F412261

General Info

Members Datasets Scaffolds Average Seq Length
335 234 335 141

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10050024|Ga0207684_100500243
Length 166
Sequence LISERLKESIAMTRSIEDPSTHLDRLNIRPFQTDDLNDVIHLWRSCNLSRPWNDPSKDIAPKLRVNPEWFLVAALGKEIVGSIMIGYEGHRGWINYLAVAAPFRCRGIATQLMREAEAILRPIGCPKINLLVRVGNEQDLSRFYAGLGYRLDEVVCYGKRLEVDDP

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
126 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
129 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
134 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
135 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
136 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
137 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
138 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
139 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
149 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
150 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
151 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
154 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
155 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
156 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
157 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
158 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
161 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
162 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
163 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
164 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
165 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
166 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
167 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
168 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
169 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
170 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
171 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
174 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
175 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
176 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
192 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
209 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
210 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
211 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
219 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
228 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
229 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
230 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.67
Nodule 0
Rhizoplane 3.58
Rhizosphere 81.49
Stem 0
Stem Tuber 0
Unclassified 9.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10272620 3300003320 Bacteria 1884
2 rootL2_10124499 3300003322 Bacteria 2514
3 rootL2_10128333 3300003322 Bacteria 3311
4 rootH1_10032282 3300003323 Bacteria 2726
5 rootH1_10137612 3300003323 Bacteria 6076
6 rootH1_10162552 3300003323 Bacteria 2805
7 Ga0070658_10995674 3300005327 Bacteria 729
8 Ga0070683_101721398 3300005329 Bacteria 603
9 Ga0070680_100013642 3300005336 Bacteria 6334
10 Ga0070680_100297415 3300005336 Bacteria 1368
11 Ga0070682_100759567 3300005337 Bacteria 784
12 Ga0068868_100212750 3300005338 Bacteria 1616
13 Ga0070689_101117360 3300005340 Bacteria 705
14 Ga0070691_10083262 3300005341 Bacteria 1569
15 Ga0070691_10083319 3300005341 Bacteria 1569
16 Ga0070687_100146564 3300005343 Bacteria 1381
17 Ga0070687_100573637 3300005343 Bacteria 771
18 Ga0070692_10029341 3300005345 Bacteria 2741
19 Ga0070692_10104646 3300005345 Bacteria 1556
20 Ga0070668_100049276 3300005347 Bacteria 3241
21 Ga0070669_100009102 3300005353 Bacteria 7078
22 Ga0070675_100803136 3300005354 Bacteria 860
23 Ga0070674_100480853 3300005356 Bacteria 1031
24 Ga0070688_100092147 3300005365 Bacteria 1982
25 Ga0070659_100339117 3300005366 Bacteria 1259
26 Ga0070709_10237994 3300005434 Bacteria 1306
27 Ga0070713_100233425 3300005436 Archaea 1673
28 Ga0070713_100570109 3300005436 Bacteria 1073
29 Ga0070701_10022630 3300005438 Bacteria 3014
30 Ga0070711_100170317 3300005439 Bacteria 1659
31 Ga0070705_100039804 3300005440 Bacteria 2670
32 Ga0070705_101212993 3300005440 Bacteria 622
33 Ga0070700_100000252 3300005441 Bacteria 28792
34 Ga0070700_100178296 3300005441 Bacteria 1476
35 Ga0070700_100315145 3300005441 Bacteria 1147
36 Ga0070694_100058659 3300005444 Bacteria 2619
37 Ga0070708_100219277 3300005445 Bacteria 1784
38 Ga0070678_100392362 3300005456 Bacteria 1204
39 Ga0068867_100011737 3300005459 Bacteria 6187
40 Ga0068867_100363452 3300005459 Bacteria 1211
41 Ga0068867_100540596 3300005459 Bacteria 1008
42 Ga0068867_102382231 3300005459 Unclassified 504
43 Ga0070706_100598589 3300005467 Bacteria 1024
44 Ga0070707_100085645 3300005468 Bacteria 3046
45 Ga0070707_100636420 3300005468 Bacteria 1029
46 Ga0070707_100643037 3300005468 Bacteria 1023
47 Ga0070698_100098580 3300005471 Bacteria 2896
48 Ga0070698_100134851 3300005471 Bacteria 2423
49 Ga0070699_100082037 3300005518 Bacteria 2810
50 Ga0070679_100028593 3300005530 Bacteria 5497
51 Ga0070697_100019608 3300005536 Bacteria 5342
52 Ga0068853_100627377 3300005539 Bacteria 1022
53 Ga0070672_100162001 3300005543 Bacteria 1856
54 Ga0070686_100396010 3300005544 Bacteria 1049
55 Ga0070695_100046297 3300005545 Bacteria 2775
56 Ga0070696_100155095 3300005546 Bacteria 1683
57 Ga0070696_100530921 3300005546 Bacteria 940
58 Ga0070696_100603219 3300005546 Bacteria 885
59 Ga0070665_100422276 3300005548 Bacteria 1342
60 Ga0070704_100056666 3300005549 Bacteria 2783
61 Ga0070704_100907513 3300005549 Bacteria 793
62 Ga0070704_102013088 3300005549 Bacteria 536
63 Ga0068855_100000100 3300005563 Bacteria 105681
64 Ga0068854_100590136 3300005578 Bacteria 947
65 Ga0068856_100280225 3300005614 Bacteria 1684
66 Ga0068859_100095304 3300005617 Bacteria 3029
67 Ga0068859_101720715 3300005617 Bacteria 693
68 Ga0068866_10057716 3300005718 Bacteria 2001
69 Ga0068861_100024622 3300005719 Bacteria 4355
70 Ga0068861_101079987 3300005719 Bacteria 770
71 Ga0068870_10108040 3300005840 Bacteria 1584
72 Ga0068863_100026485 3300005841 Bacteria 5531
73 Ga0068863_100411739 3300005841 Bacteria 1323
74 Ga0068858_100025183 3300005842 Bacteria 5537
75 Ga0068858_101647645 3300005842 Bacteria 633
76 Ga0068860_100799588 3300005843 Bacteria 956
77 Ga0068862_100413352 3300005844 Bacteria 1264
78 Ga0068862_100577294 3300005844 Bacteria 1077
79 Ga0068862_101703759 3300005844 Unclassified 639
80 Ga0070717_10000044 3300006028 Bacteria 108873
81 Ga0070717_10067079 3300006028 Bacteria 2985
82 Ga0070717_10147228 3300006028 Unclassified 2035
83 Ga0070717_10213596 3300006028 Bacteria 1694
84 Ga0075364_10012629 3300006051 Bacteria 5173
85 Ga0075364_10688573 3300006051 Bacteria 698
86 Ga0070716_100118544 3300006173 Bacteria 1653
87 Ga0070716_100249422 3300006173 Unclassified 1208
88 Ga0075362_10442285 3300006177 Bacteria 660
89 Ga0075367_11092809 3300006178 Bacteria 510
90 Ga0097621_100377464 3300006237 Bacteria 1266
91 Ga0075370_10018416 3300006353 Bacteria 3789
92 Ga0075428_100183208 3300006844 Unclassified 2266
93 Ga0075428_100292330 3300006844 Bacteria 1752
94 Ga0075428_101307904 3300006844 Unclassified 762
95 Ga0075430_100001623 3300006846 Bacteria 18369
96 Ga0075430_100612346 3300006846 Bacteria 898
97 Ga0075430_100887678 3300006846 Bacteria 734
98 Ga0075431_100088062 3300006847 Unclassified 3204
99 Ga0075431_100345950 3300006847 Bacteria 1496
100 Ga0075431_100515545 3300006847 Bacteria 1185
101 Ga0075429_100101632 3300006880 Bacteria 2510
102 Ga0075429_100227420 3300006880 Bacteria 1634
103 Ga0075429_100394690 3300006880 Bacteria 1211
104 Ga0068865_100528690 3300006881 Bacteria 987
105 Ga0097620_100095300 3300006931 Bacteria 3029
106 Ga0097620_101720596 3300006931 Bacteria 693
107 Ga0105240_10059976 3300009093 Unclassified 4745
108 Ga0111539_10334908 3300009094 Bacteria 1762
109 Ga0111539_10793341 3300009094 Bacteria 1102
110 Ga0105247_10081752 3300009101 Unclassified 2037
111 Ga0114129_10435981 3300009147 Bacteria 1721
112 Ga0105243_10418425 3300009148 Bacteria 1249
113 Ga0105242_10358736 3300009176 Bacteria 1348
114 Ga0105242_10957422 3300009176 Bacteria 860
115 Ga0105248_12293319 3300009177 Unclassified 615
116 Ga0105249_10004037 3300009553 Bacteria 12663
117 Ga0105239_13377629 3300010375 Bacteria 519
118 Ga0157371_10019938 3300013102 Bacteria 4939
119 Ga0157370_10073248 3300013104 Bacteria 3231
120 Ga0157370_11120575 3300013104 Unclassified 711
121 Ga0157369_10014643 3300013105 Bacteria 8848
122 Ga0157374_10000167 3300013296 Bacteria 60959
123 Ga0163162_10050066 3300013306 Unclassified 4189
124 Ga0157375_11447496 3300013308 Bacteria 810
125 Ga0163163_10514893 3300014325 Unclassified 1259
126 Ga0163163_11071782 3300014325 Bacteria 869
127 Ga0157380_10028131 3300014326 Bacteria 4283
128 Ga0157380_12211994 3300014326 Bacteria 614
129 Ga0157377_10013837 3300014745 Bacteria 4091
130 Ga0157377_11066528 3300014745 Bacteria 617
131 Ga0157379_11008095 3300014968 Bacteria 794
132 Ga0157379_11373432 3300014968 Unclassified 684
133 Ga0157379_11479572 3300014968 Bacteria 660
134 Ga0157379_12485401 3300014968 Bacteria 518
135 Ga0209050_1002319 3300025298 Bacteria 16743
136 Ga0207710_10217113 3300025900 Unclassified 948
137 Ga0207688_10647799 3300025901 Bacteria 667
138 Ga0207645_10542784 3300025907 Bacteria 788
139 Ga0207643_10044756 3300025908 Bacteria 2499
140 Ga0207684_10000420 3300025910 Bacteria 56576
141 Ga0207684_10050024 3300025910 Bacteria 3545
142 Ga0207684_10113671 3300025910 Bacteria 2318
143 Ga0207663_10203893 3300025916 Bacteria 1429
144 Ga0207660_10166013 3300025917 Bacteria 1706
145 Ga0207660_10590233 3300025917 Bacteria 904
146 Ga0207660_11208155 3300025917 Bacteria 615
147 Ga0207662_10489438 3300025918 Bacteria 846
148 Ga0207652_10009688 3300025921 Bacteria 7751
149 Ga0207646_10035264 3300025922 Bacteria 4519
150 Ga0207646_10506009 3300025922 Bacteria 1088
151 Ga0207681_10006509 3300025923 Bacteria 7170
152 Ga0207659_10012430 3300025926 Bacteria 5418
153 Ga0207659_10431669 3300025926 Bacteria 1107
154 Ga0207644_10643463 3300025931 Bacteria 882
155 Ga0207706_10153017 3300025933 Bacteria 2029
156 Ga0207686_10497646 3300025934 Bacteria 945
157 Ga0207709_10082418 3300025935 Bacteria 2077
158 Ga0207669_10051709 3300025937 Bacteria 2463
159 Ga0207704_10003240 3300025938 Bacteria 7376
160 Ga0207704_10615177 3300025938 Bacteria 891
161 Ga0207665_10347729 3300025939 Unclassified 1119
162 Ga0207691_10346181 3300025940 Bacteria 1272
163 Ga0207711_10803628 3300025941 Bacteria 876
164 Ga0207689_10165951 3300025942 Bacteria 1819
165 Ga0207679_11082209 3300025945 Bacteria 735
166 Ga0207667_10000207 3300025949 Bacteria 83420
167 Ga0207651_11327253 3300025960 Bacteria 647
168 Ga0207712_10052122 3300025961 Bacteria 2865
169 Ga0207668_10030494 3300025972 Bacteria 3544
170 Ga0207640_10330989 3300025981 Bacteria 1216
171 Ga0207658_10623114 3300025986 Bacteria 971
172 Ga0207703_10009199 3300026035 Bacteria 7769
173 Ga0207708_10002812 3300026075 Bacteria 12788
174 Ga0207708_10091818 3300026075 Bacteria 2342
175 Ga0207708_10196747 3300026075 Bacteria 1607
176 Ga0207708_10494101 3300026075 Bacteria 1025
177 Ga0207702_10535584 3300026078 Bacteria 1144
178 Ga0207641_10016664 3300026088 Bacteria 6016
179 Ga0207641_10554218 3300026088 Bacteria 1121
180 Ga0207648_10001474 3300026089 Bacteria 25915
181 Ga0207675_100014209 3300026118 Bacteria 7424
182 Ga0207675_100237924 3300026118 Bacteria 1759
183 Ga0207675_100870168 3300026118 Bacteria 917
184 Ga0207683_10264169 3300026121 Bacteria 1572
185 Ga0207428_10173907 3300027907 Bacteria 1630
186 Ga0268266_10844934 3300028379 Bacteria 885
187 Ga0268265_10246174 3300028380 Bacteria 1580
188 Ga0268265_10659848 3300028380 Bacteria 1006
189 Ga0265319_1036616 3300028563 Bacteria 1677
190 Ga0265323_10005358 3300028653 Bacteria 5452
191 Ga0265323_10011857 3300028653 Bacteria 3506
192 Ga0265323_10138760 3300028653 Bacteria 783
193 Ga0307515_10003154 3300028794 Bacteria 34882
194 Ga0307512_10247127 3300030522 Bacteria 894
195 Ga0265320_10010658 3300031240 Bacteria 5455
196 Ga0265327_10001560 3300031251 Bacteria 28128
197 Ga0265327_10004661 3300031251 Bacteria 12024
198 Ga0265327_10017105 3300031251 Bacteria 4566
199 Ga0265316_10023413 3300031344 Bacteria 5188
200 Ga0265316_10033317 3300031344 Bacteria 4196
201 Ga0307509_10627922 3300031507 Bacteria 745
202 Ga0307508_10136831 3300031616 Bacteria 2053
203 Ga0316575_10141074 3300031665 Bacteria 992
204 Ga0316579_10140358 3300031691 Bacteria 1165
205 Ga0265342_10393816 3300031712 Bacteria 716
206 Ga0316576_10012165 3300031727 Bacteria 5675
207 Ga0316578_10055997 3300031728 Bacteria 2315
208 Ga0316578_10851175 3300031728 Unclassified 527
209 Ga0307516_10007808 3300031730 Bacteria 12209
210 Ga0307410_10016034 3300031852 Unclassified 4457
211 Ga0307410_10614217 3300031852 Bacteria 908
212 Ga0307406_10183686 3300031901 Bacteria 1525
213 Ga0307407_10234635 3300031903 Bacteria 1248
214 Ga0307412_10748020 3300031911 Bacteria 844
215 Ga0307416_100167900 3300032002 Bacteria 2038
216 Ga0307416_100401502 3300032002 Bacteria 1408
217 Ga0307414_10082560 3300032004 Bacteria 2357
218 Ga0307411_10106950 3300032005 Bacteria 1992
219 Ga0307415_101795703 3300032126 Bacteria 593
220 Ga0373932_0185668 3300035112 Bacteria 732
221 Ga0373945_0363557 3300035116 Bacteria 629
222 Ga0316582_0045812 3300036647 Bacteria 2755
223 Ga0316582_0320900 3300036647 Bacteria 1065
224 Ga0316584_0133986 3300036712 Bacteria 1850
225 Ga0316584_0143197 3300036712 Bacteria 1782
226 Ga0316584_0247257 3300036712 Bacteria 1304
227 Ga0316584_0250853 3300036712 Bacteria 1293
228 Ga0395905_0060879 3300037471 Bacteria 3530
229 Ga0400484_12892 3300038725 Unclassified 4229
230 Ga0400484_18838 3300038725 Unclassified 1196
231 Ga0400490_05705 3300038726 Bacteria 2151
232 Ga0400488_42199 3300038741 Bacteria 4990
233 Ga0400483_006199 3300039062 Bacteria 3974
234 Ga0400483_021425 3300039062 Unclassified 2388
235 Ga0400483_043312 3300039062 Bacteria 1738
236 Ga0400483_182111 3300039062 Bacteria 1045
237 Ga0400483_223350 3300039062 Bacteria 7476
238 Ga0400483_290026 3300039062 Unclassified 2517
239 Ga0400487_10371 3300039110 Unclassified 1835
240 Ga0436361_0479269 3300039447 Bacteria 1761
241 Ga0436362_1111867 3300039453 Unclassified 724
242 Ga0451789_0336907 3300041443 Bacteria 1002
243 Ga0451791_0489318 3300041451 Bacteria 1367
244 Ga0451791_0565247 3300041451 Bacteria 680
245 Ga0451793_1484062 3300041452 Bacteria 585
246 Ga0451797_0864103 3300041453 Bacteria 568
247 Ga0451800_0615226 3300041459 Bacteria 644
248 Ga0451802_1042818 3300041460 Bacteria 2082
249 Ga0451804_0878364 3300041463 Bacteria 950
250 Ga0451807_0463801 3300041486 Bacteria 3970
251 Ga0451837_0228092 3300041494 Bacteria 876
252 Ga0451841_0482943 3300041498 Bacteria 737
253 Ga0451851_1076735 3300041507 Bacteria 849
254 Ga0451843_0344710 3300041509 Bacteria 561
255 Ga0451853_1874335 3300041512 Bacteria 938
256 Ga0451853_2466439 3300041512 Bacteria 819
257 Ga0439433_0099500 3300041999 Bacteria 721
258 Ga0439445_0064168 3300042004 Bacteria 1008
259 Ga0439462_0093920 3300042015 Bacteria 824
260 Ga0450890_049116 3300042127 Bacteria 640
261 Ga0451577_0000024 3300042876 Bacteria 411758
262 Ga0451577_0003554 3300042876 Bacteria 17210
263 Ga0451577_0240831 3300042876 Bacteria 1637
264 Ga0453684_0354696 3300044712 Bacteria 1653
265 Ga0466957_0135959 3300044842 Bacteria 1580
266 Ga0466960_0002327 3300044901 Bacteria 7132
267 Ga0451576_0004627 3300045051 Bacteria 17755
268 Ga0495669_0322297 3300046684 Bacteria 746
269 Ga0495600_0237983 3300046809 Bacteria 1161
270 Ga0495680_0212541 3300047322 Bacteria 1384
271 Ga0496104_0369425 3300048907 Bacteria 1347
272 Ga0496111_1282287 3300048914 Bacteria 517
273 Ga0496114_0168088 3300048917 Bacteria 1910
274 Ga0496121_0000965 3300048924 Bacteria 51652
275 Ga0496125_0005710 3300048928 Bacteria 13715
276 Ga0496126_0722285 3300048929 Bacteria 772
277 Ga0501294_004986 3300049517 Bacteria 1255
278 Ga0501302_012017 3300049525 Bacteria 646
279 Ga0501036_0197894 3300049572 Bacteria 1690
280 Ga0501039_0049199 3300049575 Bacteria 3259
281 Ga0501040_0024457 3300049576 Bacteria 4054
282 Ga0501040_1136398 3300049576 Bacteria 567
283 Ga0501041_0022626 3300049577 Bacteria 3764
284 Ga0501042_0159849 3300049578 Bacteria 1625
285 Ga0501046_0092482 3300049580 Bacteria 2325
286 Ga0501048_0207192 3300049582 Bacteria 1390
287 Ga0501067_0000718 3300049583 Bacteria 17854
288 Ga0501067_0552998 3300049583 Bacteria 645
289 Ga0501070_0512639 3300049586 Bacteria 963
290 Ga0501071_0008563 3300049587 Bacteria 6763
291 Ga0501072_0001230 3300049588 Bacteria 19113
292 Ga0501072_0466622 3300049588 Bacteria 999
293 Ga0501073_0136091 3300049589 Bacteria 1703
294 Ga0501074_0153322 3300049590 Bacteria 1647
295 Ga0501075_0006140 3300049591 Bacteria 8256
296 Ga0501075_0124166 3300049591 Bacteria 1965
297 Ga0501076_0000152 3300049592 Bacteria 39703
298 Ga0501222_003226 3300049662 Bacteria 2237
299 Ga0501235_073475 3300049669 Bacteria 811
300 Ga0501257_105896 3300049686 Bacteria 742
301 Ga0501225_0068147 3300049705 Bacteria 1009
302 Ga0501079_0454362 3300049741 Bacteria 1006
303 Ga0501080_0096200 3300049742 Bacteria 2749
304 Ga0501081_0003549 3300049743 Bacteria 9963
305 Ga0501083_0364779 3300049744 Bacteria 939
306 Ga0501035_0054819 3300049822 Bacteria 3561
307 Ga0501035_0136875 3300049822 Bacteria 2132
308 Ga0501045_0690228 3300049824 Bacteria 754
309 nmdc:mga03683_128156_c1 3300050489 Bacteria 1133
310 nmdc:mga03n38_242760_c1 3300050490 Bacteria 948
311 nmdc:mga00v17_12947_c1 3300050491 Bacteria 4618
312 nmdc:mga00v17_29121_c1 3300050491 Unclassified 3239
313 nmdc:mga0k408_23736_c1 3300050493 Bacteria 3463
314 nmdc:mga0k408_536521_c1 3300050493 Bacteria 692
315 nmdc:mga07m45_26943_c1 3300050496 Bacteria 3162
316 nmdc:mga07m45_9042_c1 3300050496 Bacteria 5146
317 nmdc:mga09592_427445_c1 3300050508 Bacteria 1144
318 nmdc:mga09592_69671_c1 3300050508 Bacteria 1670
319 nmdc:mga09592_99838_c1 3300050508 Bacteria 2485
320 nmdc:mga0qj67_400_c1 3300050509 Bacteria 29888
321 nmdc:mga0qj67_667577_c1 3300050509 Bacteria 829
322 nmdc:mga06r32_1379035_c1 3300050510 Bacteria 647
323 nmdc:mga06r32_425607_c1 3300050510 Bacteria 1309
324 nmdc:mga06r32_99509_c1 3300050510 Unclassified 2852
325 nmdc:mga08y16_360017_c1 3300050511 Bacteria 1494
326 Ga0500646_0022018 3300053090 Bacteria 1702
327 Ga0500568_0000028 3300053139 Bacteria 161589
328 Ga0500568_0035009 3300053139 Bacteria 2051
329 Ga0500616_0053106 3300053153 Bacteria 2128
330 Ga0500645_030633 3300053730 Unclassified 1618
331 Ga0501084_0028334 3300054114 Bacteria 4681
332 Ga0501084_0039371 3300054114 Bacteria 3954
333 Ga0501082_0027463 3300060353 Bacteria 4899
334 Ga0466962_0132999 3300061719 Bacteria 1203
335 Ga0530510_0000756 3300061734 Bacteria 20996

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041509 Ga0451843_0344710 Ga0451843_0344710_44_382 112
2 3300005343 Ga0070687_100146564 Ga0070687_1001465642 118
3 3300006028 Ga0070717_10147228 Ga0070717_101472283 118
4 3300025938 Ga0207704_10615177 Ga0207704_106151772 119
5 3300005436 Ga0070713_100233425 Ga0070713_1002334251 125
6 3300006846 Ga0075430_100612346 Ga0075430_1006123461 125
7 3300031852 Ga0307410_10614217 Ga0307410_106142171 125
8 3300031901 Ga0307406_10183686 Ga0307406_101836862 125
9 3300031903 Ga0307407_10234635 Ga0307407_102346352 125
10 3300032002 Ga0307416_100167900 Ga0307416_1001679003 125
11 3300032005 Ga0307411_10106950 Ga0307411_101069502 125
12 3300050509 nmdc:mga0qj67_667577_c1 nmdc:mga0qj67_667577_c1_420_797 125
13 3300025945 Ga0207679_11082209 Ga0207679_110822092 127
14 3300005338 Ga0068868_100212750 Ga0068868_1002127502 132
15 3300005354 Ga0070675_100803136 Ga0070675_1008031361 132
16 3300005719 Ga0068861_101079987 Ga0068861_1010799872 132
17 3300006881 Ga0068865_100528690 Ga0068865_1005286902 132
18 3300014325 Ga0163163_11071782 Ga0163163_110717822 132
19 3300014968 Ga0157379_11008095 Ga0157379_110080952 132
20 3300025986 Ga0207658_10623114 Ga0207658_106231142 132
21 3300026118 Ga0207675_100237924 Ga0207675_1002379242 132
22 3300009176 Ga0105242_10957422 Ga0105242_109574222 136
23 3300041512 Ga0451853_1874335 Ga0451853_1874335_11_421 136
24 3300005468 Ga0070707_100643037 Ga0070707_1006430372 137
25 3300005471 Ga0070698_100098580 Ga0070698_1000985805 137
26 3300013104 Ga0157370_11120575 Ga0157370_111205752 137
27 3300025910 Ga0207684_10000420 Ga0207684_1000042037 137
28 3300025922 Ga0207646_10506009 Ga0207646_105060092 137
29 3300046809 Ga0495600_0237983 Ga0495600_0237983_120_557 137
30 3300047322 Ga0495680_0212541 Ga0495680_0212541_96_527 137
31 3300049822 Ga0501035_0054819 Ga0501035_0054819_3123_3536 137
32 3300003322 rootL2_10124499 rootL2_101244993 138
33 3300005336 Ga0070680_100013642 Ga0070680_1000136426 138
34 3300005336 Ga0070680_100297415 Ga0070680_1002974151 138
35 3300005341 Ga0070691_10083262 Ga0070691_100832622 138
36 3300005341 Ga0070691_10083319 Ga0070691_100833192 138
37 3300005343 Ga0070687_100573637 Ga0070687_1005736372 138
38 3300005345 Ga0070692_10029341 Ga0070692_100293412 138
39 3300005347 Ga0070668_100049276 Ga0070668_1000492764 138
40 3300005353 Ga0070669_100009102 Ga0070669_1000091028 138
41 3300005356 Ga0070674_100480853 Ga0070674_1004808532 138
42 3300005365 Ga0070688_100092147 Ga0070688_1000921472 138
43 3300005366 Ga0070659_100339117 Ga0070659_1003391171 138
44 3300005436 Ga0070713_100570109 Ga0070713_1005701092 138
45 3300005438 Ga0070701_10022630 Ga0070701_100226303 138
46 3300005439 Ga0070711_100170317 Ga0070711_1001703173 138
47 3300005440 Ga0070705_101212993 Ga0070705_1012129932 138
48 3300005441 Ga0070700_100000252 Ga0070700_10000025217 138
49 3300005441 Ga0070700_100178296 Ga0070700_1001782962 138
50 3300005456 Ga0070678_100392362 Ga0070678_1003923622 138
51 3300005459 Ga0068867_100011737 Ga0068867_1000117372 138
52 3300005459 Ga0068867_100540596 Ga0068867_1005405962 138
53 3300005459 Ga0068867_102382231 Ga0068867_1023822311 138
54 3300005543 Ga0070672_100162001 Ga0070672_1001620012 138
55 3300005546 Ga0070696_100530921 Ga0070696_1005309212 138
56 3300005548 Ga0070665_100422276 Ga0070665_1004222762 138
57 3300005549 Ga0070704_100907513 Ga0070704_1009075132 138
58 3300005578 Ga0068854_100590136 Ga0068854_1005901362 138
59 3300005614 Ga0068856_100280225 Ga0068856_1002802253 138
60 3300005617 Ga0068859_101720715 Ga0068859_1017207152 138
61 3300005718 Ga0068866_10057716 Ga0068866_100577162 138
62 3300005719 Ga0068861_100024622 Ga0068861_1000246222 138
63 3300005840 Ga0068870_10108040 Ga0068870_101080402 138
64 3300005841 Ga0068863_100026485 Ga0068863_1000264856 138
65 3300005842 Ga0068858_100025183 Ga0068858_1000251836 138
66 3300005844 Ga0068862_100413352 Ga0068862_1004133523 138
67 3300005844 Ga0068862_100577294 Ga0068862_1005772942 138
68 3300005844 Ga0068862_101703759 Ga0068862_1017037592 138
69 3300006028 Ga0070717_10000044 Ga0070717_1000004447 138
70 3300006028 Ga0070717_10213596 Ga0070717_102135963 138
71 3300006051 Ga0075364_10688573 Ga0075364_106885731 138
72 3300006173 Ga0070716_100118544 Ga0070716_1001185443 138
73 3300006177 Ga0075362_10442285 Ga0075362_104422851 138
74 3300006178 Ga0075367_11092809 Ga0075367_110928091 138
75 3300006237 Ga0097621_100377464 Ga0097621_1003774641 138
76 3300006844 Ga0075428_100292330 Ga0075428_1002923302 138
77 3300006844 Ga0075428_101307904 Ga0075428_1013079042 138
78 3300006846 Ga0075430_100887678 Ga0075430_1008876781 138
79 3300006847 Ga0075431_100345950 Ga0075431_1003459502 138
80 3300006847 Ga0075431_100515545 Ga0075431_1005155452 138
81 3300006880 Ga0075429_100101632 Ga0075429_1001016322 138
82 3300006880 Ga0075429_100394690 Ga0075429_1003946902 138
83 3300006931 Ga0097620_101720596 Ga0097620_1017205962 138
84 3300009093 Ga0105240_10059976 Ga0105240_100599763 138
85 3300009094 Ga0111539_10334908 Ga0111539_103349083 138
86 3300009094 Ga0111539_10793341 Ga0111539_107933413 138
87 3300009147 Ga0114129_10435981 Ga0114129_104359813 138
88 3300009148 Ga0105243_10418425 Ga0105243_104184252 138
89 3300009176 Ga0105242_10358736 Ga0105242_103587362 138
90 3300009177 Ga0105248_12293319 Ga0105248_122933192 138
91 3300009553 Ga0105249_10004037 Ga0105249_1000403713 138
92 3300010375 Ga0105239_13377629 Ga0105239_133776291 138
93 3300013102 Ga0157371_10019938 Ga0157371_100199382 138
94 3300013104 Ga0157370_10073248 Ga0157370_100732482 138
95 3300013105 Ga0157369_10014643 Ga0157369_100146432 138
96 3300013296 Ga0157374_10000167 Ga0157374_100001675 138
97 3300013306 Ga0163162_10050066 Ga0163162_100500662 138
98 3300013308 Ga0157375_11447496 Ga0157375_114474962 138
99 3300014326 Ga0157380_10028131 Ga0157380_100281313 138
100 3300014326 Ga0157380_12211994 Ga0157380_122119942 138
101 3300014745 Ga0157377_10013837 Ga0157377_100138375 138
102 3300025298 Ga0209050_1002319 Ga0209050_10023193 138
103 3300025900 Ga0207710_10217113 Ga0207710_102171132 138
104 3300025901 Ga0207688_10647799 Ga0207688_106477992 138
105 3300025907 Ga0207645_10542784 Ga0207645_105427842 138
106 3300025908 Ga0207643_10044756 Ga0207643_100447563 138
107 3300025916 Ga0207663_10203893 Ga0207663_102038932 138
108 3300025917 Ga0207660_10166013 Ga0207660_101660132 138
109 3300025917 Ga0207660_10590233 Ga0207660_105902332 138
110 3300025918 Ga0207662_10489438 Ga0207662_104894382 138
111 3300025923 Ga0207681_10006509 Ga0207681_100065096 138
112 3300025926 Ga0207659_10012430 Ga0207659_100124303 138
113 3300025931 Ga0207644_10643463 Ga0207644_106434632 138
114 3300025933 Ga0207706_10153017 Ga0207706_101530172 138
115 3300025934 Ga0207686_10497646 Ga0207686_104976462 138
116 3300025935 Ga0207709_10082418 Ga0207709_100824182 138
117 3300025937 Ga0207669_10051709 Ga0207669_100517092 138
118 3300025938 Ga0207704_10003240 Ga0207704_100032405 138
119 3300025940 Ga0207691_10346181 Ga0207691_103461812 138
120 3300025941 Ga0207711_10803628 Ga0207711_108036282 138
121 3300025942 Ga0207689_10165951 Ga0207689_101659511 138
122 3300025960 Ga0207651_11327253 Ga0207651_113272532 138
123 3300025961 Ga0207712_10052122 Ga0207712_100521223 138
124 3300025972 Ga0207668_10030494 Ga0207668_100304944 138
125 3300025981 Ga0207640_10330989 Ga0207640_103309892 138
126 3300026035 Ga0207703_10009199 Ga0207703_100091999 138
127 3300026075 Ga0207708_10002812 Ga0207708_100028122 138
128 3300026075 Ga0207708_10196747 Ga0207708_101967472 138
129 3300026075 Ga0207708_10494101 Ga0207708_104941012 138
130 3300026078 Ga0207702_10535584 Ga0207702_105355841 138
131 3300026088 Ga0207641_10016664 Ga0207641_100166647 138
132 3300026089 Ga0207648_10001474 Ga0207648_1000147414 138
133 3300026118 Ga0207675_100014209 Ga0207675_1000142093 138
134 3300026121 Ga0207683_10264169 Ga0207683_102641693 138
135 3300027907 Ga0207428_10173907 Ga0207428_101739073 138
136 3300028379 Ga0268266_10844934 Ga0268266_108449342 138
137 3300028380 Ga0268265_10246174 Ga0268265_102461742 138
138 3300028380 Ga0268265_10659848 Ga0268265_106598483 138
139 3300028563 Ga0265319_1036616 Ga0265319_10366162 138
140 3300028653 Ga0265323_10011857 Ga0265323_100118573 138
141 3300031240 Ga0265320_10010658 Ga0265320_100106583 138
142 3300031251 Ga0265327_10001560 Ga0265327_100015602 138
143 3300031251 Ga0265327_10004661 Ga0265327_100046617 138
144 3300031251 Ga0265327_10017105 Ga0265327_100171051 138
145 3300031344 Ga0265316_10023413 Ga0265316_100234133 138
146 3300031344 Ga0265316_10033317 Ga0265316_100333174 138
147 3300031691 Ga0316579_10140358 Ga0316579_101403582 138
148 3300031727 Ga0316576_10012165 Ga0316576_100121658 138
149 3300031728 Ga0316578_10055997 Ga0316578_100559972 138
150 3300031728 Ga0316578_10851175 Ga0316578_108511751 138
151 3300031852 Ga0307410_10016034 Ga0307410_100160344 138
152 3300031911 Ga0307412_10748020 Ga0307412_107480202 138
153 3300032002 Ga0307416_100401502 Ga0307416_1004015023 138
154 3300032004 Ga0307414_10082560 Ga0307414_100825603 138
155 3300032126 Ga0307415_101795703 Ga0307415_1017957032 138
156 3300035112 Ga0373932_0185668 Ga0373932_0185668_263_679 138
157 3300036647 Ga0316582_0045812 Ga0316582_0045812_2252_2680 138
158 3300036712 Ga0316584_0133986 Ga0316584_0133986_1237_1668 138
159 3300036712 Ga0316584_0143197 Ga0316584_0143197_819_1247 138
160 3300036712 Ga0316584_0247257 Ga0316584_0247257_100_522 138
161 3300039062 Ga0400483_021425 Ga0400483_021425_373_792 138
162 3300039062 Ga0400483_043312 Ga0400483_043312_911_1336 138
163 3300039062 Ga0400483_290026 Ga0400483_290026_60_479 138
164 3300039110 Ga0400487_10371 Ga0400487_10371_100_516 138
165 3300039447 Ga0436361_0479269 Ga0436361_0479269_164_601 138
166 3300041999 Ga0439433_0099500 Ga0439433_0099500_129_548 138
167 3300042015 Ga0439462_0093920 Ga0439462_0093920_85_513 138
168 3300042876 Ga0451577_0240831 Ga0451577_0240831_794_1210 138
169 3300045051 Ga0451576_0004627 Ga0451576_0004627_10672_11088 138
170 3300046684 Ga0495669_0322297 Ga0495669_0322297_197_616 138
171 3300048917 Ga0496114_0168088 Ga0496114_0168088_530_952 138
172 3300048924 Ga0496121_0000965 Ga0496121_0000965_3008_3424 138
173 3300048928 Ga0496125_0005710 Ga0496125_0005710_693_1109 138
174 3300048929 Ga0496126_0722285 Ga0496126_0722285_195_623 138
175 3300049572 Ga0501036_0197894 Ga0501036_0197894_706_1125 138
176 3300049575 Ga0501039_0049199 Ga0501039_0049199_1717_2136 138
177 3300049576 Ga0501040_0024457 Ga0501040_0024457_852_1271 138
178 3300049576 Ga0501040_1136398 Ga0501040_1136398_97_525 138
179 3300049577 Ga0501041_0022626 Ga0501041_0022626_1722_2141 138
180 3300049578 Ga0501042_0159849 Ga0501042_0159849_592_1011 138
181 3300049580 Ga0501046_0092482 Ga0501046_0092482_685_1104 138
182 3300049582 Ga0501048_0207192 Ga0501048_0207192_420_839 138
183 3300049586 Ga0501070_0512639 Ga0501070_0512639_219_638 138
184 3300049587 Ga0501071_0008563 Ga0501071_0008563_5949_6368 138
185 3300049588 Ga0501072_0001230 Ga0501072_0001230_637_1056 138
186 3300049588 Ga0501072_0466622 Ga0501072_0466622_109_528 138
187 3300049589 Ga0501073_0136091 Ga0501073_0136091_830_1249 138
188 3300049590 Ga0501074_0153322 Ga0501074_0153322_701_1120 138
189 3300049591 Ga0501075_0006140 Ga0501075_0006140_3866_4285 138
190 3300049591 Ga0501075_0124166 Ga0501075_0124166_955_1374 138
191 3300049592 Ga0501076_0000152 Ga0501076_0000152_38122_38541 138
192 3300049741 Ga0501079_0454362 Ga0501079_0454362_495_914 138
193 3300049742 Ga0501080_0096200 Ga0501080_0096200_1525_1944 138
194 3300049743 Ga0501081_0003549 Ga0501081_0003549_321_740 138
195 3300049744 Ga0501083_0364779 Ga0501083_0364779_110_529 138
196 3300049822 Ga0501035_0136875 Ga0501035_0136875_1633_2052 138
197 3300049824 Ga0501045_0690228 Ga0501045_0690228_27_446 138
198 3300050490 nmdc:mga03n38_242760_c1 nmdc:mga03n38_242760_c1_13_432 138
199 3300050493 nmdc:mga0k408_23736_c1 nmdc:mga0k408_23736_c1_1256_1684 138
200 3300050493 nmdc:mga0k408_536521_c1 nmdc:mga0k408_536521_c1_113_538 138
201 3300050496 nmdc:mga07m45_26943_c1 nmdc:mga07m45_26943_c1_2200_2628 138
202 3300050508 nmdc:mga09592_427445_c1 nmdc:mga09592_427445_c1_248_664 138
203 3300050508 nmdc:mga09592_99838_c1 nmdc:mga09592_99838_c1_1771_2196 138
204 3300050510 nmdc:mga06r32_1379035_c1 nmdc:mga06r32_1379035_c1_170_586 138
205 3300050510 nmdc:mga06r32_425607_c1 nmdc:mga06r32_425607_c1_867_1283 138
206 3300050511 nmdc:mga08y16_360017_c1 nmdc:mga08y16_360017_c1_772_1188 138
207 3300053139 Ga0500568_0000028 Ga0500568_0000028_107323_107742 138
208 3300053139 Ga0500568_0035009 Ga0500568_0035009_703_1134 138
209 3300053153 Ga0500616_0053106 Ga0500616_0053106_1526_1945 138
210 3300053730 Ga0500645_030633 Ga0500645_030633_200_625 138
211 3300054114 Ga0501084_0028334 Ga0501084_0028334_2857_3276 138
212 3300060353 Ga0501082_0027463 Ga0501082_0027463_2689_3108 138
213 3300061734 Ga0530510_0000756 Ga0530510_0000756_2252_2671 138
214 3300003320 rootH2_10272620 rootH2_102726202 139
215 3300003322 rootL2_10128333 rootL2_101283333 139
216 3300003323 rootH1_10032282 rootH1_100322822 139
217 3300003323 rootH1_10137612 rootH1_101376125 139
218 3300003323 rootH1_10162552 rootH1_101625524 139
219 3300005327 Ga0070658_10995674 Ga0070658_109956742 139
220 3300005329 Ga0070683_101721398 Ga0070683_1017213981 139
221 3300005337 Ga0070682_100759567 Ga0070682_1007595671 139
222 3300005340 Ga0070689_101117360 Ga0070689_1011173602 139
223 3300005345 Ga0070692_10104646 Ga0070692_101046462 139
224 3300005434 Ga0070709_10237994 Ga0070709_102379942 139
225 3300005440 Ga0070705_100039804 Ga0070705_1000398043 139
226 3300005441 Ga0070700_100315145 Ga0070700_1003151452 139
227 3300005444 Ga0070694_100058659 Ga0070694_1000586593 139
228 3300005445 Ga0070708_100219277 Ga0070708_1002192772 139
229 3300005459 Ga0068867_100363452 Ga0068867_1003634522 139
230 3300005467 Ga0070706_100598589 Ga0070706_1005985892 139
231 3300005468 Ga0070707_100085645 Ga0070707_1000856452 139
232 3300005468 Ga0070707_100636420 Ga0070707_1006364202 139
233 3300005471 Ga0070698_100134851 Ga0070698_1001348513 139
234 3300005518 Ga0070699_100082037 Ga0070699_1000820373 139
235 3300005530 Ga0070679_100028593 Ga0070679_1000285936 139
236 3300005536 Ga0070697_100019608 Ga0070697_1000196084 139
237 3300005539 Ga0068853_100627377 Ga0068853_1006273771 139
238 3300005544 Ga0070686_100396010 Ga0070686_1003960102 139
239 3300005545 Ga0070695_100046297 Ga0070695_1000462972 139
240 3300005546 Ga0070696_100155095 Ga0070696_1001550953 139
241 3300005546 Ga0070696_100603219 Ga0070696_1006032192 139
242 3300005549 Ga0070704_100056666 Ga0070704_1000566663 139
243 3300005549 Ga0070704_102013088 Ga0070704_1020130881 139
244 3300005563 Ga0068855_100000100 Ga0068855_10000010012 139
245 3300005617 Ga0068859_100095304 Ga0068859_1000953042 139
246 3300005841 Ga0068863_100411739 Ga0068863_1004117392 139
247 3300005842 Ga0068858_101647645 Ga0068858_1016476451 139
248 3300005843 Ga0068860_100799588 Ga0068860_1007995881 139
249 3300006028 Ga0070717_10067079 Ga0070717_100670793 139
250 3300006051 Ga0075364_10012629 Ga0075364_100126294 139
251 3300006173 Ga0070716_100249422 Ga0070716_1002494223 139
252 3300006353 Ga0075370_10018416 Ga0075370_100184164 139
253 3300006844 Ga0075428_100183208 Ga0075428_1001832083 139
254 3300006846 Ga0075430_100001623 Ga0075430_10000162315 139
255 3300006847 Ga0075431_100088062 Ga0075431_1000880623 139
256 3300006880 Ga0075429_100227420 Ga0075429_1002274203 139
257 3300006931 Ga0097620_100095300 Ga0097620_1000953003 139
258 3300009101 Ga0105247_10081752 Ga0105247_100817522 139
259 3300014325 Ga0163163_10514893 Ga0163163_105148932 139
260 3300014745 Ga0157377_11066528 Ga0157377_110665282 139
261 3300014968 Ga0157379_11373432 Ga0157379_113734321 139
262 3300014968 Ga0157379_11479572 Ga0157379_114795721 139
263 3300014968 Ga0157379_12485401 Ga0157379_124854011 139
264 3300025910 Ga0207684_10050024 Ga0207684_100500243 139
265 3300025910 Ga0207684_10113671 Ga0207684_101136712 139
266 3300025917 Ga0207660_11208155 Ga0207660_112081551 139
267 3300025921 Ga0207652_10009688 Ga0207652_100096882 139
268 3300025922 Ga0207646_10035264 Ga0207646_100352644 139
269 3300025926 Ga0207659_10431669 Ga0207659_104316693 139
270 3300025939 Ga0207665_10347729 Ga0207665_103477293 139
271 3300025949 Ga0207667_10000207 Ga0207667_1000020768 139
272 3300026075 Ga0207708_10091818 Ga0207708_100918182 139
273 3300026088 Ga0207641_10554218 Ga0207641_105542181 139
274 3300026118 Ga0207675_100870168 Ga0207675_1008701682 139
275 3300028653 Ga0265323_10005358 Ga0265323_100053585 139
276 3300028653 Ga0265323_10138760 Ga0265323_101387602 139
277 3300028794 Ga0307515_10003154 Ga0307515_1000315418 139
278 3300030522 Ga0307512_10247127 Ga0307512_102471272 139
279 3300031507 Ga0307509_10627922 Ga0307509_106279221 139
280 3300031616 Ga0307508_10136831 Ga0307508_101368313 139
281 3300031665 Ga0316575_10141074 Ga0316575_101410742 139
282 3300031712 Ga0265342_10393816 Ga0265342_103938162 139
283 3300031730 Ga0307516_10007808 Ga0307516_100078088 139
284 3300035116 Ga0373945_0363557 Ga0373945_0363557_155_580 139
285 3300036647 Ga0316582_0320900 Ga0316582_0320900_172_597 139
286 3300036712 Ga0316584_0250853 Ga0316584_0250853_529_969 139
287 3300037471 Ga0395905_0060879 Ga0395905_0060879_1144_1584 139
288 3300038725 Ga0400484_12892 Ga0400484_12892_3595_4035 139
289 3300038725 Ga0400484_18838 Ga0400484_18838_500_961 139
290 3300038726 Ga0400490_05705 Ga0400490_05705_1157_1600 139
291 3300038741 Ga0400488_42199 Ga0400488_42199_1038_1481 139
292 3300039062 Ga0400483_006199 Ga0400483_006199_2458_2886 139
293 3300039062 Ga0400483_182111 Ga0400483_182111_352_792 139
294 3300039062 Ga0400483_223350 Ga0400483_223350_6738_7166 139
295 3300039453 Ga0436362_1111867 Ga0436362_1111867_237_680 139
296 3300041443 Ga0451789_0336907 Ga0451789_0336907_206_631 139
297 3300041451 Ga0451791_0489318 Ga0451791_0489318_699_1121 139
298 3300041451 Ga0451791_0565247 Ga0451791_0565247_37_459 139
299 3300041452 Ga0451793_1484062 Ga0451793_1484062_11_436 139
300 3300041453 Ga0451797_0864103 Ga0451797_0864103_55_483 139
301 3300041459 Ga0451800_0615226 Ga0451800_0615226_118_549 139
302 3300041460 Ga0451802_1042818 Ga0451802_1042818_440_865 139
303 3300041463 Ga0451804_0878364 Ga0451804_0878364_442_867 139
304 3300041486 Ga0451807_0463801 Ga0451807_0463801_862_1287 139
305 3300041494 Ga0451837_0228092 Ga0451837_0228092_349_774 139
306 3300041498 Ga0451841_0482943 Ga0451841_0482943_85_510 139
307 3300041507 Ga0451851_1076735 Ga0451851_1076735_145_570 139
308 3300041512 Ga0451853_2466439 Ga0451853_2466439_50_487 139
309 3300042004 Ga0439445_0064168 Ga0439445_0064168_123_563 139
310 3300042127 Ga0450890_049116 Ga0450890_049116_83_514 139
311 3300042876 Ga0451577_0000024 Ga0451577_0000024_355740_356219 139
312 3300042876 Ga0451577_0003554 Ga0451577_0003554_3109_3540 139
313 3300044712 Ga0453684_0354696 Ga0453684_0354696_1070_1501 139
314 3300044842 Ga0466957_0135959 Ga0466957_0135959_387_815 139
315 3300044901 Ga0466960_0002327 Ga0466960_0002327_4847_5275 139
316 3300048907 Ga0496104_0369425 Ga0496104_0369425_354_803 139
317 3300048914 Ga0496111_1282287 Ga0496111_1282287_35_472 139
318 3300049517 Ga0501294_004986 Ga0501294_004986_805_1233 139
319 3300049525 Ga0501302_012017 Ga0501302_012017_123_551 139
320 3300049583 Ga0501067_0000718 Ga0501067_0000718_4133_4558 139
321 3300049583 Ga0501067_0552998 Ga0501067_0552998_23_454 139
322 3300049662 Ga0501222_003226 Ga0501222_003226_29_463 139
323 3300049669 Ga0501235_073475 Ga0501235_073475_106_531 139
324 3300049686 Ga0501257_105896 Ga0501257_105896_136_570 139
325 3300049705 Ga0501225_0068147 Ga0501225_0068147_463_888 139
326 3300050489 nmdc:mga03683_128156_c1 nmdc:mga03683_128156_c1_651_1091 139
327 3300050491 nmdc:mga00v17_12947_c1 nmdc:mga00v17_12947_c1_3527_3949 139
328 3300050491 nmdc:mga00v17_29121_c1 nmdc:mga00v17_29121_c1_1892_2329 139
329 3300050496 nmdc:mga07m45_9042_c1 nmdc:mga07m45_9042_c1_4519_4959 139
330 3300050508 nmdc:mga09592_69671_c1 nmdc:mga09592_69671_c1_365_796 139
331 3300050509 nmdc:mga0qj67_400_c1 nmdc:mga0qj67_400_c1_22182_22613 139
332 3300050510 nmdc:mga06r32_99509_c1 nmdc:mga06r32_99509_c1_2067_2498 139
333 3300053090 Ga0500646_0022018 Ga0500646_0022018_573_1010 139
334 3300054114 Ga0501084_0039371 Ga0501084_0039371_3256_3687 139
335 3300061719 Ga0466962_0132999 Ga0466962_0132999_57_485 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

56

162

0.81

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

66

151

0.79

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

36

149

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qvt-assembly5.cif.gz_H crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.976 3 139
4qvt-assembly2.cif.gz_D crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.9757 3 139
2pdo-assembly1.cif.gz_A crystal structure of the putative acetyltransferase of gnat family from shigella flexneri 0.9738 1 139
2pdo-assembly1.cif.gz_A crystal structure of the putative acetyltransferase of gnat family from shigella flexneri 0.967 1 139
4qvt-assembly5.cif.gz_H crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.9623 3 139
ID Description Score Start End Superfamily
4qvtA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.984 3 124 3.40.630.30
af_P76539_1_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9802 3 139 3.40.630.30
4qvtA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9683 3 124 3.40.630.30
af_P76539_1_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9595 3 139 3.40.630.30
1y9wB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9245 46 122 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A3N5W594-F1-model_v4 GNAT family acetyltransferase 0.9974 2 139 GO:0008080
AF-T0Z5R7-F1-model_v4 GCN5-related N-acetyltransferase 0.9956 1 121 GO:0016747
AF-A0A7H1J8J2-F1-model_v4 GNAT family acetyltransferase (EC 2.3.1.-) 0.9954 3 139 GO:0016747
AF-A0A6L7MQT2-F1-model_v4 GNAT family acetyltransferase (EC 2.3.1.-) 0.995 1 139 GO:0016747
AF-A0A433V796-F1-model_v4 deleted 0.9947 3 139

Feature Viewer

pLDDT pTM Quality
95.22 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map