
252 Ga0373933_0005767 3300035724 Bacteria 6736
253 Ga0316582_0089542 3300036647 Bacteria 2023
254 Ga0395900_0001240 3300037418 Bacteria 31317
255 Ga0395898_0001183 3300037466 Bacteria 39710
256 Ga0436364_0309374 3300037853 Bacteria 1458
257 Ga0436364_0496747 3300037853 Bacteria 12455
258 Ga0436364_1189683 3300037853 Bacteria 6982
259 Ga0436365_0110418 3300039437 Bacteria 1305
260 Ga0436365_0130869 3300039437 Bacteria 2525
261 Ga0436365_0135600 3300039437 Bacteria 15237
262 Ga0436365_0519198 3300039437 Bacteria 7359
263 Ga0436365_0547247 3300039437 Bacteria 9788
264 Ga0436365_0592067 3300039437 Bacteria 1289
265 Ga0436365_1468503 3300039437 Bacteria 2326
266 Ga0436363_0572509 3300039450 Bacteria 1825
267 Ga0436363_0645487 3300039450 Unclassified 3024
268 Ga0436363_0942783 3300039450 Bacteria 1775
269 Ga0436363_1236354 3300039450 Bacteria 27353
270 Ga0436363_1327862 3300039450 Bacteria 6081
271 Ga0436363_1354269 3300039450 Bacteria 1257
272 Ga0436362_0200775 3300039453 Bacteria 2276
273 Ga0436362_0941391 3300039453 Bacteria 12509
274 Ga0439448_0112330 3300042005 Bacteria 931
275 Ga0450920_024652 3300042122 Bacteria 1169
276 Ga0450894_000822 3300042131 Bacteria 4996
277 Ga0450896_001291 3300042133 Bacteria 3038
278 Ga0450906_004392 3300042145 Bacteria 2956
279 Ga0466969_0000773 3300044656 Bacteria 17432
280 Ga0466972_0023105 3300044658 Bacteria 3094
281 Ga0466972_0061656 3300044658 Bacteria 1798
282 Ga0466965_0178239 3300044683 Bacteria 1120
283 Ga0466966_0001114 3300044684 Bacteria 17238
284 Ga0466963_0021187 3300044694 Bacteria 4097
285 Ga0466963_0048827 3300044694 Bacteria 2798
286 Ga0466963_0219141 3300044694 Bacteria 1332
287 Ga0466964_0000308 3300044706 Bacteria 14405
288 Ga0466971_0013005 3300044719 Bacteria 3651
289 Ga0466968_0000040 3300044735 Bacteria 36417
290 Ga0466970_0000014 3300044765 Bacteria 69370
291 Ga0466957_0126493 3300044842 Bacteria 1633
292 Ga0466957_0249093 3300044842 Bacteria 1181
293 Ga0466959_0008053 3300045049 Bacteria 7428
294 Ga0466959_0191363 3300045049 Bacteria 1428
295 Ga0466959_0271435 3300045049 Bacteria 1166
296 Ga0466958_0131450 3300045836 Bacteria 1572
297 Ga0466967_0007145 3300045976 Bacteria 8015
298 Ga0466967_0010564 3300045976 Bacteria 6934
299 Ga0495653_0095294 3300046463 Bacteria 2167
300 Ga0495654_0099299 3300046530 Bacteria 1342
301 Ga0495645_0004740 3300046543 Bacteria 9297
302 Ga0495658_0014365 3300046683 Bacteria 4046
303 Ga0495636_0020184 3300047318 Bacteria 2684
304 Ga0495684_0065237 3300047471 Bacteria 2768
305 Ga0496100_0013895 3300048903 Bacteria 4659
306 Ga0496101_0490343 3300048904 Bacteria 970
307 Ga0496102_0000002 3300048905 Bacteria 814588
308 Ga0496102_0004726 3300048905 Bacteria 11533
309 Ga0496103_0000017 3300048906 Bacteria 244768
310 Ga0496104_0000001 3300048907 Bacteria 711867
311 Ga0496104_0025335 3300048907 Bacteria 5468
312 Ga0496105_0030481 3300048908 Bacteria 4420
313 Ga0496108_0243848 3300048911 Bacteria 1563
314 Ga0496109_0179605 3300048912 Bacteria 1987
315 Ga0496110_0002884 3300048913 Bacteria 12998
316 Ga0496111_0000021 3300048914 Bacteria 67813
317 Ga0496112_0000088 3300048915 Bacteria 60691
318 Ga0496113_0004164 3300048916 Bacteria 8832
319 Ga0496114_0005946 3300048917 Bacteria 9593
320 Ga0496114_0032519 3300048917 Bacteria 4294
321 Ga0496115_0150335 3300048918 Bacteria 1923
322 Ga0496122_0144859 3300048925 Bacteria 1478
323 Ga0496126_0187830 3300048929 Bacteria 1752
324 nmdc:mga05p37_265888_c1 3300050507 Bacteria 2051
325 nmdc:mga05p37_323730_c1 3300050507 Bacteria 1823
326 nmdc:mga09592_292134_c1 3300050508 Bacteria 1413
327 nmdc:mga08y16_193128_c1 3300050511 Bacteria 2111
328 nmdc:mga08y16_40209_c1 3300050511 Bacteria 4902
329 nmdc:mga08y16_73153_c1 3300050511 Bacteria 3571
330 Ga0495601_0043669 3300053077 Bacteria 2815
331 Ga0495601_0273558 3300053077 Bacteria 1102
332 Ga0495619_0008964 3300053085 Bacteria 6311
333 Ga0500556_0000593 3300053104 Bacteria 23858
334 Ga0500616_0004992 3300053153 Bacteria 9198
335 Ga0500599_006026 3300053736 Bacteria 1539
336 Ga0114129_10167304
337 MBSR1b_contig_9199985
338 JGI24737J22298_10075327
339 Ga0070658_10000364
340 Ga0070676_10000047
341 Ga0070683_100122542
342 Ga0070690_100000098
343 Ga0070690_100041832
344 Ga0070670_100003364
345 Ga0070677_10000063
346 Ga0068869_100000030
347 Ga0070666_10000458
348 Ga0068868_100000118
349 Ga0070660_100000050
350 Ga0070689_100000415
351 Ga0070689_100161558
352 Ga0070691_10121190
353 Ga0070687_100000138
354 Ga0070661_100000117
355 Ga0070692_10017140
356 Ga0070668_100000051
357 Ga0070668_100036916
358 Ga0070669_100000325
359 Ga0070675_100000130
360 Ga0070671_100002282
361 Ga0070671_100197633
362 Ga0070674_100000572
363 Ga0070673_100036677
364 Ga0070688_100000060
365 Ga0070659_100000161
366 Ga0070659_100134903
367 Ga0070667_100000585
368 Ga0070709_10074039
369 Ga0070714_100313787
370 Ga0070701_10014361
371 Ga0070711_100116228
372 Ga0070705_100000326
373 Ga0070700_100036164
374 Ga0070708_100026355
375 Ga0070708_100053151
376 Ga0070708_100278520
377 Ga0070708_100469220
378 Ga0070663_100044656
379 Ga0070662_100000392
380 Ga0068867_100000317
381 Ga0068867_100085105
382 Ga0070685_10000091
383 Ga0070685_10055689
384 Ga0070706_100000006
385 Ga0070706_100045069
386 Ga0070706_100498462
387 Ga0070707_100102482
388 Ga0070707_100121696
389 Ga0070698_100156731
390 Ga0070698_100159356
391 Ga0070698_100530314
392 Ga0070699_100005296
393 Ga0070699_100013921
394 Ga0070699_100110565
395 Ga0070679_100029014
396 Ga0070679_100048090
397 Ga0070684_100026207
398 Ga0070697_100005087
399 Ga0070697_100236887
400 Ga0068853_100000168
401 Ga0070672_100000413
402 Ga0070686_100002752
403 Ga0070665_100062636
404 Ga0070665_100066052
405 Ga0070704_100010371
406 Ga0068855_100000205
407 Ga0070664_100456708
408 Ga0070664_100485754
409 Ga0068857_100000129
410 Ga0068857_100008573
411 Ga0068854_100000250
412 Ga0068856_100005213
413 Ga0070702_100031168
414 Ga0068852_100000245
415 Ga0068852_100062244
416 Ga0068859_100000218
417 Ga0068864_100000408
418 Ga0068866_10000026
419 Ga0068861_100000053
420 Ga0068861_100328534
421 Ga0068851_10000095
422 Ga0068851_10070709
423 Ga0068870_10000141
424 Ga0068863_100001172
425 Ga0068858_100001427
426 Ga0068860_100001481
427 Ga0068860_100025323
428 Ga0068862_100000535
429 Ga0081540_1001160
430 Ga0081540_1001298
431 Ga0081540_1002770
432 Ga0081539_10002491
433 Ga0070717_10001822
434 Ga0070717_10026299
435 Ga0070717_10034284
436 Ga0097621_100000570
437 Ga0068871_100000143
438 Ga0068871_100012870
439 Ga0075428_100065537
440 Ga0075430_100051422
441 Ga0075430_100137216
442 Ga0068865_100000077
443 Ga0068865_100056308
444 Ga0097620_100000218
445 Ga0105240_10014212
446 Ga0111539_10052273
447 Ga0111539_10055254
448 Ga0111539_10065301
449 Ga0105245_10000841
450 Ga0105247_10000615
451 Ga0114129_10050035
452 Ga0114129_10815042
453 Ga0105243_10000914
454 Ga0105241_10000444
455 Ga0105241_10157207
456 Ga0105241_10410902
457 Ga0105242_10000925
458 Ga0105242_10040566
459 Ga0105248_10000420
460 Ga0105237_10000339
461 Ga0105238_10000245
462 Ga0105249_10000229
463 Ga0105239_10001848
464 Ga0105239_10189580
465 Ga0157373_10000481
466 Ga0157371_10000743
467 Ga0157369_10000161
468 Ga0157374_10000342
469 Ga0157378_10000244
470 Ga0163162_10000138
471 Ga0157372_10001412
472 Ga0157372_10344260
473 Ga0157375_10001320
474 Ga0163163_10010443
475 Ga0163163_10176606
476 Ga0163163_10496185
477 Ga0157377_10000181
478 Ga0157379_10000195
479 Ga0157376_10001254
480 Ga0157376_10134880
481 Ga0182006_1003302
482 Ga0163161_10062100
483 Ga0206350_11127482
484 Ga0213873_10005691
485 Ga0213874_10000279
486 Ga0213874_10005782
487 Ga0213874_10014988
488 Ga0213876_10016047
489 Ga0213876_10064406
490 Ga0213876_10068759
491 Ga0213876_10120529
492 Ga0213875_10083081
493 Ga0207697_10000115
494 Ga0207656_10000277
495 Ga0207682_10000100
496 Ga0207692_10200498
497 Ga0207642_10000352
498 Ga0207710_10000530
499 Ga0207688_10000045
500 Ga0207680_10000355
501 Ga0207699_10019777
502 Ga0207645_10000086
503 Ga0207643_10000031
504 Ga0207705_10004478
505 Ga0207684_10037559
506 Ga0207684_10056547
507 Ga0207654_10025230
508 Ga0207654_10117355
509 Ga0207654_10247772
510 Ga0207695_10030157
511 Ga0207695_10496952
512 Ga0207671_10001358
513 Ga0207660_10286412
514 Ga0207662_10000056
515 Ga0207657_10000033
516 Ga0207649_10007446
517 Ga0207652_10114297
518 Ga0207652_10154858
519 Ga0207646_10013895
520 Ga0207646_10037566
521 Ga0207646_10151741
522 Ga0207681_10000166
523 Ga0207650_10000305
524 Ga0207659_10000103
525 Ga0207687_10001081
526 Ga0207644_10001343
527 Ga0207690_10004431
528 Ga0207706_10000303
529 Ga0207686_10005356
530 Ga0207686_10097211
531 Ga0207709_10001792
532 Ga0207670_10000082
533 Ga0207669_10000189
534 Ga0207704_10000087
535 Ga0207691_10000035
536 Ga0207711_10000208
537 Ga0207711_10100299
538 Ga0207689_10000012
539 Ga0207661_10000731
540 Ga0207679_10000253
541 Ga0207667_10003992
542 Ga0207651_10000029
543 Ga0207712_10000192
544 Ga0207668_10032574
545 Ga0207668_10318971
546 Ga0207640_10000569
547 Ga0207658_10000651
548 Ga0207658_10191633
549 Ga0207677_10000196
550 Ga0207677_10382153
551 Ga0207703_10000239
552 Ga0207639_10000227
553 Ga0207678_10001711
554 Ga0207708_10054395
555 Ga0207702_10001102
556 Ga0207702_10600666
557 Ga0207641_10001188
558 Ga0207648_10000315
559 Ga0207648_10026408
560 Ga0207648_10077059
561 Ga0207676_10000238
562 Ga0207676_10289494
563 Ga0207674_10000286
564 Ga0207674_10004855
565 Ga0207674_10440583
566 Ga0207675_100000026
567 Ga0207683_10000090
568 Ga0207698_10000210
569 Ga0207698_10046799
570 Ga0207428_10119586
571 Ga0268266_10000628
572 Ga0268265_10000533
573 Ga0268264_10000522
574 Ga0268264_10027133
575 Ga0265319_1000015
576 Ga0265320_10027177
577 Ga0265320_10043402
578 Ga0307405_10129724
579 Ga0316577_10002351
580 Ga0307407_10000041
581 Ga0307411_10621199
582 Ga0373956_0001662
583 Ga0373955_0187368
584 Ga0373935_0214773
585 Ga0373927_0000009
586 Ga0373933_0003893
587 Ga0373933_0005767
588 Ga0316582_0089542
589 Ga0395900_0001240
590 Ga0395898_0001183
591 Ga0436364_0309374
592 Ga0436364_0496747
593 Ga0436364_1189683
594 Ga0436365_0110418
595 Ga0436365_0130869
596 Ga0436365_0135600
597 Ga0436365_0519198
598 Ga0436365_0547247
599 Ga0436365_0592067
600 Ga0436365_1468503
601 Ga0436363_0572509
602 Ga0436363_0645487
603 Ga0436363_0942783
604 Ga0436363_1236354
605 Ga0436363_1327862
606 Ga0436363_1354269
607 Ga0436362_0200775
608 Ga0436362_0941391
609 Ga0439448_0112330
610 Ga0450920_024652
611 Ga0450894_000822
612 Ga0450896_001291
613 Ga0450906_004392
614 Ga0466969_0000773
615 Ga0466972_0023105
616 Ga0466972_0061656
617 Ga0466965_0178239
618 Ga0466966_0001114
619 Ga0466963_0021187
620 Ga0466963_0048827
621 Ga0466963_0219141
622 Ga0466964_0000308
623 Ga0466971_0013005
624 Ga0466968_0000040
625 Ga0466970_0000014
626 Ga0466957_0126493
627 Ga0466957_0249093
628 Ga0466959_0008053
629 Ga0466959_0191363
630 Ga0466959_0271435
631 Ga0466958_0131450
632 Ga0466967_0007145
633 Ga0466967_0010564
634 Ga0495653_0095294
635 Ga0495654_0099299
636 Ga0495645_0004740
637 Ga0495658_0014365
638 Ga0495636_0020184
639 Ga0495684_0065237
640 Ga0496100_0013895
641 Ga0496101_0490343
642 Ga0496102_0000002
643 Ga0496102_0004726
644 Ga0496103_0000017
645 Ga0496104_0000001
646 Ga0496104_0025335
647 Ga0496105_0030481
648 Ga0496108_0243848
649 Ga0496109_0179605
650 Ga0496110_0002884
651 Ga0496111_0000021
652 Ga0496112_0000088
653 Ga0496113_0004164
654 Ga0496114_0005946
655 Ga0496114_0032519
656 Ga0496115_0150335
657 Ga0496122_0144859
658 Ga0496126_0187830
659 nmdc:mga05p37_265888_c1
660 nmdc:mga05p37_323730_c1
661 nmdc:mga09592_292134_c1
662 nmdc:mga08y16_193128_c1
663 nmdc:mga08y16_40209_c1
664 nmdc:mga08y16_73153_c1
665 Ga0495601_0043669
666 Ga0495601_0273558
667 Ga0495619_0008964
668 Ga0500556_0000593
669 Ga0500616_0004992
670 Ga0500599_006026

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01729

QRPTase_C

Quinolinate phosphoribosyl transferase, C-terminal domain

134

299

0.97

PF02749

QRPTase_N

Quinolinate phosphoribosyl transferase, N-terminal domain

46

132

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l0g-assembly1.cif.gz_C crystal structure of nicotinate-nucleotide pyrophosphorylase from ehrlichia chaffeensis at 2.05a resolution 0.9656 5 276
1x1o-assembly1.cif.gz_A crystal structure of project id tt0268 from thermus thermophilus hb8 0.9639 4 278
5hul-assembly1.cif.gz_A crystal structure of nadc deletion mutant in cubic space group 0.9585 5 278
3gnn-assembly1.cif.gz_A crystal structure of nicotinate-nucleotide pyrophosphorylase from burkholderi pseudomallei 0.9556 3 276
5huo-assembly1.cif.gz_E-3 crystal structure of nadc deletion mutant in c2221 space group 0.9516 4 278
ID Description Score Start End Superfamily
af_A0A1D6EUR3_65_193_3.90.1170.20 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Quinolinate phosphoribosyl transferase, N-terminal domain 0.9737 4 119 3.90.1170.20
af_Q9ZU32_47_153_3.90.1170.20 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Quinolinate phosphoribosyl transferase, N-terminal domain 0.9712 6 110 3.90.1170.20
1x1oB01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Quinolinate phosphoribosyl transferase, N-terminal domain 0.9615 1 121 3.90.1170.20
3l0gD02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.96 112 265 3.20.20.70
af_P30011_147_280_3.90.1170.20 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Quinolinate phosphoribosyl transferase, N-terminal domain 0.9563 125 259 3.90.1170.20
ID Description Score Start End GO Terms
AF-A0A848LF09-F1-model_v4 nicotinate-nucleotide diphosphorylase (carboxylating) (EC 2.4.2.19) (Quinolinate phosphoribosyltransferase [decarboxylating]) 0.9851 9 277 GO:0004514
GO:0005737
GO:0009435
GO:0034213
AF-A0A7C6DMD4-F1-model_v4 Nicotinate-nucleotide diphosphorylase (Carboxylating) 0.9841 3 156 GO:0004514
GO:0005737
GO:0009435
GO:0034213
AF-A0A4Q5Z927-F1-model_v4 deleted 0.9839 9 270
AF-A0A1Q3HHV6-F1-model_v4 nicotinate-nucleotide diphosphorylase (carboxylating) (EC 2.4.2.19) (Quinolinate phosphoribosyltransferase [decarboxylating]) 0.9838 34 278 GO:0004514
GO:0005737
GO:0009435
GO:0034213
AF-A0A4Q3C2S7-F1-model_v4 deleted 0.9832 71 278

Map