F412251

General Info

Members Datasets Scaffolds Average Seq Length
335 174 670 510

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10021997|Ga0157376_100219972
Length 543
Sequence MLGLFMLFTLVKGPNLNPIKKFVMKKNIPISIFIITAAFVLNLSCNKEIEGRTDNLPALSPSNIDLDAGAWKLVLLSRPDSFGVVAPAATNSPGYLGELNEVKGLQRNLTSDQVAGIKYWAAGAVLRWNETMRELVAKHNLPPYQNADDTYPIPNSANPFAYPQFPFSNPPYAARAFGYVSAAQYDALVACWYYKKLYNRPAPYKTDSTINANATLIAKTDLPSYPSEDAVLAGVTAEMMKLLFPTEIAFVEEKAADEKASALASGKNTRSDWTAGETLGRQIASVFAARGRTDNAGKAVGTPAQWAQLEEGAKARGEIPWMSLEVPKRPPMLPFFGNVKPFLFDSLTVIALRPGPPPSTSSDEMKQETAEVLSYTTNATRENFRIVHFWADGVATYTPPGHWDAIAAEDFVKKNFSEVRWARNMALLNMAEMDAAIVCWNTKYFYFNPRPTQMDPSIKTLTGIPNFPSYISGHSTFSGAAAAILSHIIPERASAYSAMAEEAARSRLIAGIHYNKSDCGVGLQVGKNVGNYAVQRAMTDGAE

Samples

Sample ID Description Type Environment
1 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
123 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
130 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
131 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
142 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
143 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
146 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
168 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
169 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 2738541278 Niastella sp. CF465 Isolate Unclassified
173 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
174 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0
Isolates 0.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.49
Nodule 0
Rhizoplane 2.09
Rhizosphere 90.75
Stem 0
Stem Tuber 0
Unclassified 5.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157376_10021997 3300014969 Bacteria 4961
2 rootH1_10003045 3300003316 Bacteria 15908
3 rootH2_10003554 3300003320 Bacteria 26047
4 rootH2_10005472 3300003320 Bacteria 61274
5 rootH2_10037638 3300003320 Bacteria 6175
6 rootH2_10052345 3300003320 Bacteria 10683
7 rootH2_10161659 3300003320 Bacteria 6661
8 rootH2_10198931 3300003320 Bacteria 2526
9 rootL2_10000108 3300003322 Bacteria 20989
10 rootH1_10005894 3300003323 Bacteria 29566
11 rootH1_10092001 3300003323 Bacteria 14085
12 JGI25160J50197_1001307 3300003354 Bacteria 12579
13 Ga0065714_10071450 3300005288 Bacteria 3508
14 Ga0065712_10075811 3300005290 Bacteria 3784
15 Ga0070658_10001676 3300005327 Bacteria 18699
16 Ga0070658_10028950 3300005327 Bacteria 4447
17 Ga0070658_10140753 3300005327 Bacteria 2015
18 Ga0070676_10003036 3300005328 Bacteria 8673
19 Ga0070676_10004956 3300005328 Bacteria 7048
20 Ga0070676_10065967 3300005328 Bacteria 2162
21 Ga0070683_100017093 3300005329 Bacteria 6404
22 Ga0070683_100018875 3300005329 Bacteria 6118
23 Ga0070670_100021307 3300005331 Bacteria 5576
24 Ga0070670_100057459 3300005331 Bacteria 3340
25 Ga0070670_100150841 3300005331 Bacteria 2011
26 Ga0070670_100191037 3300005331 Bacteria 1779
27 Ga0068869_100011906 3300005334 Bacteria 5723
28 Ga0070666_10005211 3300005335 Bacteria 7962
29 Ga0070680_100015425 3300005336 Bacteria 5989
30 Ga0070682_100013193 3300005337 Bacteria 4749
31 Ga0068868_100000112 3300005338 Bacteria 50817
32 Ga0068868_100005340 3300005338 Bacteria 9020
33 Ga0068868_100012088 3300005338 Bacteria 6304
34 Ga0068868_100016928 3300005338 Bacteria 5423
35 Ga0068868_100033152 3300005338 Bacteria 3979
36 Ga0068868_100054131 3300005338 Bacteria 3161
37 Ga0068868_100056623 3300005338 Bacteria 3096
38 Ga0068868_100109033 3300005338 Bacteria 2248
39 Ga0070689_100021002 3300005340 Bacteria 4853
40 Ga0070689_100088918 3300005340 Bacteria 2432
41 Ga0070689_100173674 3300005340 Bacteria 1747
42 Ga0070691_10014439 3300005341 Bacteria 3624
43 Ga0070661_100004163 3300005344 Bacteria 9980
44 Ga0070661_100067146 3300005344 Bacteria 2635
45 Ga0070668_100000110 3300005347 Bacteria 50766
46 Ga0070668_100032151 3300005347 Bacteria 3993
47 Ga0070673_100000305 3300005364 Bacteria 25760
48 Ga0070673_100017141 3300005364 Bacteria 5141
49 Ga0070673_100053202 3300005364 Bacteria 3179
50 Ga0070673_100162938 3300005364 Bacteria 1898
51 Ga0070688_100031929 3300005365 Unclassified 3172
52 Ga0070659_100018351 3300005366 Bacteria 5280
53 Ga0070667_100013900 3300005367 Bacteria 6655
54 Ga0070667_100017847 3300005367 Bacteria 5881
55 Ga0070678_100015076 3300005456 Bacteria 4900
56 Ga0070662_100002360 3300005457 Bacteria 11606
57 Ga0070662_100009009 3300005457 Bacteria 6508
58 Ga0070681_10021844 3300005458 Bacteria 6419
59 Ga0070681_10052834 3300005458 Bacteria 4052
60 Ga0070679_100034065 3300005530 Bacteria 5046
61 Ga0070684_100041376 3300005535 Bacteria 3972
62 Ga0070684_100068078 3300005535 Bacteria 3129
63 Ga0068853_100001501 3300005539 Bacteria 16945
64 Ga0068853_100074364 3300005539 Bacteria 2964
65 Ga0068853_100082513 3300005539 Bacteria 2815
66 Ga0070672_100000020 3300005543 Bacteria 69277
67 Ga0070695_100006892 3300005545 Bacteria 6729
68 Ga0070693_100006246 3300005547 Bacteria 5772
69 Ga0070665_100000014 3300005548 Bacteria 484881
70 Ga0070665_100000318 3300005548 Bacteria 74326
71 Ga0070704_100167278 3300005549 Bacteria 1745
72 Ga0068855_100009960 3300005563 Bacteria 11457
73 Ga0068855_100055268 3300005563 Bacteria 4664
74 Ga0068855_100057646 3300005563 Bacteria 4552
75 Ga0068855_100075627 3300005563 Unclassified 3910
76 Ga0070664_100074706 3300005564 Bacteria 2909
77 Ga0070664_100074766 3300005564 Bacteria 2908
78 Ga0068857_100016212 3300005577 Bacteria 6527
79 Ga0068856_100137131 3300005614 Unclassified 2453
80 Ga0070702_100024037 3300005615 Bacteria 3246
81 Ga0070702_100067337 3300005615 Bacteria 2103
82 Ga0068852_100063969 3300005616 Bacteria 3205
83 Ga0068859_100203836 3300005617 Unclassified 2063
84 Ga0068864_100000392 3300005618 Bacteria 38124
85 Ga0068864_100167788 3300005618 Bacteria 2000
86 Ga0068866_10007254 3300005718 Bacteria 4637
87 Ga0068851_10006000 3300005834 Bacteria 5534
88 Ga0068863_100002244 3300005841 Bacteria 19182
89 Ga0068863_100117700 3300005841 Bacteria 2532
90 Ga0068863_100239880 3300005841 Unclassified 1750
91 Ga0068858_100000342 3300005842 Bacteria 49465
92 Ga0068858_100050491 3300005842 Bacteria 3850
93 Ga0068860_100000061 3300005843 Bacteria 192548
94 Ga0068860_100007315 3300005843 Bacteria 11039
95 Ga0068860_100007522 3300005843 Bacteria 10900
96 Ga0081540_1002830 3300005983 Bacteria 14047
97 Ga0081539_10003031 3300005985 Bacteria 21772
98 Ga0097621_100008467 3300006237 Bacteria 7411
99 Ga0097621_100046767 3300006237 Bacteria 3503
100 Ga0097621_100078795 3300006237 Bacteria 2738
101 Ga0068871_100001044 3300006358 Bacteria 18562
102 Ga0068871_100003870 3300006358 Bacteria 10323
103 Ga0068871_100010670 3300006358 Bacteria 6717
104 Ga0068871_100012571 3300006358 Bacteria 6249
105 Ga0075431_100000819 3300006847 Bacteria 27158
106 Ga0068865_100004637 3300006881 Bacteria 8300
107 Ga0097620_100203835 3300006931 Unclassified 2063
108 Ga0105240_10000190 3300009093 Bacteria 125290
109 Ga0105240_10000226 3300009093 Bacteria 112655
110 Ga0105240_10000674 3300009093 Bacteria 62689
111 Ga0105240_10000857 3300009093 Bacteria 54806
112 Ga0105240_10022499 3300009093 Bacteria 8354
113 Ga0105240_10029462 3300009093 Bacteria 7150
114 Ga0105240_10034712 3300009093 Bacteria 6503
115 Ga0105240_10047437 3300009093 Bacteria 5436
116 Ga0105240_10052823 3300009093 Bacteria 5106
117 Ga0105240_10191600 3300009093 Bacteria 2404
118 Ga0111539_10024937 3300009094 Bacteria 7331
119 Ga0105245_10041716 3300009098 Bacteria 4091
120 Ga0114129_10041509 3300009147 Bacteria 6482
121 Ga0105241_10010644 3300009174 Bacteria 6747
122 Ga0105241_10078105 3300009174 Bacteria 2586
123 Ga0105241_10108503 3300009174 Unclassified 2219
124 Ga0105242_10046548 3300009176 Bacteria 3519
125 Ga0105242_10047864 3300009176 Bacteria 3473
126 Ga0105248_10011596 3300009177 Bacteria 9709
127 Ga0105248_10087945 3300009177 Bacteria 3497
128 Ga0105237_10000229 3300009545 Bacteria 79571
129 Ga0105237_10006551 3300009545 Bacteria 12879
130 Ga0105237_10007386 3300009545 Bacteria 12034
131 Ga0105237_10009599 3300009545 Bacteria 10363
132 Ga0105237_10010656 3300009545 Bacteria 9768
133 Ga0105237_10011389 3300009545 Bacteria 9408
134 Ga0105237_10123214 3300009545 Bacteria 2586
135 Ga0105238_10011536 3300009551 Bacteria 8902
136 Ga0105239_10000019 3300010375 Bacteria 273836
137 Ga0105239_10000805 3300010375 Bacteria 44408
138 Ga0105239_10006970 3300010375 Bacteria 13020
139 Ga0105239_10153402 3300010375 Bacteria 2571
140 Ga0105246_10009499 3300011119 Bacteria 5990
141 Ga0105246_10061242 3300011119 Bacteria 2618
142 Ga0157371_10001423 3300013102 Bacteria 24864
143 Ga0157370_10078587 3300013104 Bacteria 3107
144 Ga0157369_10013285 3300013105 Bacteria 9317
145 Ga0157369_10249108 3300013105 Bacteria 1854
146 Ga0157374_10000011 3300013296 Bacteria 466749
147 Ga0157374_10001515 3300013296 Bacteria 19575
148 Ga0157374_10002159 3300013296 Bacteria 16586
149 Ga0157374_10013923 3300013296 Bacteria 7030
150 Ga0157374_10076251 3300013296 Bacteria 3170
151 Ga0157374_10090475 3300013296 Bacteria 2918
152 Ga0157378_10003130 3300013297 Bacteria 14703
153 Ga0157378_10006178 3300013297 Bacteria 10482
154 Ga0157378_10093908 3300013297 Bacteria 2731
155 Ga0163162_10000201 3300013306 Bacteria 55260
156 Ga0163162_10000544 3300013306 Bacteria 34854
157 Ga0163162_10002245 3300013306 Bacteria 18145
158 Ga0163162_10002374 3300013306 Bacteria 17700
159 Ga0163162_10003819 3300013306 Bacteria 14443
160 Ga0163162_10004331 3300013306 Bacteria 13665
161 Ga0163162_10020220 3300013306 Bacteria 6538
162 Ga0163162_10053319 3300013306 Bacteria 4064
163 Ga0163162_10117829 3300013306 Bacteria 2757
164 Ga0157372_10061998 3300013307 Bacteria 4188
165 Ga0157375_10000821 3300013308 Bacteria 27183
166 Ga0157375_10003913 3300013308 Bacteria 12917
167 Ga0157375_10040984 3300013308 Unclassified 4468
168 Ga0157375_10123214 3300013308 Bacteria 2704
169 Ga0163163_10000079 3300014325 Bacteria 106874
170 Ga0163163_10000385 3300014325 Bacteria 41966
171 Ga0163163_10000471 3300014325 Bacteria 36731
172 Ga0163163_10026967 3300014325 Bacteria 5497
173 Ga0163163_10108954 3300014325 Bacteria 2797
174 Ga0163163_10248234 3300014325 Bacteria 1830
175 Ga0157380_10055027 3300014326 Bacteria 3158
176 Ga0157379_10000115 3300014968 Bacteria 55499
177 Ga0157379_10054409 3300014968 Unclassified 3576
178 Ga0157379_10080556 3300014968 Bacteria 2917
179 Ga0157376_10001273 3300014969 Bacteria 16559
180 Ga0157376_10003237 3300014969 Bacteria 11207
181 Ga0157376_10004662 3300014969 Bacteria 9557
182 Ga0157376_10004723 3300014969 Bacteria 9491
183 Ga0157376_10013495 3300014969 Bacteria 6097
184 Ga0157376_10117025 3300014969 Bacteria 2356
185 Ga0163161_10002810 3300017792 Bacteria 12351
186 Ga0213876_10021157 3300021384 Bacteria 3439
187 Ga0207426_1000023 3300025302 Bacteria 545465
188 Ga0207688_10004663 3300025901 Bacteria 7470
189 Ga0207680_10037332 3300025903 Bacteria 2804
190 Ga0207645_10002811 3300025907 Bacteria 13515
191 Ga0207645_10008058 3300025907 Bacteria 7391
192 Ga0207645_10065416 3300025907 Bacteria 2324
193 Ga0207705_10003949 3300025909 Bacteria 11276
194 Ga0207707_10012790 3300025912 Bacteria 7301
195 Ga0207707_10038837 3300025912 Bacteria 4161
196 Ga0207707_10050314 3300025912 Bacteria 3630
197 Ga0207695_10000263 3300025913 Bacteria 132894
198 Ga0207695_10000276 3300025913 Bacteria 128924
199 Ga0207695_10000313 3300025913 Bacteria 117072
200 Ga0207695_10001456 3300025913 Bacteria 39626
201 Ga0207695_10046685 3300025913 Bacteria 4589
202 Ga0207695_10086468 3300025913 Bacteria 3162
203 Ga0207671_10001496 3300025914 Bacteria 26941
204 Ga0207671_10001671 3300025914 Bacteria 25207
205 Ga0207671_10008980 3300025914 Bacteria 8409
206 Ga0207671_10020629 3300025914 Bacteria 5012
207 Ga0207671_10032247 3300025914 Bacteria 3900
208 Ga0207660_10013389 3300025917 Bacteria 5377
209 Ga0207649_10028306 3300025920 Bacteria 3298
210 Ga0207652_10019385 3300025921 Bacteria 5594
211 Ga0207650_10037517 3300025925 Bacteria 3532
212 Ga0207650_10051160 3300025925 Bacteria 3056
213 Ga0207650_10110464 3300025925 Bacteria 2127
214 Ga0207659_10034399 3300025926 Bacteria 3494
215 Ga0207687_10099335 3300025927 Bacteria 2138
216 Ga0207687_10122731 3300025927 Bacteria 1945
217 Ga0207644_10039689 3300025931 Bacteria 3324
218 Ga0207690_10011967 3300025932 Bacteria 5188
219 Ga0207706_10006655 3300025933 Bacteria 10684
220 Ga0207706_10008325 3300025933 Bacteria 9564
221 Ga0207706_10023655 3300025933 Bacteria 5516
222 Ga0207706_10088837 3300025933 Bacteria 2716
223 Ga0207670_10065311 3300025936 Bacteria 2497
224 Ga0207704_10006041 3300025938 Bacteria 5614
225 Ga0207691_10000322 3300025940 Bacteria 47690
226 Ga0207691_10029649 3300025940 Bacteria 5118
227 Ga0207691_10035693 3300025940 Bacteria 4612
228 Ga0207691_10116307 3300025940 Bacteria 2373
229 Ga0207689_10002462 3300025942 Bacteria 17250
230 Ga0207689_10011340 3300025942 Bacteria 7645
231 Ga0207689_10034446 3300025942 Bacteria 4206
232 Ga0207689_10046262 3300025942 Bacteria 3596
233 Ga0207661_10015706 3300025944 Bacteria 5578
234 Ga0207661_10019577 3300025944 Bacteria 5049
235 Ga0207661_10023505 3300025944 Bacteria 4659
236 Ga0207679_10014932 3300025945 Bacteria 5117
237 Ga0207667_10015421 3300025949 Bacteria 8682
238 Ga0207667_10020584 3300025949 Bacteria 7331
239 Ga0207667_10098267 3300025949 Unclassified 3021
240 Ga0207651_10031471 3300025960 Bacteria 3392
241 Ga0207651_10042678 3300025960 Unclassified 3021
242 Ga0207668_10000475 3300025972 Bacteria 25151
243 Ga0207640_10160666 3300025981 Bacteria 1662
244 Ga0207658_10002779 3300025986 Bacteria 12608
245 Ga0207658_10031171 3300025986 Bacteria 3784
246 Ga0207677_10012452 3300026023 Bacteria 4890
247 Ga0207677_10014980 3300026023 Bacteria 4545
248 Ga0207703_10000814 3300026035 Bacteria 30775
249 Ga0207703_10068866 3300026035 Unclassified 2917
250 Ga0207703_10129223 3300026035 Bacteria 2179
251 Ga0207639_10023187 3300026041 Bacteria 4480
252 Ga0207639_10033952 3300026041 Bacteria 3767
253 Ga0207702_10176862 3300026078 Bacteria 1962
254 Ga0207641_10014583 3300026088 Bacteria 6443
255 Ga0207641_10216601 3300026088 Unclassified 1773
256 Ga0207648_10005953 3300026089 Bacteria 12201
257 Ga0207648_10006750 3300026089 Bacteria 11382
258 Ga0207648_10067876 3300026089 Bacteria 3108
259 Ga0207676_10004453 3300026095 Bacteria 9907
260 Ga0207674_10018555 3300026116 Bacteria 7557
261 Ga0207674_10025263 3300026116 Bacteria 6339
262 Ga0207674_10041367 3300026116 Bacteria 4767
263 Ga0207675_100038840 3300026118 Bacteria 4442
264 Ga0207675_100128128 3300026118 Bacteria 2405
265 Ga0207683_10016479 3300026121 Bacteria 6290
266 Ga0207698_10031730 3300026142 Bacteria 3818
267 Ga0207698_10048600 3300026142 Bacteria 3222
268 Ga0268266_10000068 3300028379 Bacteria 241100
269 Ga0268266_10014466 3300028379 Bacteria 6783
270 Ga0268266_10083891 3300028379 Bacteria 2782
271 Ga0268264_10000079 3300028381 Bacteria 249516
272 Ga0268264_10001681 3300028381 Bacteria 20386
273 Ga0268264_10008652 3300028381 Bacteria 8457
274 Ga0307517_10007634 3300028786 Bacteria 15724
275 Ga0307511_10000554 3300030521 Bacteria 40123
276 Ga0265313_10022287 3300031595 Bacteria 3440
277 Ga0307413_10017390 3300031824 Bacteria 3743
278 Ga0307510_10000152 3300033180 Bacteria 57328
279 Ga0307510_10143041 3300033180 Bacteria 2031
280 Ga0373937_0062037 3300036401 Bacteria 3436
281 Ga0436365_0198288 3300039437 Bacteria 8842
282 Ga0439436_0007386 3300041404 Bacteria 3382
283 Ga0439449_0008527 3300042007 Bacteria 3894
284 Ga0439462_0001130 3300042015 Bacteria 5793
285 Ga0451577_0158525 3300042876 Bacteria 2037
286 Ga0466972_0000123 3300044658 Bacteria 65577
287 Ga0466972_0003081 3300044658 Bacteria 8260
288 Ga0466972_0013598 3300044658 Bacteria 4084
289 Ga0453684_0000525 3300044712 Bacteria 146588
290 Ga0453684_0036571 3300044712 Bacteria 6765
291 Ga0466957_0000689 3300044842 Bacteria 17232
292 Ga0466957_0001397 3300044842 Bacteria 12589
293 Ga0466959_0012351 3300045049 Bacteria 6169
294 Ga0495638_0025451 3300046460 Unclassified 3847
295 Ga0495582_0069384 3300046473 Unclassified 1949
296 Ga0495585_0000470 3300046492 Bacteria 38600
297 Ga0495606_0003860 3300046507 Bacteria 15473
298 Ga0495644_0016557 3300046523 Bacteria 2821
299 Ga0495648_0006383 3300046524 Bacteria 9637
300 Ga0495611_0000026 3300046648 Bacteria 118428
301 Ga0495611_0022963 3300046648 Unclassified 2702
302 Ga0495674_0035591 3300047319 Bacteria 4490
303 Ga0495672_0027825 3300047320 Bacteria 3587
304 Ga0495672_0040154 3300047320 Bacteria 2840
305 Ga0495687_000564 3300047443 Bacteria 43681
306 Ga0495686_0000005 3300047472 Bacteria 827143
307 Ga0495686_0062098 3300047472 Bacteria 2318
308 Ga0496108_0022555 3300048911 Bacteria 5177
309 Ga0496110_0125700 3300048913 Unclassified 2313
310 Ga0496112_0279363 3300048915 Bacteria 1617
311 Ga0496113_0069369 3300048916 Bacteria 2677
312 Ga0496114_0001786 3300048917 Bacteria 16330
313 Ga0496115_0027952 3300048918 Bacteria 4416
314 Ga0496115_0041511 3300048918 Bacteria 3662
315 Ga0501031_0021070 3300049568 Bacteria 4251
316 Ga0501032_0161559 3300049569 Bacteria 1471
317 Ga0501037_0040234 3300049573 Bacteria 3440
318 Ga0501038_0026641 3300049574 Bacteria 5147
319 Ga0501047_0023363 3300049581 Bacteria 5937
320 Ga0501070_0064759 3300049586 Bacteria 3026
321 Ga0501071_0012209 3300049587 Bacteria 5817
322 Ga0501072_0111167 3300049588 Bacteria 2181
323 Ga0501073_0015960 3300049589 Bacteria 5443
324 Ga0501079_0018839 3300049741 Bacteria 5275
325 Ga0501035_0060125 3300049822 Bacteria 3383
326 Ga0501044_0019255 3300049823 Bacteria 7306
327 nmdc:mga06r32_24246_c1 3300050510 Bacteria 5627
328 Ga0500578_0000060 3300053086 Bacteria 118274
329 Ga0500641_0000014 3300053096 Bacteria 150696
330 Ga0500622_0000398 3300053156 Bacteria 41643
331 Ga0501084_0005663 3300054114 Bacteria 10256
332 Ga0501082_0203508 3300060353 Bacteria 1722
333 2738725704 2738541278 Bacteria 9755573
334 2929926468 2929921140 Bacteria 8649150
335 8003156803 8003151029 Bacteria 8187759
336 Ga0157376_10021997
337 rootH1_10003045
338 rootH2_10003554
339 rootH2_10005472
340 rootH2_10037638
341 rootH2_10052345
342 rootH2_10161659
343 rootH2_10198931
344 rootL2_10000108
345 rootH1_10005894
346 rootH1_10092001
347 JGI25160J50197_1001307
348 Ga0065714_10071450
349 Ga0065712_10075811
350 Ga0070658_10001676
351 Ga0070658_10028950
352 Ga0070658_10140753
353 Ga0070676_10003036
354 Ga0070676_10004956
355 Ga0070676_10065967
356 Ga0070683_100017093
357 Ga0070683_100018875
358 Ga0070670_100021307
359 Ga0070670_100057459
360 Ga0070670_100150841
361 Ga0070670_100191037
362 Ga0068869_100011906
363 Ga0070666_10005211
364 Ga0070680_100015425
365 Ga0070682_100013193
366 Ga0068868_100000112
367 Ga0068868_100005340
368 Ga0068868_100012088
369 Ga0068868_100016928
370 Ga0068868_100033152
371 Ga0068868_100054131
372 Ga0068868_100056623
373 Ga0068868_100109033
374 Ga0070689_100021002
375 Ga0070689_100088918
376 Ga0070689_100173674
377 Ga0070691_10014439
378 Ga0070661_100004163
379 Ga0070661_100067146
380 Ga0070668_100000110
381 Ga0070668_100032151
382 Ga0070673_100000305
383 Ga0070673_100017141
384 Ga0070673_100053202
385 Ga0070673_100162938
386 Ga0070688_100031929
387 Ga0070659_100018351
388 Ga0070667_100013900
389 Ga0070667_100017847
390 Ga0070678_100015076
391 Ga0070662_100002360
392 Ga0070662_100009009
393 Ga0070681_10021844
394 Ga0070681_10052834
395 Ga0070679_100034065
396 Ga0070684_100041376
397 Ga0070684_100068078
398 Ga0068853_100001501
399 Ga0068853_100074364
400 Ga0068853_100082513
401 Ga0070672_100000020
402 Ga0070695_100006892
403 Ga0070693_100006246
404 Ga0070665_100000014
405 Ga0070665_100000318
406 Ga0070704_100167278
407 Ga0068855_100009960
408 Ga0068855_100055268
409 Ga0068855_100057646
410 Ga0068855_100075627
411 Ga0070664_100074706
412 Ga0070664_100074766
413 Ga0068857_100016212
414 Ga0068856_100137131
415 Ga0070702_100024037
416 Ga0070702_100067337
417 Ga0068852_100063969
418 Ga0068859_100203836
419 Ga0068864_100000392
420 Ga0068864_100167788
421 Ga0068866_10007254
422 Ga0068851_10006000
423 Ga0068863_100002244
424 Ga0068863_100117700
425 Ga0068863_100239880
426 Ga0068858_100000342
427 Ga0068858_100050491
428 Ga0068860_100000061
429 Ga0068860_100007315
430 Ga0068860_100007522
431 Ga0081540_1002830
432 Ga0081539_10003031
433 Ga0097621_100008467
434 Ga0097621_100046767
435 Ga0097621_100078795
436 Ga0068871_100001044
437 Ga0068871_100003870
438 Ga0068871_100010670
439 Ga0068871_100012571
440 Ga0075431_100000819
441 Ga0068865_100004637
442 Ga0097620_100203835
443 Ga0105240_10000190
444 Ga0105240_10000226
445 Ga0105240_10000674
446 Ga0105240_10000857
447 Ga0105240_10022499
448 Ga0105240_10029462
449 Ga0105240_10034712
450 Ga0105240_10047437
451 Ga0105240_10052823
452 Ga0105240_10191600
453 Ga0111539_10024937
454 Ga0105245_10041716
455 Ga0114129_10041509
456 Ga0105241_10010644
457 Ga0105241_10078105
458 Ga0105241_10108503
459 Ga0105242_10046548
460 Ga0105242_10047864
461 Ga0105248_10011596
462 Ga0105248_10087945
463 Ga0105237_10000229
464 Ga0105237_10006551
465 Ga0105237_10007386
466 Ga0105237_10009599
467 Ga0105237_10010656
468 Ga0105237_10011389
469 Ga0105237_10123214
470 Ga0105238_10011536
471 Ga0105239_10000019
472 Ga0105239_10000805
473 Ga0105239_10006970
474 Ga0105239_10153402
475 Ga0105246_10009499
476 Ga0105246_10061242
477 Ga0157371_10001423
478 Ga0157370_10078587
479 Ga0157369_10013285
480 Ga0157369_10249108
481 Ga0157374_10000011
482 Ga0157374_10001515
483 Ga0157374_10002159
484 Ga0157374_10013923
485 Ga0157374_10076251
486 Ga0157374_10090475
487 Ga0157378_10003130
488 Ga0157378_10006178
489 Ga0157378_10093908
490 Ga0163162_10000201
491 Ga0163162_10000544
492 Ga0163162_10002245
493 Ga0163162_10002374
494 Ga0163162_10003819
495 Ga0163162_10004331
496 Ga0163162_10020220
497 Ga0163162_10053319
498 Ga0163162_10117829
499 Ga0157372_10061998
500 Ga0157375_10000821
501 Ga0157375_10003913
502 Ga0157375_10040984
503 Ga0157375_10123214
504 Ga0163163_10000079
505 Ga0163163_10000385
506 Ga0163163_10000471
507 Ga0163163_10026967
508 Ga0163163_10108954
509 Ga0163163_10248234
510 Ga0157380_10055027
511 Ga0157379_10000115
512 Ga0157379_10054409
513 Ga0157379_10080556
514 Ga0157376_10001273
515 Ga0157376_10003237
516 Ga0157376_10004662
517 Ga0157376_10004723
518 Ga0157376_10013495
519 Ga0157376_10117025
520 Ga0163161_10002810
521 Ga0213876_10021157
522 Ga0207426_1000023
523 Ga0207688_10004663
524 Ga0207680_10037332
525 Ga0207645_10002811
526 Ga0207645_10008058
527 Ga0207645_10065416
528 Ga0207705_10003949
529 Ga0207707_10012790
530 Ga0207707_10038837
531 Ga0207707_10050314
532 Ga0207695_10000263
533 Ga0207695_10000276
534 Ga0207695_10000313
535 Ga0207695_10001456
536 Ga0207695_10046685
537 Ga0207695_10086468
538 Ga0207671_10001496
539 Ga0207671_10001671
540 Ga0207671_10008980
541 Ga0207671_10020629
542 Ga0207671_10032247
543 Ga0207660_10013389
544 Ga0207649_10028306
545 Ga0207652_10019385
546 Ga0207650_10037517
547 Ga0207650_10051160
548 Ga0207650_10110464
549 Ga0207659_10034399
550 Ga0207687_10099335
551 Ga0207687_10122731
552 Ga0207644_10039689
553 Ga0207690_10011967
554 Ga0207706_10006655
555 Ga0207706_10008325
556 Ga0207706_10023655
557 Ga0207706_10088837
558 Ga0207670_10065311
559 Ga0207704_10006041
560 Ga0207691_10000322
561 Ga0207691_10029649
562 Ga0207691_10035693
563 Ga0207691_10116307
564 Ga0207689_10002462
565 Ga0207689_10011340
566 Ga0207689_10034446
567 Ga0207689_10046262
568 Ga0207661_10015706
569 Ga0207661_10019577
570 Ga0207661_10023505
571 Ga0207679_10014932
572 Ga0207667_10015421
573 Ga0207667_10020584
574 Ga0207667_10098267
575 Ga0207651_10031471
576 Ga0207651_10042678
577 Ga0207668_10000475
578 Ga0207640_10160666
579 Ga0207658_10002779
580 Ga0207658_10031171
581 Ga0207677_10012452
582 Ga0207677_10014980
583 Ga0207703_10000814
584 Ga0207703_10068866
585 Ga0207703_10129223
586 Ga0207639_10023187
587 Ga0207639_10033952
588 Ga0207702_10176862
589 Ga0207641_10014583
590 Ga0207641_10216601
591 Ga0207648_10005953
592 Ga0207648_10006750
593 Ga0207648_10067876
594 Ga0207676_10004453
595 Ga0207674_10018555
596 Ga0207674_10025263
597 Ga0207674_10041367
598 Ga0207675_100038840
599 Ga0207675_100128128
600 Ga0207683_10016479
601 Ga0207698_10031730
602 Ga0207698_10048600
603 Ga0268266_10000068
604 Ga0268266_10014466
605 Ga0268266_10083891
606 Ga0268264_10000079
607 Ga0268264_10001681
608 Ga0268264_10008652
609 Ga0307517_10007634
610 Ga0307511_10000554
611 Ga0265313_10022287
612 Ga0307413_10017390
613 Ga0307510_10000152
614 Ga0307510_10143041
615 Ga0373937_0062037
616 Ga0436365_0198288
617 Ga0439436_0007386
618 Ga0439449_0008527
619 Ga0439462_0001130
620 Ga0451577_0158525
621 Ga0466972_0000123
622 Ga0466972_0003081
623 Ga0466972_0013598
624 Ga0453684_0000525
625 Ga0453684_0036571
626 Ga0466957_0000689
627 Ga0466957_0001397
628 Ga0466959_0012351
629 Ga0495638_0025451
630 Ga0495582_0069384
631 Ga0495585_0000470
632 Ga0495606_0003860
633 Ga0495644_0016557
634 Ga0495648_0006383
635 Ga0495611_0000026
636 Ga0495611_0022963
637 Ga0495674_0035591
638 Ga0495672_0027825
639 Ga0495672_0040154
640 Ga0495687_000564
641 Ga0495686_0000005
642 Ga0495686_0062098
643 Ga0496108_0022555
644 Ga0496110_0125700
645 Ga0496112_0279363
646 Ga0496113_0069369
647 Ga0496114_0001786
648 Ga0496115_0027952
649 Ga0496115_0041511
650 Ga0501031_0021070
651 Ga0501032_0161559
652 Ga0501037_0040234
653 Ga0501038_0026641
654 Ga0501047_0023363
655 Ga0501070_0064759
656 Ga0501071_0012209
657 Ga0501072_0111167
658 Ga0501073_0015960
659 Ga0501079_0018839
660 Ga0501035_0060125
661 Ga0501044_0019255
662 nmdc:mga06r32_24246_c1
663 Ga0500578_0000060
664 Ga0500641_0000014
665 Ga0500622_0000398
666 Ga0501084_0005663
667 Ga0501082_0203508
668 2738725704
669 2929926468
670 8003156803

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01569

PAP2

PAP2 superfamily

425

538

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qi9-assembly1.cif.gz_B x-ray siras structure determination of a vanadium-dependent haloperoxidase from ascophyllum nodosum at 2.0 a resolution 0.8257 385 500
7f18-assembly3.cif.gz_C crystal structure of a mutant of acid phosphatase from pseudomonas aeruginosa (q57h/w58p/d135r) 0.8194 315 503
1qi9-assembly1.cif.gz_A x-ray siras structure determination of a vanadium-dependent haloperoxidase from ascophyllum nodosum at 2.0 a resolution 0.8135 385 500
6ebu-assembly1.cif.gz_A crystal structure of aquifex aeolicus lpxe 0.7971 331 498
7f18-assembly2.cif.gz_B crystal structure of a mutant of acid phosphatase from pseudomonas aeruginosa (q57h/w58p/d135r) 0.7918 315 505
ID Description Score Start End Superfamily
af_Q54FF5_166_492_1.10.606.10 Mainly Alpha;Orthogonal Bundle;Vanadium-containing Chloroperoxidase; domain 2;Vanadium-containing Chloroperoxidase, domain 2 0.8694 282 499 1.10.606.10
1qi9B00 Mainly Alpha;Orthogonal Bundle;Vanadium-containing Chloroperoxidase; domain 2;Vanadium-containing Chloroperoxidase, domain 2 0.8086 385 500 1.10.606.10
af_A0A2R8Q2K8_118_304_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.7917 384 502 1.20.144.10
af_A4HXR9_231_397_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.7916 384 498 1.20.144.10
5aa6C00 Mainly Alpha;Orthogonal Bundle;Vanadium-containing Chloroperoxidase; domain 2;Vanadium-containing Chloroperoxidase, domain 2 0.781 387 499 1.10.606.10
ID Description Score Start End GO Terms
AF-A0A3C1T4N8-F1-model_v4 PA-phosphatase 0.9918 386 506
AF-A0A3C0IUE9-F1-model_v4 PA-phosphatase 0.9907 242 506
AF-A0A7J5WNZ0-F1-model_v4 Phosphoesterase PA-phosphatase-like 0.9889 202 506
AF-A0A2T6BSJ8-F1-model_v4 PAP2 superfamily protein 0.9885 367 502
AF-A0A7J5WNZ0-F1-model_v4 Phosphoesterase PA-phosphatase-like 0.9825 202 506

Map