F412241

General Info

Members Datasets Scaffolds Average Seq Length
335 228 670 138

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10021841|Ga0157372_100218416
Length 176
Sequence LAENYQLLSVPPLYQREAASYNHQTRRKETVHMPSLISEVPAASPAESLQHFSRRLAFETDCSDVHQSQKTGNVDYVLVDVRNGEAFAKAHVPGAISIPTRTLTEERMAGYPRETLFVVYCAGPHCNGVHRAAIRLAGLGFAVKEMIGGLTGWVDEGIPLQGEHIPAPADGFSCEC

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
46 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
48 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
49 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
50 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
51 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
53 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
54 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
72 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
77 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
78 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
82 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
93 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
94 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
95 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
96 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
97 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
98 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
99 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
100 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
101 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
102 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
103 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
104 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
105 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
106 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
107 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
108 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
109 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
110 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
111 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
112 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
113 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
114 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
115 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
116 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
117 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
118 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
122 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
127 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
128 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
133 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
134 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
135 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
143 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
161 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
162 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
163 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
164 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
165 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
178 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
186 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
187 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
191 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
192 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
193 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
194 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
195 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
196 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
197 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
198 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
199 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
200 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
201 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
202 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
203 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
204 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
205 2718217882 Rhizobium sp. N741 Isolate Nodule
206 2718218009 Rhizobium sp. N561 Isolate Nodule
207 2718218363 Rhizobium sp. N113 Isolate Nodule
208 2718218366 Rhizobium sp. N621 Isolate Nodule
209 2721755514 Rhizobium sp. N6212 Isolate Nodule
210 2721755810 Rhizobium sp. N871 Isolate Nodule
211 2728369365 Rhizobium sp. N1341 Isolate Nodule
212 2728369397 Rhizobium sp. N1314 Isolate Nodule
213 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
214 2791355264 Rhizobium sp. S9 Isolate Nodule
215 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
216 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
217 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
218 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
219 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
220 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
221 2933599457 Rhizobium phaseoli M3 Isolate Nodule
222 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
223 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
224 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
225 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
226 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
227 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
228 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.25
Metatranscriptomes 0.3
Isolates 10.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.07
Nodule 5.67
Rhizoplane 1.49
Rhizosphere 77.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10021841 3300013307 Bacteria 6919
2 JGI25155J39150_1000058 3300002704 Bacteria 72188
3 JGI25156J39149_1000080 3300002705 Bacteria 72430
4 JGI25162J39368_1002591 3300002737 Bacteria 6796
5 JGI25154J39366_1000253 3300002738 Bacteria 34195
6 JGI25157J39369_1000101 3300002741 Bacteria 72430
7 JGI25165J46597_1001762 3300003214 Bacteria 9418
8 JGI25165J46597_1014770 3300003214 Bacteria 1060
9 Ga0058692_1000136 3300003856 Bacteria 46599
10 Ga0058692_1002723 3300003856 Bacteria 5812
11 Ga0068869_100925840 3300005334 Bacteria 755
12 Ga0070689_100479525 3300005340 Bacteria 1062
13 Ga0070668_101049384 3300005347 Bacteria 734
14 Ga0070675_101058598 3300005354 Bacteria 745
15 Ga0070671_100287128 3300005355 Bacteria 1400
16 Ga0070673_100021003 3300005364 Bacteria 4722
17 Ga0070673_100806264 3300005364 Bacteria 867
18 Ga0070688_100494976 3300005365 Bacteria 921
19 Ga0070667_100566110 3300005367 Bacteria 1045
20 Ga0070667_101680133 3300005367 Bacteria 597
21 Ga0070700_100218111 3300005441 Bacteria 1350
22 Ga0070694_100462859 3300005444 Bacteria 1003
23 Ga0070685_10031744 3300005466 Bacteria 2954
24 Ga0070672_100196000 3300005543 Bacteria 1688
25 Ga0070672_100199472 3300005543 Bacteria 1673
26 Ga0070665_100145816 3300005548 Bacteria 2370
27 Ga0068855_100025837 3300005563 Bacteria 7023
28 Ga0068854_100085096 3300005578 Bacteria 2341
29 Ga0068856_100156873 3300005614 Bacteria 2286
30 Ga0070702_100428047 3300005615 Bacteria 954
31 Ga0068852_100479193 3300005616 Bacteria 1236
32 Ga0068858_100474933 3300005842 Bacteria 1206
33 Ga0068858_101870388 3300005842 Bacteria 593
34 Ga0068860_102461404 3300005843 Bacteria 540
35 Ga0068862_100293463 3300005844 Bacteria 1494
36 Ga0075366_10104642 3300006195 Bacteria 1701
37 Ga0097621_101946054 3300006237 Bacteria 561
38 Ga0075370_10010359 3300006353 Bacteria 4873
39 Ga0075428_100043810 3300006844 Bacteria 4919
40 Ga0075431_100078096 3300006847 Bacteria 3417
41 Ga0105251_10036030 3300009011 Bacteria 2438
42 Ga0105244_10465990 3300009036 Bacteria 581
43 Ga0105240_10000005 3300009093 Bacteria 702630
44 Ga0114129_10280639 3300009147 Bacteria 2226
45 Ga0105248_11266424 3300009177 Bacteria 834
46 Ga0105237_10001344 3300009545 Bacteria 32586
47 Ga0105238_10146957 3300009551 Bacteria 2333
48 Ga0105239_10020469 3300010375 Bacteria 7298
49 Ga0157370_10000948 3300013104 Bacteria 36781
50 Ga0157372_11112665 3300013307 Bacteria 914
51 Ga0182007_10007629 3300015262 Bacteria 4515
52 Ga0182005_1008077 3300015265 Bacteria 3120
53 Ga0224712_10000092 3300022467 Bacteria 14147
54 Ga0209435_100045 3300025206 Bacteria 96483
55 Ga0209437_100122 3300025233 Bacteria 201364
56 Ga0209437_127610 3300025233 Bacteria 605
57 Ga0209646_1000154 3300025246 Bacteria 96483
58 Ga0209026_1000177 3300025250 Bacteria 96629
59 Ga0209677_100440 3300025253 Bacteria 24115
60 Ga0209677_101638 3300025253 Bacteria 9421
61 Ga0209759_1000274 3300025256 Bacteria 72593
62 Ga0209233_1000170 3300025261 Bacteria 147527
63 Ga0209233_1000297 3300025261 Bacteria 61773
64 Ga0207655_1037529 3300025728 Bacteria 2133
65 Ga0207695_10000011 3300025913 Bacteria 910221
66 Ga0207695_11172706 3300025913 Bacteria 648
67 Ga0207671_10010390 3300025914 Bacteria 7684
68 Ga0207657_11108462 3300025919 Bacteria 605
69 Ga0207681_10309285 3300025923 Bacteria 1253
70 Ga0207694_10339399 3300025924 Bacteria 1242
71 Ga0207706_11626400 3300025933 Bacteria 522
72 Ga0207670_10404875 3300025936 Bacteria 1092
73 Ga0207670_11070363 3300025936 Bacteria 680
74 Ga0207691_10150595 3300025940 Bacteria 2046
75 Ga0207691_10167603 3300025940 Bacteria 1924
76 Ga0207711_11505607 3300025941 Bacteria 616
77 Ga0207651_10025380 3300025960 Bacteria 3682
78 Ga0207668_10399945 3300025972 Bacteria 1161
79 Ga0207640_10076258 3300025981 Bacteria 2275
80 Ga0207658_10331018 3300025986 Bacteria 1321
81 Ga0207658_10733197 3300025986 Bacteria 894
82 Ga0207678_10378761 3300026067 Bacteria 1223
83 Ga0207708_10097999 3300026075 Bacteria 2266
84 Ga0207702_10072042 3300026078 Bacteria 2977
85 Ga0209281_1003642 3300027111 Bacteria 4966
86 Ga0209371_1000017 3300027312 Bacteria 625776
87 Ga0209371_1000134 3300027312 Bacteria 121747
88 Ga0209371_1000453 3300027312 Bacteria 40780
89 Ga0268266_10668459 3300028379 Bacteria 1000
90 Ga0268265_10257031 3300028380 Bacteria 1551
91 Ga0268264_12176460 3300028381 Bacteria 563
92 Ga0268256_1000116 3300030500 Bacteria 115451
93 Ga0268256_1000208 3300030500 Bacteria 66543
94 Ga0268256_1000461 3300030500 Bacteria 35515
95 Ga0268256_1000629 3300030500 Bacteria 27210
96 Ga0316183_1185279 3300030742 Bacteria 2454
97 Ga0316182_1067637 3300030745 Bacteria 982
98 Ga0316182_1375135 3300030745 Bacteria 1090
99 Ga0307513_10241651 3300031456 Bacteria 1610
100 Ga0307408_100014912 3300031548 Bacteria 5169
101 Ga0307514_10001271 3300031649 Bacteria 32966
102 Ga0316578_10011911 3300031728 Bacteria 4569
103 Ga0307405_10000826 3300031731 Bacteria 12179
104 Ga0316577_10000784 3300031733 Bacteria 13702
105 Ga0307413_10051285 3300031824 Bacteria 2485
106 Ga0307406_10017199 3300031901 Bacteria 4209
107 Ga0307412_10000128 3300031911 Bacteria 55850
108 Ga0307412_10538681 3300031911 Bacteria 978
109 Ga0307409_100018187 3300031995 Bacteria 4713
110 Ga0307416_100121111 3300032002 Bacteria 2332
111 Ga0307414_10014547 3300032004 Bacteria 4723
112 Ga0307411_10003901 3300032005 Bacteria 7033
113 Ga0316580_10023000 3300032139 Bacteria 1924
114 Ga0373939_0056279 3300035114 Bacteria 1237
115 Ga0316574_0000334 3300035398 Bacteria 18157
116 Ga0316584_0005949 3300036712 Bacteria 8234
117 Ga0439438_077475 3300041405 Bacteria 818
118 Ga0439447_000213 3300041407 Bacteria 20435
119 Ga0439466_0007397 3300041411 Bacteria 4160
120 Ga0439465_0000286 3300041413 Bacteria 14239
121 Ga0439431_0003633 3300041997 Bacteria 3403
122 Ga0439437_001828 3300042000 Bacteria 2258
123 Ga0439443_086237 3300042003 Bacteria 588
124 Ga0439445_0001991 3300042004 Bacteria 4501
125 Ga0439449_0000350 3300042007 Bacteria 16878
126 Ga0439455_0116240 3300042012 Bacteria 747
127 Ga0439463_006757 3300042016 Bacteria 2837
128 Ga0450911_000001 3300042115 Bacteria 311012
129 Ga0450902_004878 3300042137 Bacteria 2009
130 Ga0450904_000116 3300042139 Bacteria 17747
131 Ga0450905_029997 3300042142 Bacteria 835
132 Ga0439446_0005319 3300042156 Bacteria 3309
133 Ga0439435_0100084 3300042436 Bacteria 890
134 Ga0450916_032148 3300042530 Bacteria 768
135 Ga0450893_0003909 3300042532 Bacteria 2362
136 Ga0495617_010626 3300046452 Bacteria 3153
137 Ga0495627_004443 3300046453 Bacteria 5868
138 Ga0495590_0000009 3300046457 Bacteria 320425
139 Ga0495590_0017609 3300046457 Bacteria 2569
140 Ga0495591_000511 3300046458 Bacteria 30479
141 Ga0495591_079859 3300046458 Bacteria 835
142 Ga0495638_0133366 3300046460 Bacteria 1457
143 Ga0495651_0309425 3300046462 Bacteria 1057
144 Ga0495650_0015804 3300046471 Bacteria 3857
145 Ga0495605_0000008 3300046474 Bacteria 334602
146 Ga0495605_0022827 3300046474 Bacteria 3297
147 Ga0495605_0026231 3300046474 Bacteria 3030
148 Ga0495605_0040653 3300046474 Bacteria 2320
149 Ga0495584_0015814 3300046491 Bacteria 3848
150 Ga0495584_0099375 3300046491 Bacteria 1470
151 Ga0495585_0007370 3300046492 Bacteria 6743
152 Ga0495585_0159415 3300046492 Bacteria 1171
153 Ga0495585_0173237 3300046492 Bacteria 1113
154 Ga0495594_0002037 3300046499 Bacteria 10522
155 Ga0495596_0074664 3300046500 Bacteria 1316
156 Ga0495607_0002755 3300046501 Bacteria 14012
157 Ga0495607_0022384 3300046501 Bacteria 3969
158 Ga0495607_0042976 3300046501 Bacteria 2675
159 Ga0495607_0061638 3300046501 Bacteria 2130
160 Ga0495583_0000039 3300046506 Bacteria 241501
161 Ga0495583_0003487 3300046506 Bacteria 11918
162 Ga0495583_0155634 3300046506 Bacteria 945
163 Ga0495606_0001356 3300046507 Bacteria 33234
164 Ga0495606_0061170 3300046507 Bacteria 2409
165 Ga0495610_0001261 3300046512 Bacteria 22679
166 Ga0495610_0009840 3300046512 Bacteria 5991
167 Ga0495610_0047903 3300046512 Bacteria 2100
168 Ga0495616_0012839 3300046513 Bacteria 4738
169 Ga0495620_0000031 3300046515 Bacteria 120343
170 Ga0495620_0000155 3300046515 Bacteria 55845
171 Ga0495631_0005562 3300046518 Bacteria 6586
172 Ga0495631_0012987 3300046518 Bacteria 4054
173 Ga0495631_0040052 3300046518 Bacteria 2077
174 Ga0495632_0044002 3300046519 Bacteria 2229
175 Ga0495632_0077482 3300046519 Bacteria 1589
176 Ga0495632_0528018 3300046519 Bacteria 507
177 Ga0495637_0000003 3300046520 Bacteria 623293
178 Ga0495637_0003191 3300046520 Bacteria 8748
179 Ga0495637_0037919 3300046520 Bacteria 2089
180 Ga0495637_0083976 3300046520 Bacteria 1265
181 Ga0495643_0000049 3300046522 Bacteria 212242
182 Ga0495643_0005938 3300046522 Bacteria 8147
183 Ga0495643_0029169 3300046522 Bacteria 3088
184 Ga0495643_0087757 3300046522 Bacteria 1609
185 Ga0495643_0325966 3300046522 Bacteria 693
186 Ga0495644_0016511 3300046523 Bacteria 2825
187 Ga0495644_0024312 3300046523 Bacteria 2304
188 Ga0495648_0000862 3300046524 Bacteria 31961
189 Ga0495648_0013551 3300046524 Bacteria 6016
190 Ga0495648_0232854 3300046524 Bacteria 900
191 Ga0495642_0055698 3300046528 Bacteria 1632
192 Ga0495642_0155441 3300046528 Bacteria 990
193 Ga0495642_0424447 3300046528 Bacteria 587
194 Ga0495654_0005800 3300046530 Bacteria 7114
195 Ga0495654_0013732 3300046530 Bacteria 4328
196 Ga0495609_0000031 3300046538 Bacteria 213813
197 Ga0495609_0014498 3300046538 Bacteria 3703
198 Ga0495597_0004022 3300046542 Bacteria 8245
199 Ga0495597_0010850 3300046542 Bacteria 4436
200 Ga0495633_0000011 3300046558 Bacteria 268237
201 Ga0495633_0002876 3300046558 Bacteria 11798
202 Ga0495656_0304449 3300046615 Bacteria 817
203 Ga0495668_0000364 3300046616 Bacteria 59836
204 Ga0495668_0031011 3300046616 Bacteria 3013
205 Ga0495611_0000645 3300046648 Bacteria 19981
206 Ga0495611_0080004 3300046648 Bacteria 1501
207 Ga0495625_0028790 3300046660 Bacteria 4161
208 Ga0495625_0029520 3300046660 Bacteria 4099
209 Ga0495625_0627817 3300046660 Bacteria 642
210 Ga0495661_0035387 3300046665 Bacteria 3133
211 Ga0495661_0100139 3300046665 Bacteria 1632
212 Ga0495661_0144624 3300046665 Bacteria 1290
213 Ga0495661_0413307 3300046665 Bacteria 654
214 Ga0495599_0047214 3300046678 Bacteria 2698
215 Ga0495623_0005480 3300046679 Bacteria 8295
216 Ga0495669_0016111 3300046684 Bacteria 3201
217 Ga0495669_0201189 3300046684 Bacteria 952
218 Ga0495670_0001750 3300046691 Bacteria 10657
219 Ga0495670_0085368 3300046691 Bacteria 1611
220 Ga0495671_0006439 3300046692 Bacteria 6779
221 Ga0495671_0012301 3300046692 Bacteria 4678
222 Ga0495671_0135428 3300046692 Bacteria 1201
223 Ga0495671_0139152 3300046692 Bacteria 1183
224 Ga0495649_0000088 3300046694 Bacteria 79155
225 Ga0495649_0009130 3300046694 Bacteria 5911
226 Ga0495649_0403202 3300046694 Bacteria 686
227 Ga0495589_0002989 3300046794 Bacteria 9313
228 Ga0495589_0152604 3300046794 Bacteria 1102
229 Ga0495589_0220681 3300046794 Bacteria 890
230 Ga0495660_0002193 3300046810 Bacteria 12575
231 Ga0495660_0014259 3300046810 Bacteria 4603
232 Ga0495660_0062836 3300046810 Bacteria 1989
233 Ga0495660_0197822 3300046810 Bacteria 961
234 Ga0495660_0286006 3300046810 Bacteria 752
235 Ga0495604_0000745 3300047317 Bacteria 27317
236 Ga0495672_0000319 3300047320 Bacteria 63963
237 Ga0495680_0062297 3300047322 Bacteria 2868
238 Ga0495683_0000008 3300047323 Bacteria 241577
239 Ga0495683_0000136 3300047323 Bacteria 72177
240 Ga0495683_0076319 3300047323 Bacteria 1639
241 Ga0495677_0000552 3300047445 Bacteria 15461
242 Ga0495677_0011276 3300047445 Bacteria 3272
243 Ga0495679_000920 3300047446 Bacteria 18404
244 Ga0495679_001481 3300047446 Bacteria 13274
245 Ga0495679_008554 3300047446 Bacteria 4151
246 Ga0495679_012882 3300047446 Bacteria 3162
247 Ga0495685_019469 3300047447 Bacteria 2332
248 Ga0495673_0000012 3300047469 Bacteria 656908
249 Ga0495673_0009328 3300047469 Bacteria 5437
250 Ga0495673_0180252 3300047469 Bacteria 800
251 Ga0495681_0008051 3300047470 Bacteria 6644
252 Ga0495681_0025770 3300047470 Bacteria 3072
253 Ga0495681_0043870 3300047470 Bacteria 2153
254 Ga0495681_0090172 3300047470 Bacteria 1355
255 Ga0495686_0063005 3300047472 Bacteria 2298
256 Ga0495602_0012684 3300048088 Bacteria 8647
257 Ga0495626_0013406 3300048091 Bacteria 4259
258 Ga0495626_0019611 3300048091 Bacteria 3380
259 Ga0495626_0042874 3300048091 Bacteria 2124
260 Ga0495626_0330621 3300048091 Bacteria 597
261 Ga0496100_0061082 3300048903 Bacteria 2482
262 Ga0496101_0166513 3300048904 Bacteria 1692
263 Ga0496102_0101371 3300048905 Bacteria 2674
264 Ga0496103_0066404 3300048906 Bacteria 2251
265 Ga0496106_0631971 3300048909 Bacteria 856
266 Ga0496116_0066620 3300048919 Bacteria 2303
267 Ga0496117_0003941 3300048920 Bacteria 16793
268 Ga0496118_0002145 3300048921 Bacteria 27524
269 Ga0496119_0017024 3300048922 Bacteria 5495
270 Ga0496120_0014751 3300048923 Bacteria 5187
271 Ga0496121_0002644 3300048924 Bacteria 26901
272 Ga0496121_0005121 3300048924 Bacteria 17074
273 Ga0496121_0142307 3300048924 Bacteria 1777
274 Ga0496122_0045401 3300048925 Bacteria 3415
275 Ga0496122_0052549 3300048925 Bacteria 3082
276 Ga0496122_0147389 3300048925 Bacteria 1460
277 Ga0496123_0022455 3300048926 Bacteria 4862
278 Ga0496123_0027336 3300048926 Bacteria 4251
279 Ga0496124_0026574 3300048927 Bacteria 5216
280 Ga0496124_0233972 3300048927 Bacteria 1371
281 Ga0496124_0448536 3300048927 Bacteria 880
282 Ga0496125_0073953 3300048928 Bacteria 2645
283 Ga0496126_0023041 3300048929 Bacteria 6039
284 Ga0496126_0288198 3300048929 Bacteria 1358
285 Ga0496126_0919076 3300048929 Bacteria 662
286 Ga0496126_1068193 3300048929 Bacteria 601
287 Ga0495678_000018 3300049459 Bacteria 279747
288 Ga0495678_000139 3300049459 Bacteria 87263
289 Ga0495678_000256 3300049459 Bacteria 59602
290 Ga0495678_008689 3300049459 Bacteria 5100
291 Ga0495678_020280 3300049459 Bacteria 2948
292 Ga0501241_001144 3300049758 Bacteria 5514
293 Ga0501226_000003 3300049853 Bacteria 358977
294 nmdc:mga07m45_142702_c1 3300050496 Bacteria 1387
295 nmdc:mga06r32_225689_c1 3300050510 Bacteria 1862
296 Ga0500618_011462 3300053125 Bacteria 2349
297 Ga0500618_092420 3300053125 Bacteria 680
298 Ga0500633_0182911 3300053160 Bacteria 786
299 Ga0500636_0215986 3300053177 Bacteria 1003
300 Ga0500645_004133 3300053730 Bacteria 5659
301 2511134974 2510917022 Bacteria 6504556
302 2585270713 2582581307 Bacteria 6597605
303 2585277061 2582581308 Bacteria 7413247
304 2585323931 2582581315 Bacteria 7318924
305 2585333719 2582581316 Bacteria 7774528
306 2585534201 2585427527 Bacteria 7273426
307 2585551946 2585427530 Bacteria 7383882
308 2585558436 2585427531 Bacteria 6992870
309 2585904594 2585427609 Bacteria 6667127
310 2587980290 2585428125 Bacteria 6662905
311 2616308437 2615840626 Bacteria 7921970
312 2719182260 2718217882 Bacteria 6556348
313 2719732976 2718218009 Bacteria 6478651
314 2721148373 2718218363 Bacteria 6524337
315 2721165187 2718218366 Bacteria 6425255
316 2722841357 2721755514 Bacteria 6424414
317 2724045732 2721755810 Bacteria 6479005
318 2730165495 2728369365 Bacteria 6555560
319 2730299391 2728369397 Bacteria 6274511
320 2778177778 2775507266 Bacteria 7392367
321 2793349683 2791355264 Bacteria 6429314
322 2819612848 2818991448 Bacteria 6772224
323 2819638049 2818991453 Bacteria 7181617
324 2838069719 2838068647 Bacteria 6208656
325 2842423333 2842422224 Bacteria 6239196
326 2842488415 2842482326 Bacteria 7212537
327 2852389750 2852387548 Bacteria 8025568
328 2933600526 2933599457 Bacteria 5858799
329 3005420244 3005416602 Bacteria 7064308
330 8005317195 8005314921 Bacteria 7072929
331 8005485005 8005484373 Bacteria 6297373
332 8005648742 8005645114 Bacteria 6950293
333 8018127580 8018127388 Bacteria 7351159
334 8046769452 8046767195 Bacteria 7547379
335 8057578908 8057575449 Bacteria 7367519
336 Ga0157372_10021841
337 JGI25155J39150_1000058
338 JGI25156J39149_1000080
339 JGI25162J39368_1002591
340 JGI25154J39366_1000253
341 JGI25157J39369_1000101
342 JGI25165J46597_1001762
343 JGI25165J46597_1014770
344 Ga0058692_1000136
345 Ga0058692_1002723
346 Ga0068869_100925840
347 Ga0070689_100479525
348 Ga0070668_101049384
349 Ga0070675_101058598
350 Ga0070671_100287128
351 Ga0070673_100021003
352 Ga0070673_100806264
353 Ga0070688_100494976
354 Ga0070667_100566110
355 Ga0070667_101680133
356 Ga0070700_100218111
357 Ga0070694_100462859
358 Ga0070685_10031744
359 Ga0070672_100196000
360 Ga0070672_100199472
361 Ga0070665_100145816
362 Ga0068855_100025837
363 Ga0068854_100085096
364 Ga0068856_100156873
365 Ga0070702_100428047
366 Ga0068852_100479193
367 Ga0068858_100474933
368 Ga0068858_101870388
369 Ga0068860_102461404
370 Ga0068862_100293463
371 Ga0075366_10104642
372 Ga0097621_101946054
373 Ga0075370_10010359
374 Ga0075428_100043810
375 Ga0075431_100078096
376 Ga0105251_10036030
377 Ga0105244_10465990
378 Ga0105240_10000005
379 Ga0114129_10280639
380 Ga0105248_11266424
381 Ga0105237_10001344
382 Ga0105238_10146957
383 Ga0105239_10020469
384 Ga0157370_10000948
385 Ga0157372_11112665
386 Ga0182007_10007629
387 Ga0182005_1008077
388 Ga0224712_10000092
389 Ga0209435_100045
390 Ga0209437_100122
391 Ga0209437_127610
392 Ga0209646_1000154
393 Ga0209026_1000177
394 Ga0209677_100440
395 Ga0209677_101638
396 Ga0209759_1000274
397 Ga0209233_1000170
398 Ga0209233_1000297
399 Ga0207655_1037529
400 Ga0207695_10000011
401 Ga0207695_11172706
402 Ga0207671_10010390
403 Ga0207657_11108462
404 Ga0207681_10309285
405 Ga0207694_10339399
406 Ga0207706_11626400
407 Ga0207670_10404875
408 Ga0207670_11070363
409 Ga0207691_10150595
410 Ga0207691_10167603
411 Ga0207711_11505607
412 Ga0207651_10025380
413 Ga0207668_10399945
414 Ga0207640_10076258
415 Ga0207658_10331018
416 Ga0207658_10733197
417 Ga0207678_10378761
418 Ga0207708_10097999
419 Ga0207702_10072042
420 Ga0209281_1003642
421 Ga0209371_1000017
422 Ga0209371_1000134
423 Ga0209371_1000453
424 Ga0268266_10668459
425 Ga0268265_10257031
426 Ga0268264_12176460
427 Ga0268256_1000116
428 Ga0268256_1000208
429 Ga0268256_1000461
430 Ga0268256_1000629
431 Ga0316183_1185279
432 Ga0316182_1067637
433 Ga0316182_1375135
434 Ga0307513_10241651
435 Ga0307408_100014912
436 Ga0307514_10001271
437 Ga0316578_10011911
438 Ga0307405_10000826
439 Ga0316577_10000784
440 Ga0307413_10051285
441 Ga0307406_10017199
442 Ga0307412_10000128
443 Ga0307412_10538681
444 Ga0307409_100018187
445 Ga0307416_100121111
446 Ga0307414_10014547
447 Ga0307411_10003901
448 Ga0316580_10023000
449 Ga0373939_0056279
450 Ga0316574_0000334
451 Ga0316584_0005949
452 Ga0439438_077475
453 Ga0439447_000213
454 Ga0439466_0007397
455 Ga0439465_0000286
456 Ga0439431_0003633
457 Ga0439437_001828
458 Ga0439443_086237
459 Ga0439445_0001991
460 Ga0439449_0000350
461 Ga0439455_0116240
462 Ga0439463_006757
463 Ga0450911_000001
464 Ga0450902_004878
465 Ga0450904_000116
466 Ga0450905_029997
467 Ga0439446_0005319
468 Ga0439435_0100084
469 Ga0450916_032148
470 Ga0450893_0003909
471 Ga0495617_010626
472 Ga0495627_004443
473 Ga0495590_0000009
474 Ga0495590_0017609
475 Ga0495591_000511
476 Ga0495591_079859
477 Ga0495638_0133366
478 Ga0495651_0309425
479 Ga0495650_0015804
480 Ga0495605_0000008
481 Ga0495605_0022827
482 Ga0495605_0026231
483 Ga0495605_0040653
484 Ga0495584_0015814
485 Ga0495584_0099375
486 Ga0495585_0007370
487 Ga0495585_0159415
488 Ga0495585_0173237
489 Ga0495594_0002037
490 Ga0495596_0074664
491 Ga0495607_0002755
492 Ga0495607_0022384
493 Ga0495607_0042976
494 Ga0495607_0061638
495 Ga0495583_0000039
496 Ga0495583_0003487
497 Ga0495583_0155634
498 Ga0495606_0001356
499 Ga0495606_0061170
500 Ga0495610_0001261
501 Ga0495610_0009840
502 Ga0495610_0047903
503 Ga0495616_0012839
504 Ga0495620_0000031
505 Ga0495620_0000155
506 Ga0495631_0005562
507 Ga0495631_0012987
508 Ga0495631_0040052
509 Ga0495632_0044002
510 Ga0495632_0077482
511 Ga0495632_0528018
512 Ga0495637_0000003
513 Ga0495637_0003191
514 Ga0495637_0037919
515 Ga0495637_0083976
516 Ga0495643_0000049
517 Ga0495643_0005938
518 Ga0495643_0029169
519 Ga0495643_0087757
520 Ga0495643_0325966
521 Ga0495644_0016511
522 Ga0495644_0024312
523 Ga0495648_0000862
524 Ga0495648_0013551
525 Ga0495648_0232854
526 Ga0495642_0055698
527 Ga0495642_0155441
528 Ga0495642_0424447
529 Ga0495654_0005800
530 Ga0495654_0013732
531 Ga0495609_0000031
532 Ga0495609_0014498
533 Ga0495597_0004022
534 Ga0495597_0010850
535 Ga0495633_0000011
536 Ga0495633_0002876
537 Ga0495656_0304449
538 Ga0495668_0000364
539 Ga0495668_0031011
540 Ga0495611_0000645
541 Ga0495611_0080004
542 Ga0495625_0028790
543 Ga0495625_0029520
544 Ga0495625_0627817
545 Ga0495661_0035387
546 Ga0495661_0100139
547 Ga0495661_0144624
548 Ga0495661_0413307
549 Ga0495599_0047214
550 Ga0495623_0005480
551 Ga0495669_0016111
552 Ga0495669_0201189
553 Ga0495670_0001750
554 Ga0495670_0085368
555 Ga0495671_0006439
556 Ga0495671_0012301
557 Ga0495671_0135428
558 Ga0495671_0139152
559 Ga0495649_0000088
560 Ga0495649_0009130
561 Ga0495649_0403202
562 Ga0495589_0002989
563 Ga0495589_0152604
564 Ga0495589_0220681
565 Ga0495660_0002193
566 Ga0495660_0014259
567 Ga0495660_0062836
568 Ga0495660_0197822
569 Ga0495660_0286006
570 Ga0495604_0000745
571 Ga0495672_0000319
572 Ga0495680_0062297
573 Ga0495683_0000008
574 Ga0495683_0000136
575 Ga0495683_0076319
576 Ga0495677_0000552
577 Ga0495677_0011276
578 Ga0495679_000920
579 Ga0495679_001481
580 Ga0495679_008554
581 Ga0495679_012882
582 Ga0495685_019469
583 Ga0495673_0000012
584 Ga0495673_0009328
585 Ga0495673_0180252
586 Ga0495681_0008051
587 Ga0495681_0025770
588 Ga0495681_0043870
589 Ga0495681_0090172
590 Ga0495686_0063005
591 Ga0495602_0012684
592 Ga0495626_0013406
593 Ga0495626_0019611
594 Ga0495626_0042874
595 Ga0495626_0330621
596 Ga0496100_0061082
597 Ga0496101_0166513
598 Ga0496102_0101371
599 Ga0496103_0066404
600 Ga0496106_0631971
601 Ga0496116_0066620
602 Ga0496117_0003941
603 Ga0496118_0002145
604 Ga0496119_0017024
605 Ga0496120_0014751
606 Ga0496121_0002644
607 Ga0496121_0005121
608 Ga0496121_0142307
609 Ga0496122_0045401
610 Ga0496122_0052549
611 Ga0496122_0147389
612 Ga0496123_0022455
613 Ga0496123_0027336
614 Ga0496124_0026574
615 Ga0496124_0233972
616 Ga0496124_0448536
617 Ga0496125_0073953
618 Ga0496126_0023041
619 Ga0496126_0288198
620 Ga0496126_0919076
621 Ga0496126_1068193
622 Ga0495678_000018
623 Ga0495678_000139
624 Ga0495678_000256
625 Ga0495678_008689
626 Ga0495678_020280
627 Ga0501241_001144
628 Ga0501226_000003
629 nmdc:mga07m45_142702_c1
630 nmdc:mga06r32_225689_c1
631 Ga0500618_011462
632 Ga0500618_092420
633 Ga0500633_0182911
634 Ga0500636_0215986
635 Ga0500645_004133
636 2511134974
637 2585270713
638 2585277061
639 2585323931
640 2585333719
641 2585534201
642 2585551946
643 2585558436
644 2585904594
645 2587980290
646 2616308437
647 2719182260
648 2719732976
649 2721148373
650 2721165187
651 2722841357
652 2724045732
653 2730165495
654 2730299391
655 2778177778
656 2793349683
657 2819612848
658 2819638049
659 2838069719
660 2842423333
661 2842488415
662 2852389750
663 2933600526
664 3005420244
665 8005317195
666 8005485005
667 8005648742
668 8018127580
669 8046769452
670 8057578908

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

61

156

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o3w-assembly2.cif.gz_D crystal structure of bh2092 protein (residues 14-131) from bacillus halodurans, northeast structural genomics consortium target bhr228a 0.9635 12 123
3o3w-assembly2.cif.gz_F crystal structure of bh2092 protein (residues 14-131) from bacillus halodurans, northeast structural genomics consortium target bhr228a 0.9603 9 128
3nhv-assembly1.cif.gz_C crystal structure of bh2092 protein from bacillus halodurans, northeast structural genomics consortium target bhr228f 0.959 10 130
3o3w-assembly2.cif.gz_F crystal structure of bh2092 protein (residues 14-131) from bacillus halodurans, northeast structural genomics consortium target bhr228a 0.9447 9 128
3o3w-assembly2.cif.gz_D crystal structure of bh2092 protein (residues 14-131) from bacillus halodurans, northeast structural genomics consortium target bhr228a 0.9391 12 123
ID Description Score Start End Superfamily
3o3wI00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9246 10 123 3.40.250.10
af_O08446_114_219_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8948 26 130 3.40.250.10
3o3wI00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8933 10 123 3.40.250.10
3ilmD00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8914 27 129 3.40.250.10
2kl3A01 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8889 26 128 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A437MWV7-F1-model_v4 Rhodanese-like domain-containing protein 0.9959 25 130 GO:0004792
AF-A0A7K3M4L0-F1-model_v4 Rhodanese-like domain-containing protein 0.9919 41 129 GO:0004792
AF-A0A1I4RX74-F1-model_v4 Rhodanese-related sulfurtransferase 0.9915 18 129 GO:0004792
AF-A0A2W5MDJ9-F1-model_v4 deleted 0.9902 16 130
AF-A0A5E4VS51-F1-model_v4 Rhodanese 0.9868 44 116 GO:0004792

Map