F412307
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 335 | 240 | 670 | 443 |
Family's Representative Sequence
| Representative Sequence | 3300032004|Ga0307414_10076125|Ga0307414_100761251 |
| Length | 420 |
| Sequence | VATIDKAGVVRKPLYRTLYGQVLVAIFGGALLGHFLPETGIALKPLGDGFVSLVKMIIAPVIFVTVATGIAGMRDTSAVGSVAFKAXSYFLFFSTLALVIGLVVGNLVQPGVGLNIDPATLDAKAVANYAASAEEQSITGFLLAIIPITLFSSVTSGSILQTLMVAILVGVAIALTRPRSDLMQDILVSFGEVVFKLVHMLMKLAPIGAFGAIAFTIGQFGIGTLANIRYLKEELILVLGTSSSEAALPNLMEKLEVAGCRRSVVGLVVPTGYSFNLDGTNIYMTLASLFIAQAVGINLSMGEQLALVLIAMISSKGAAGVTGAGFVILAATLSVIPSVPVAGMALILGVDRFMSECRALTNFVGNAVATIVVAKWEGALDRDRLAAAMAGQPIPLPEADSELHERHDLAVPAPSQEALS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 21 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 32 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 33 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 40 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 46 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 49 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 50 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 51 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 52 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 54 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 57 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 60 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 79 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 81 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 82 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 83 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 84 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 85 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 86 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 87 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 88 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 89 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 90 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 91 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 92 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 93 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 94 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 95 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 122 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 123 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 124 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 125 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 126 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 127 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 128 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 129 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 130 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 131 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 132 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 148 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 149 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 150 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 151 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 152 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 153 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 154 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 155 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 156 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 157 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 158 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 159 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 160 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 161 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 162 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 163 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 164 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 165 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 166 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 167 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 168 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 169 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 170 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 171 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 172 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 173 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 174 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 175 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 176 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 177 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 178 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 179 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 180 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 181 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 182 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 183 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 184 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 185 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 186 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 187 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 188 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 189 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 190 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 191 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 192 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 193 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 194 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 195 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 196 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 197 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 198 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 199 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 200 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 201 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 202 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 203 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 204 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 205 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 206 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 207 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 208 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 209 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 210 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 211 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 212 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 213 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 214 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 215 | 2928515477 | Acinetobacter bereziniae 1375 | Isolate | Rhizosphere |
| 216 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 217 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 218 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 219 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 220 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 221 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 222 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 223 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 224 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 225 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 226 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 227 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 228 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 229 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 230 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 231 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 232 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 233 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 234 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 235 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 236 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 237 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 238 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 239 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 240 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 74.93 |
| Metatranscriptomes | 0 |
| Isolates | 25.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 1.19 |
| Bulb | 0 |
| Endosphere | 24.78 |
| Nodule | 1.49 |
| Rhizoplane | 0.3 |
| Rhizosphere | 48.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307414_10076125 | 3300032004 | Bacteria | 2438 |
| 2 | JGI24736J21556_1002498 | 3300001904 | Bacteria | 3252 |
| 3 | JGI24739J22299_10001175 | 3300001989 | Bacteria | 9803 |
| 4 | JGI24735J21928_10003388 | 3300002067 | Bacteria | 5440 |
| 5 | JGI24738J21930_10000047 | 3300002075 | Bacteria | 24272 |
| 6 | JGI24751J29686_10000431 | 3300002459 | Bacteria | 12979 |
| 7 | JGI25152J39213_1000057 | 3300002773 | Bacteria | 75426 |
| 8 | JGI25150J39212_1000174 | 3300002774 | Bacteria | 36085 |
| 9 | JGI25151J46595_10000109 | 3300003187 | Bacteria | 112044 |
| 10 | JGI25153J46596_10000084 | 3300003215 | Bacteria | 112044 |
| 11 | rootL2_10002127 | 3300003322 | Bacteria | 10396 |
| 12 | Ga0055526_1003222 | 3300003771 | Bacteria | 10519 |
| 13 | Ga0055526_1009286 | 3300003771 | Bacteria | 4762 |
| 14 | Ga0055526_1012432 | 3300003771 | Bacteria | 3715 |
| 15 | Ga0055537_1000213 | 3300003773 | Bacteria | 42839 |
| 16 | Ga0055537_1000945 | 3300003773 | Bacteria | 13476 |
| 17 | Ga0055524_1005291 | 3300003775 | Bacteria | 5793 |
| 18 | Ga0055536_1000733 | 3300003781 | Bacteria | 22058 |
| 19 | Ga0055536_1001078 | 3300003781 | Bacteria | 17194 |
| 20 | Ga0055536_1001700 | 3300003781 | Bacteria | 13026 |
| 21 | Ga0055536_1003006 | 3300003781 | Bacteria | 9234 |
| 22 | Ga0055536_1004517 | 3300003781 | Bacteria | 7078 |
| 23 | Ga0055534_1000126 | 3300003784 | Bacteria | 57340 |
| 24 | Ga0055528_1000282 | 3300003790 | Bacteria | 43363 |
| 25 | Ga0055530_10000164 | 3300003791 | Bacteria | 60316 |
| 26 | Ga0055531_10003207 | 3300003794 | Bacteria | 10501 |
| 27 | Ga0055531_10005994 | 3300003794 | Bacteria | 6978 |
| 28 | Ga0055531_10006379 | 3300003794 | Bacteria | 6707 |
| 29 | Ga0055531_10008566 | 3300003794 | Bacteria | 5368 |
| 30 | Ga0055531_10019017 | 3300003794 | Bacteria | 2805 |
| 31 | Ga0058692_1000013 | 3300003856 | Bacteria | 316299 |
| 32 | Ga0055543_1001394 | 3300004625 | Bacteria | 9650 |
| 33 | Ga0065165_1000101 | 3300005262 | Bacteria | 141486 |
| 34 | Ga0065165_1000653 | 3300005262 | Bacteria | 50050 |
| 35 | Ga0065165_1001443 | 3300005262 | Bacteria | 25758 |
| 36 | Ga0065704_10079341 | 3300005289 | Bacteria | 4191 |
| 37 | Ga0065704_10135378 | 3300005289 | Bacteria | 1578 |
| 38 | Ga0070670_100001410 | 3300005331 | Bacteria | 19303 |
| 39 | Ga0070668_100010506 | 3300005347 | Bacteria | 6881 |
| 40 | Ga0070668_100040704 | 3300005347 | Bacteria | 3556 |
| 41 | Ga0070674_100000262 | 3300005356 | Bacteria | 26193 |
| 42 | Ga0070678_100000992 | 3300005456 | Bacteria | 14678 |
| 43 | Ga0070662_100000531 | 3300005457 | Bacteria | 23047 |
| 44 | Ga0068855_100053364 | 3300005563 | Bacteria | 4756 |
| 45 | Ga0068855_100133049 | 3300005563 | Bacteria | 2839 |
| 46 | Ga0068854_100024170 | 3300005578 | Bacteria | 4158 |
| 47 | Ga0081539_10012710 | 3300005985 | Bacteria | 6445 |
| 48 | Ga0081539_10015234 | 3300005985 | Bacteria | 5603 |
| 49 | Ga0081539_10067588 | 3300005985 | Bacteria | 1932 |
| 50 | Ga0099823_1000575 | 3300006944 | Bacteria | 25524 |
| 51 | Ga0105251_10000126 | 3300009011 | Bacteria | 76832 |
| 52 | Ga0105251_10002345 | 3300009011 | Bacteria | 14979 |
| 53 | Ga0105244_10016356 | 3300009036 | Bacteria | 4227 |
| 54 | Ga0105243_10003632 | 3300009148 | Bacteria | 12417 |
| 55 | Ga0105243_10011442 | 3300009148 | Bacteria | 6713 |
| 56 | Ga0105242_10006283 | 3300009176 | Bacteria | 9155 |
| 57 | Ga0105237_10026434 | 3300009545 | Bacteria | 5932 |
| 58 | Ga0105239_10109051 | 3300010375 | Bacteria | 3067 |
| 59 | Ga0157319_1000008 | 3300012497 | Bacteria | 315600 |
| 60 | Ga0157371_10011336 | 3300013102 | Bacteria | 6877 |
| 61 | Ga0157370_10001042 | 3300013104 | Bacteria | 34875 |
| 62 | Ga0157369_10013587 | 3300013105 | Bacteria | 9207 |
| 63 | Ga0157369_10015682 | 3300013105 | Bacteria | 8539 |
| 64 | Ga0157372_10024150 | 3300013307 | Bacteria | 6598 |
| 65 | Ga0157380_10070452 | 3300014326 | Bacteria | 2825 |
| 66 | Ga0182005_1000173 | 3300015265 | Bacteria | 44701 |
| 67 | Ga0182005_1006246 | 3300015265 | Bacteria | 3658 |
| 68 | Ga0209674_101897 | 3300025226 | Bacteria | 4930 |
| 69 | Ga0209437_100727 | 3300025233 | Bacteria | 16722 |
| 70 | Ga0207425_1000045 | 3300025245 | Bacteria | 194257 |
| 71 | Ga0209129_1000202 | 3300025258 | Bacteria | 72795 |
| 72 | Ga0209565_1000059 | 3300025263 | Bacteria | 189658 |
| 73 | Ga0209565_1000060 | 3300025263 | Bacteria | 188543 |
| 74 | Ga0209565_1000457 | 3300025263 | Bacteria | 31431 |
| 75 | Ga0209673_1000047 | 3300025273 | Bacteria | 289276 |
| 76 | Ga0209673_1005052 | 3300025273 | Bacteria | 6797 |
| 77 | Ga0209673_1013613 | 3300025273 | Bacteria | 3199 |
| 78 | Ga0209673_1020513 | 3300025273 | Bacteria | 2338 |
| 79 | Ga0209130_1009224 | 3300025284 | Bacteria | 2834 |
| 80 | Ga0209675_1000016 | 3300025291 | Bacteria | 391965 |
| 81 | Ga0209675_1000183 | 3300025291 | Bacteria | 70391 |
| 82 | Ga0209676_1000035 | 3300025292 | Bacteria | 459284 |
| 83 | Ga0209676_1000037 | 3300025292 | Bacteria | 457562 |
| 84 | Ga0209676_1000234 | 3300025292 | Bacteria | 119888 |
| 85 | Ga0209676_1000384 | 3300025292 | Bacteria | 81053 |
| 86 | Ga0209676_1000475 | 3300025292 | Bacteria | 66299 |
| 87 | Ga0209676_1006150 | 3300025292 | Bacteria | 6019 |
| 88 | Ga0209676_1020477 | 3300025292 | Bacteria | 2246 |
| 89 | Ga0209025_1000013 | 3300025294 | Bacteria | 871757 |
| 90 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 91 | Ga0209564_1001657 | 3300025295 | Bacteria | 21411 |
| 92 | Ga0209564_1002728 | 3300025295 | Bacteria | 13301 |
| 93 | Ga0209564_1003879 | 3300025295 | Bacteria | 9616 |
| 94 | Ga0209564_1010226 | 3300025295 | Bacteria | 4352 |
| 95 | Ga0209758_1000014 | 3300025297 | Bacteria | 871757 |
| 96 | Ga0209050_1000132 | 3300025298 | Bacteria | 185906 |
| 97 | Ga0209050_1000146 | 3300025298 | Bacteria | 166930 |
| 98 | Ga0209050_1000472 | 3300025298 | Bacteria | 71438 |
| 99 | Ga0209050_1000901 | 3300025298 | Bacteria | 39362 |
| 100 | Ga0209050_1005506 | 3300025298 | Bacteria | 7917 |
| 101 | Ga0209050_1014975 | 3300025298 | Bacteria | 3295 |
| 102 | Ga0209256_1001049 | 3300025299 | Bacteria | 32147 |
| 103 | Ga0207426_1021572 | 3300025302 | Bacteria | 2226 |
| 104 | Ga0209051_1021789 | 3300025303 | Bacteria | 2715 |
| 105 | Ga0209257_1000176 | 3300025304 | Bacteria | 161436 |
| 106 | Ga0209257_1000240 | 3300025304 | Bacteria | 128014 |
| 107 | Ga0209257_1000536 | 3300025304 | Bacteria | 65942 |
| 108 | Ga0209257_1003818 | 3300025304 | Bacteria | 12357 |
| 109 | Ga0209257_1004286 | 3300025304 | Bacteria | 11239 |
| 110 | Ga0209257_1007255 | 3300025304 | Bacteria | 6773 |
| 111 | Ga0209257_1008221 | 3300025304 | Bacteria | 6019 |
| 112 | Ga0207655_1004432 | 3300025728 | Bacteria | 9957 |
| 113 | Ga0207655_1004629 | 3300025728 | Bacteria | 9661 |
| 114 | Ga0207655_1032813 | 3300025728 | Bacteria | 2366 |
| 115 | Ga0207713_1000773 | 3300025735 | Bacteria | 29536 |
| 116 | Ga0207713_1007271 | 3300025735 | Bacteria | 6568 |
| 117 | Ga0207647_10000007 | 3300025904 | Bacteria | 209754 |
| 118 | Ga0207647_10001365 | 3300025904 | Bacteria | 18758 |
| 119 | Ga0207671_10007318 | 3300025914 | Bacteria | 9588 |
| 120 | Ga0207681_10005718 | 3300025923 | Bacteria | 7630 |
| 121 | Ga0207650_10004980 | 3300025925 | Bacteria | 9076 |
| 122 | Ga0207706_10002418 | 3300025933 | Bacteria | 18218 |
| 123 | Ga0207686_10002760 | 3300025934 | Bacteria | 9514 |
| 124 | Ga0207709_10001044 | 3300025935 | Bacteria | 20448 |
| 125 | Ga0207669_10000048 | 3300025937 | Bacteria | 60914 |
| 126 | Ga0207667_10009285 | 3300025949 | Bacteria | 11604 |
| 127 | Ga0207668_10041494 | 3300025972 | Bacteria | 3111 |
| 128 | Ga0207668_10098537 | 3300025972 | Bacteria | 2166 |
| 129 | Ga0207640_10043097 | 3300025981 | Bacteria | 2882 |
| 130 | Ga0207640_10122362 | 3300025981 | Bacteria | 1867 |
| 131 | Ga0207674_10022381 | 3300026116 | Bacteria | 6787 |
| 132 | Ga0207683_10000619 | 3300026121 | Bacteria | 32637 |
| 133 | Ga0207683_10232704 | 3300026121 | Bacteria | 1681 |
| 134 | Ga0209389_1009789 | 3300027296 | Bacteria | 8607 |
| 135 | Ga0209371_1000007 | 3300027312 | Bacteria | 1050654 |
| 136 | Ga0307515_10085966 | 3300028794 | Bacteria | 4017 |
| 137 | Ga0268256_1000008 | 3300030500 | Bacteria | 1050654 |
| 138 | Ga0268256_1015643 | 3300030500 | Bacteria | 2206 |
| 139 | Ga0316183_1173556 | 3300030742 | Bacteria | 6174 |
| 140 | Ga0307513_10012062 | 3300031456 | Bacteria | 10688 |
| 141 | Ga0307413_10003565 | 3300031824 | Bacteria | 6584 |
| 142 | Ga0307413_10067912 | 3300031824 | Bacteria | 2231 |
| 143 | Ga0307413_10130107 | 3300031824 | Bacteria | 1721 |
| 144 | Ga0307410_10003865 | 3300031852 | Bacteria | 7617 |
| 145 | Ga0307407_10007535 | 3300031903 | Bacteria | 4935 |
| 146 | Ga0307412_10003457 | 3300031911 | Bacteria | 8782 |
| 147 | Ga0307416_100011816 | 3300032002 | Bacteria | 5850 |
| 148 | Ga0307414_10001115 | 3300032004 | Bacteria | 13723 |
| 149 | Ga0307414_10012354 | 3300032004 | Bacteria | 5046 |
| 150 | Ga0307414_10022064 | 3300032004 | Bacteria | 4008 |
| 151 | Ga0307414_10140503 | 3300032004 | Bacteria | 1890 |
| 152 | Ga0307411_10003646 | 3300032005 | Bacteria | 7200 |
| 153 | Ga0307411_10095118 | 3300032005 | Bacteria | 2091 |
| 154 | Ga0307415_100003165 | 3300032126 | Bacteria | 8343 |
| 155 | Ga0395899_0067685 | 3300037312 | Bacteria | 2620 |
| 156 | Ga0395905_0000372 | 3300037471 | Bacteria | 63933 |
| 157 | Ga0395901_0001674 | 3300038443 | Bacteria | 22881 |
| 158 | Ga0237819_05278 | 3300038705 | Bacteria | 2041 |
| 159 | Ga0495617_000176 | 3300046452 | Bacteria | 40516 |
| 160 | Ga0495638_0000139 | 3300046460 | Bacteria | 114810 |
| 161 | Ga0495584_0026682 | 3300046491 | Bacteria | 2927 |
| 162 | Ga0495585_0000112 | 3300046492 | Bacteria | 87291 |
| 163 | Ga0495607_0000067 | 3300046501 | Bacteria | 102663 |
| 164 | Ga0495607_0000119 | 3300046501 | Bacteria | 82732 |
| 165 | Ga0495607_0002423 | 3300046501 | Bacteria | 15227 |
| 166 | Ga0495607_0014247 | 3300046501 | Bacteria | 5184 |
| 167 | Ga0495583_0021924 | 3300046506 | Bacteria | 3273 |
| 168 | Ga0495606_0034729 | 3300046507 | Bacteria | 3457 |
| 169 | Ga0495606_0050614 | 3300046507 | Bacteria | 2716 |
| 170 | Ga0495616_0008743 | 3300046513 | Bacteria | 5967 |
| 171 | Ga0495631_0000124 | 3300046518 | Bacteria | 51693 |
| 172 | Ga0495631_0000847 | 3300046518 | Bacteria | 19421 |
| 173 | Ga0495632_0037681 | 3300046519 | Bacteria | 2452 |
| 174 | Ga0495643_0001568 | 3300046522 | Bacteria | 20340 |
| 175 | Ga0495643_0002296 | 3300046522 | Bacteria | 15441 |
| 176 | Ga0495648_0000331 | 3300046524 | Bacteria | 52275 |
| 177 | Ga0495609_0002642 | 3300046538 | Bacteria | 10869 |
| 178 | Ga0495668_0000053 | 3300046616 | Bacteria | 209976 |
| 179 | Ga0495611_0000002 | 3300046648 | Bacteria | 705677 |
| 180 | Ga0495625_0000002 | 3300046660 | Bacteria | 813323 |
| 181 | Ga0495625_0000351 | 3300046660 | Bacteria | 70408 |
| 182 | Ga0495625_0064312 | 3300046660 | Bacteria | 2587 |
| 183 | Ga0495661_0000700 | 3300046665 | Bacteria | 33318 |
| 184 | Ga0495670_0000006 | 3300046691 | Bacteria | 255322 |
| 185 | Ga0495670_0001387 | 3300046691 | Bacteria | 11844 |
| 186 | Ga0495671_0000220 | 3300046692 | Bacteria | 49354 |
| 187 | Ga0495589_0000067 | 3300046794 | Bacteria | 99395 |
| 188 | Ga0495660_0000432 | 3300046810 | Bacteria | 35230 |
| 189 | Ga0495672_0000087 | 3300047320 | Bacteria | 154275 |
| 190 | Ga0495677_0001298 | 3300047445 | Bacteria | 9983 |
| 191 | Ga0495679_000003 | 3300047446 | Bacteria | 787868 |
| 192 | Ga0495673_0008404 | 3300047469 | Bacteria | 5817 |
| 193 | Ga0495686_0000522 | 3300047472 | Bacteria | 55463 |
| 194 | Ga0495686_0013963 | 3300047472 | Bacteria | 5553 |
| 195 | Ga0496116_0104653 | 3300048919 | Bacteria | 1681 |
| 196 | Ga0496117_0000368 | 3300048920 | Bacteria | 78448 |
| 197 | Ga0496117_0018500 | 3300048920 | Bacteria | 5765 |
| 198 | Ga0496118_0002837 | 3300048921 | Bacteria | 22651 |
| 199 | Ga0496118_0002870 | 3300048921 | Bacteria | 22495 |
| 200 | Ga0496118_0068654 | 3300048921 | Bacteria | 2573 |
| 201 | Ga0496119_0000779 | 3300048922 | Bacteria | 42634 |
| 202 | Ga0496120_0000458 | 3300048923 | Bacteria | 64377 |
| 203 | Ga0496121_0000075 | 3300048924 | Bacteria | 240437 |
| 204 | Ga0496122_0000896 | 3300048925 | Bacteria | 55027 |
| 205 | Ga0496122_0000990 | 3300048925 | Bacteria | 50743 |
| 206 | Ga0496122_0009852 | 3300048925 | Bacteria | 9963 |
| 207 | Ga0496123_0000097 | 3300048926 | Bacteria | 173894 |
| 208 | Ga0496123_0000137 | 3300048926 | Bacteria | 152169 |
| 209 | Ga0496124_0000115 | 3300048927 | Bacteria | 164929 |
| 210 | Ga0496124_0000343 | 3300048927 | Bacteria | 85220 |
| 211 | Ga0496124_0000725 | 3300048927 | Bacteria | 54102 |
| 212 | Ga0496124_0002387 | 3300048927 | Bacteria | 24716 |
| 213 | Ga0496124_0088494 | 3300048927 | Bacteria | 2531 |
| 214 | Ga0496124_0146608 | 3300048927 | Bacteria | 1856 |
| 215 | Ga0496125_0019893 | 3300048928 | Bacteria | 6314 |
| 216 | Ga0496125_0072016 | 3300048928 | Bacteria | 2696 |
| 217 | Ga0496125_0131103 | 3300048928 | Bacteria | 1764 |
| 218 | Ga0496126_0082866 | 3300048929 | Bacteria | 2832 |
| 219 | Ga0495678_000026 | 3300049459 | Bacteria | 226978 |
| 220 | Ga0495682_0001649 | 3300049460 | Bacteria | 11491 |
| 221 | Ga0501031_0016117 | 3300049568 | Bacteria | 4853 |
| 222 | Ga0501031_0067966 | 3300049568 | Bacteria | 2321 |
| 223 | Ga0501032_0035931 | 3300049569 | Bacteria | 3384 |
| 224 | Ga0501032_0048235 | 3300049569 | Bacteria | 2875 |
| 225 | Ga0501033_0009947 | 3300049570 | Bacteria | 7301 |
| 226 | Ga0501034_0002864 | 3300049571 | Bacteria | 20079 |
| 227 | Ga0501034_0025292 | 3300049571 | Bacteria | 6043 |
| 228 | Ga0501036_0074327 | 3300049572 | Bacteria | 2874 |
| 229 | Ga0501037_0058384 | 3300049573 | Bacteria | 2816 |
| 230 | Ga0501038_0012954 | 3300049574 | Bacteria | 7608 |
| 231 | Ga0501038_0090158 | 3300049574 | Bacteria | 2570 |
| 232 | Ga0501039_0020871 | 3300049575 | Bacteria | 5021 |
| 233 | Ga0501046_0135045 | 3300049580 | Bacteria | 1869 |
| 234 | Ga0501047_0002891 | 3300049581 | Bacteria | 16289 |
| 235 | Ga0501070_0036328 | 3300049586 | Bacteria | 4115 |
| 236 | Ga0501035_0015360 | 3300049822 | Bacteria | 7066 |
| 237 | Ga0501044_0011336 | 3300049823 | Bacteria | 9658 |
| 238 | Ga0501044_0037198 | 3300049823 | Bacteria | 5088 |
| 239 | Ga0500643_000031 | 3300053087 | Bacteria | 204488 |
| 240 | Ga0500643_001241 | 3300053087 | Bacteria | 15107 |
| 241 | Ga0500643_004843 | 3300053087 | Bacteria | 5944 |
| 242 | Ga0500566_0000203 | 3300053094 | Bacteria | 31188 |
| 243 | Ga0500595_007345 | 3300053119 | Bacteria | 4576 |
| 244 | Ga0500658_0030181 | 3300053134 | Bacteria | 2113 |
| 245 | Ga0500559_0020035 | 3300053136 | Bacteria | 2827 |
| 246 | Ga0500568_0002683 | 3300053139 | Bacteria | 10316 |
| 247 | Ga0500627_0000035 | 3300053158 | Bacteria | 80123 |
| 248 | Ga0500627_0000196 | 3300053158 | Bacteria | 17442 |
| 249 | Ga0500645_000212 | 3300053730 | Bacteria | 44287 |
| 250 | Ga0500596_003063 | 3300053735 | Bacteria | 3215 |
| 251 | Ga0501082_0000866 | 3300060353 | Bacteria | 26762 |
| 252 | 2548501488 | 2547132374 | Bacteria | 5530232 |
| 253 | 2578457067 | 2576861471 | Bacteria | 4648976 |
| 254 | 2585261490 | 2582581305 | Bacteria | 4895574 |
| 255 | 2595446667 | 2593339238 | Bacteria | 4182970 |
| 256 | 2596375207 | 2595698237 | Bacteria | 6712432 |
| 257 | 2600228853 | 2599185359 | Bacteria | 4772316 |
| 258 | 2643835260 | 2643221563 | Bacteria | 4726935 |
| 259 | 2643907715 | 2643221579 | Bacteria | 4443405 |
| 260 | 2643914012 | 2643221581 | Bacteria | 3893603 |
| 261 | 2643994391 | 2643221596 | Bacteria | 5006805 |
| 262 | 2644040237 | 2643221605 | Bacteria | 4772303 |
| 263 | 2644056186 | 2643221608 | Bacteria | 4724829 |
| 264 | 2644061414 | 2643221609 | Bacteria | 6756331 |
| 265 | 2644074945 | 2643221611 | Bacteria | 6820941 |
| 266 | 2644295227 | 2643221652 | Bacteria | 5140275 |
| 267 | 2644648963 | 2643221717 | Bacteria | 5676132 |
| 268 | 2735834473 | 2734482264 | Unclassified | 5014763 |
| 269 | 2738745160 | 2738541281 | Bacteria | 5112672 |
| 270 | 2739243110 | 2738543012 | Bacteria | 7115078 |
| 271 | 2739354390 | 2738543032 | Bacteria | 5115625 |
| 272 | 2747949183 | 2747842428 | Bacteria | 4689383 |
| 273 | 2748018548 | 2747842501 | Bacteria | 5293829 |
| 274 | 2765580432 | 2765235840 | Bacteria | 4663337 |
| 275 | 2793062618 | 2791355196 | Bacteria | 7323613 |
| 276 | 2816473682 | 2816332133 | Bacteria | 7249298 |
| 277 | 2816518534 | 2816332141 | Bacteria | 4436036 |
| 278 | 2819563697 | 2818991440 | Bacteria | 4774720 |
| 279 | 2819661216 | 2818991457 | Bacteria | 5323295 |
| 280 | 2819714689 | 2818991466 | Bacteria | 4748179 |
| 281 | 2831869173 | 2831864461 | Bacteria | 6502356 |
| 282 | 2839138344 | 2839138175 | Bacteria | 6549354 |
| 283 | 2842394358 | 2842391507 | Bacteria | 4486072 |
| 284 | 2842702115 | 2842698319 | Bacteria | 5190321 |
| 285 | 2842759055 | 2842757796 | Bacteria | 3981385 |
| 286 | 2842782915 | 2842780639 | Bacteria | 4337790 |
| 287 | 2842917987 | 2842914999 | Bacteria | 4419378 |
| 288 | 2852652201 | 2852649853 | Bacteria | 4036942 |
| 289 | 2852654774 | 2852653556 | Bacteria | 4050083 |
| 290 | 2852684446 | 2852680915 | Bacteria | 4100189 |
| 291 | 2852687082 | 2852684882 | Bacteria | 5463342 |
| 292 | 2857445653 | 2857442823 | Bacteria | 4562550 |
| 293 | 2874223105 | 2874220319 | Bacteria | 4594709 |
| 294 | 2879166940 | 2879163058 | Bacteria | 4223965 |
| 295 | 2885430687 | 2885429604 | Bacteria | 3642894 |
| 296 | 2886849333 | 2886848708 | Bacteria | 5632523 |
| 297 | 2894414345 | 2894414249 | Bacteria | 4405451 |
| 298 | 2898716470 | 2898713307 | Bacteria | 4110805 |
| 299 | 2904463992 | 2904463128 | Bacteria | 4775606 |
| 300 | 2904480131 | 2904479285 | Bacteria | 5073931 |
| 301 | 2919087670 | 2919085039 | Bacteria | 4532964 |
| 302 | 2919092534 | 2919089067 | Bacteria | 4560942 |
| 303 | 2919131140 | 2919130084 | Bacteria | 5301837 |
| 304 | 2919137301 | 2919134579 | Bacteria | 4480386 |
| 305 | 2919405476 | 2919404418 | Bacteria | 4232372 |
| 306 | 2919514276 | 2919513703 | Bacteria | 3844312 |
| 307 | 2928027482 | 2928027323 | Bacteria | 4382488 |
| 308 | 2928126584 | 2928125067 | Bacteria | 5937560 |
| 309 | 2928499002 | 2928496128 | Bacteria | 4631123 |
| 310 | 2928517942 | 2928515477 | Bacteria | 4448421 |
| 311 | 2928529195 | 2928526807 | Bacteria | 4760224 |
| 312 | 2928968736 | 2928968154 | Bacteria | 4633371 |
| 313 | 2929196381 | 2929195423 | Bacteria | 5325372 |
| 314 | 2931383444 | 2931380184 | Bacteria | 4455911 |
| 315 | 2932423083 | 2932422444 | Bacteria | 4678430 |
| 316 | 2937614432 | 2937610967 | Bacteria | 4618818 |
| 317 | 2939589733 | 2939589442 | Bacteria | 4214238 |
| 318 | 2939624184 | 2939622612 | Bacteria | 4698046 |
| 319 | 2939630185 | 2939626828 | Bacteria | 4695272 |
| 320 | 2941474846 | 2941471342 | Bacteria | 5018624 |
| 321 | 2941478827 | 2941475908 | Bacteria | 4145589 |
| 322 | 2961049870 | 2961047084 | Bacteria | 4594415 |
| 323 | 2961064969 | 2961064222 | Bacteria | 4749990 |
| 324 | 2974307712 | 2974307012 | Bacteria | 4172388 |
| 325 | 2974321038 | 2974320154 | Bacteria | 4571377 |
| 326 | 2977248432 | 2977247770 | Bacteria | 4160543 |
| 327 | 2984517084 | 2984514374 | Bacteria | 4172479 |
| 328 | 2984558217 | 2984555340 | Bacteria | 4247089 |
| 329 | 2984567404 | 2984564862 | Bacteria | 4339992 |
| 330 | 2987608712 | 2987605356 | Bacteria | 4187822 |
| 331 | 2990715315 | 2990710928 | Bacteria | 5002431 |
| 332 | 2993358469 | 2993356040 | Bacteria | 4247105 |
| 333 | 3000867708 | 3000865235 | Bacteria | 3106258 |
| 334 | 3003670873 | 3003665799 | Bacteria | 7279786 |
| 335 | 8001848610 | 8001845381 | Bacteria | 5804942 |
| 336 | Ga0307414_10076125 | |||
| 337 | JGI24736J21556_1002498 | |||
| 338 | JGI24739J22299_10001175 | |||
| 339 | JGI24735J21928_10003388 | |||
| 340 | JGI24738J21930_10000047 | |||
| 341 | JGI24751J29686_10000431 | |||
| 342 | JGI25152J39213_1000057 | |||
| 343 | JGI25150J39212_1000174 | |||
| 344 | JGI25151J46595_10000109 | |||
| 345 | JGI25153J46596_10000084 | |||
| 346 | rootL2_10002127 | |||
| 347 | Ga0055526_1003222 | |||
| 348 | Ga0055526_1009286 | |||
| 349 | Ga0055526_1012432 | |||
| 350 | Ga0055537_1000213 | |||
| 351 | Ga0055537_1000945 | |||
| 352 | Ga0055524_1005291 | |||
| 353 | Ga0055536_1000733 | |||
| 354 | Ga0055536_1001078 | |||
| 355 | Ga0055536_1001700 | |||
| 356 | Ga0055536_1003006 | |||
| 357 | Ga0055536_1004517 | |||
| 358 | Ga0055534_1000126 | |||
| 359 | Ga0055528_1000282 | |||
| 360 | Ga0055530_10000164 | |||
| 361 | Ga0055531_10003207 | |||
| 362 | Ga0055531_10005994 | |||
| 363 | Ga0055531_10006379 | |||
| 364 | Ga0055531_10008566 | |||
| 365 | Ga0055531_10019017 | |||
| 366 | Ga0058692_1000013 | |||
| 367 | Ga0055543_1001394 | |||
| 368 | Ga0065165_1000101 | |||
| 369 | Ga0065165_1000653 | |||
| 370 | Ga0065165_1001443 | |||
| 371 | Ga0065704_10079341 | |||
| 372 | Ga0065704_10135378 | |||
| 373 | Ga0070670_100001410 | |||
| 374 | Ga0070668_100010506 | |||
| 375 | Ga0070668_100040704 | |||
| 376 | Ga0070674_100000262 | |||
| 377 | Ga0070678_100000992 | |||
| 378 | Ga0070662_100000531 | |||
| 379 | Ga0068855_100053364 | |||
| 380 | Ga0068855_100133049 | |||
| 381 | Ga0068854_100024170 | |||
| 382 | Ga0081539_10012710 | |||
| 383 | Ga0081539_10015234 | |||
| 384 | Ga0081539_10067588 | |||
| 385 | Ga0099823_1000575 | |||
| 386 | Ga0105251_10000126 | |||
| 387 | Ga0105251_10002345 | |||
| 388 | Ga0105244_10016356 | |||
| 389 | Ga0105243_10003632 | |||
| 390 | Ga0105243_10011442 | |||
| 391 | Ga0105242_10006283 | |||
| 392 | Ga0105237_10026434 | |||
| 393 | Ga0105239_10109051 | |||
| 394 | Ga0157319_1000008 | |||
| 395 | Ga0157371_10011336 | |||
| 396 | Ga0157370_10001042 | |||
| 397 | Ga0157369_10013587 | |||
| 398 | Ga0157369_10015682 | |||
| 399 | Ga0157372_10024150 | |||
| 400 | Ga0157380_10070452 | |||
| 401 | Ga0182005_1000173 | |||
| 402 | Ga0182005_1006246 | |||
| 403 | Ga0209674_101897 | |||
| 404 | Ga0209437_100727 | |||
| 405 | Ga0207425_1000045 | |||
| 406 | Ga0209129_1000202 | |||
| 407 | Ga0209565_1000059 | |||
| 408 | Ga0209565_1000060 | |||
| 409 | Ga0209565_1000457 | |||
| 410 | Ga0209673_1000047 | |||
| 411 | Ga0209673_1005052 | |||
| 412 | Ga0209673_1013613 | |||
| 413 | Ga0209673_1020513 | |||
| 414 | Ga0209130_1009224 | |||
| 415 | Ga0209675_1000016 | |||
| 416 | Ga0209675_1000183 | |||
| 417 | Ga0209676_1000035 | |||
| 418 | Ga0209676_1000037 | |||
| 419 | Ga0209676_1000234 | |||
| 420 | Ga0209676_1000384 | |||
| 421 | Ga0209676_1000475 | |||
| 422 | Ga0209676_1006150 | |||
| 423 | Ga0209676_1020477 | |||
| 424 | Ga0209025_1000013 | |||
| 425 | Ga0209564_1000008 | |||
| 426 | Ga0209564_1001657 | |||
| 427 | Ga0209564_1002728 | |||
| 428 | Ga0209564_1003879 | |||
| 429 | Ga0209564_1010226 | |||
| 430 | Ga0209758_1000014 | |||
| 431 | Ga0209050_1000132 | |||
| 432 | Ga0209050_1000146 | |||
| 433 | Ga0209050_1000472 | |||
| 434 | Ga0209050_1000901 | |||
| 435 | Ga0209050_1005506 | |||
| 436 | Ga0209050_1014975 | |||
| 437 | Ga0209256_1001049 | |||
| 438 | Ga0207426_1021572 | |||
| 439 | Ga0209051_1021789 | |||
| 440 | Ga0209257_1000176 | |||
| 441 | Ga0209257_1000240 | |||
| 442 | Ga0209257_1000536 | |||
| 443 | Ga0209257_1003818 | |||
| 444 | Ga0209257_1004286 | |||
| 445 | Ga0209257_1007255 | |||
| 446 | Ga0209257_1008221 | |||
| 447 | Ga0207655_1004432 | |||
| 448 | Ga0207655_1004629 | |||
| 449 | Ga0207655_1032813 | |||
| 450 | Ga0207713_1000773 | |||
| 451 | Ga0207713_1007271 | |||
| 452 | Ga0207647_10000007 | |||
| 453 | Ga0207647_10001365 | |||
| 454 | Ga0207671_10007318 | |||
| 455 | Ga0207681_10005718 | |||
| 456 | Ga0207650_10004980 | |||
| 457 | Ga0207706_10002418 | |||
| 458 | Ga0207686_10002760 | |||
| 459 | Ga0207709_10001044 | |||
| 460 | Ga0207669_10000048 | |||
| 461 | Ga0207667_10009285 | |||
| 462 | Ga0207668_10041494 | |||
| 463 | Ga0207668_10098537 | |||
| 464 | Ga0207640_10043097 | |||
| 465 | Ga0207640_10122362 | |||
| 466 | Ga0207674_10022381 | |||
| 467 | Ga0207683_10000619 | |||
| 468 | Ga0207683_10232704 | |||
| 469 | Ga0209389_1009789 | |||
| 470 | Ga0209371_1000007 | |||
| 471 | Ga0307515_10085966 | |||
| 472 | Ga0268256_1000008 | |||
| 473 | Ga0268256_1015643 | |||
| 474 | Ga0316183_1173556 | |||
| 475 | Ga0307513_10012062 | |||
| 476 | Ga0307413_10003565 | |||
| 477 | Ga0307413_10067912 | |||
| 478 | Ga0307413_10130107 | |||
| 479 | Ga0307410_10003865 | |||
| 480 | Ga0307407_10007535 | |||
| 481 | Ga0307412_10003457 | |||
| 482 | Ga0307416_100011816 | |||
| 483 | Ga0307414_10001115 | |||
| 484 | Ga0307414_10012354 | |||
| 485 | Ga0307414_10022064 | |||
| 486 | Ga0307414_10140503 | |||
| 487 | Ga0307411_10003646 | |||
| 488 | Ga0307411_10095118 | |||
| 489 | Ga0307415_100003165 | |||
| 490 | Ga0395899_0067685 | |||
| 491 | Ga0395905_0000372 | |||
| 492 | Ga0395901_0001674 | |||
| 493 | Ga0237819_05278 | |||
| 494 | Ga0495617_000176 | |||
| 495 | Ga0495638_0000139 | |||
| 496 | Ga0495584_0026682 | |||
| 497 | Ga0495585_0000112 | |||
| 498 | Ga0495607_0000067 | |||
| 499 | Ga0495607_0000119 | |||
| 500 | Ga0495607_0002423 | |||
| 501 | Ga0495607_0014247 | |||
| 502 | Ga0495583_0021924 | |||
| 503 | Ga0495606_0034729 | |||
| 504 | Ga0495606_0050614 | |||
| 505 | Ga0495616_0008743 | |||
| 506 | Ga0495631_0000124 | |||
| 507 | Ga0495631_0000847 | |||
| 508 | Ga0495632_0037681 | |||
| 509 | Ga0495643_0001568 | |||
| 510 | Ga0495643_0002296 | |||
| 511 | Ga0495648_0000331 | |||
| 512 | Ga0495609_0002642 | |||
| 513 | Ga0495668_0000053 | |||
| 514 | Ga0495611_0000002 | |||
| 515 | Ga0495625_0000002 | |||
| 516 | Ga0495625_0000351 | |||
| 517 | Ga0495625_0064312 | |||
| 518 | Ga0495661_0000700 | |||
| 519 | Ga0495670_0000006 | |||
| 520 | Ga0495670_0001387 | |||
| 521 | Ga0495671_0000220 | |||
| 522 | Ga0495589_0000067 | |||
| 523 | Ga0495660_0000432 | |||
| 524 | Ga0495672_0000087 | |||
| 525 | Ga0495677_0001298 | |||
| 526 | Ga0495679_000003 | |||
| 527 | Ga0495673_0008404 | |||
| 528 | Ga0495686_0000522 | |||
| 529 | Ga0495686_0013963 | |||
| 530 | Ga0496116_0104653 | |||
| 531 | Ga0496117_0000368 | |||
| 532 | Ga0496117_0018500 | |||
| 533 | Ga0496118_0002837 | |||
| 534 | Ga0496118_0002870 | |||
| 535 | Ga0496118_0068654 | |||
| 536 | Ga0496119_0000779 | |||
| 537 | Ga0496120_0000458 | |||
| 538 | Ga0496121_0000075 | |||
| 539 | Ga0496122_0000896 | |||
| 540 | Ga0496122_0000990 | |||
| 541 | Ga0496122_0009852 | |||
| 542 | Ga0496123_0000097 | |||
| 543 | Ga0496123_0000137 | |||
| 544 | Ga0496124_0000115 | |||
| 545 | Ga0496124_0000343 | |||
| 546 | Ga0496124_0000725 | |||
| 547 | Ga0496124_0002387 | |||
| 548 | Ga0496124_0088494 | |||
| 549 | Ga0496124_0146608 | |||
| 550 | Ga0496125_0019893 | |||
| 551 | Ga0496125_0072016 | |||
| 552 | Ga0496125_0131103 | |||
| 553 | Ga0496126_0082866 | |||
| 554 | Ga0495678_000026 | |||
| 555 | Ga0495682_0001649 | |||
| 556 | Ga0501031_0016117 | |||
| 557 | Ga0501031_0067966 | |||
| 558 | Ga0501032_0035931 | |||
| 559 | Ga0501032_0048235 | |||
| 560 | Ga0501033_0009947 | |||
| 561 | Ga0501034_0002864 | |||
| 562 | Ga0501034_0025292 | |||
| 563 | Ga0501036_0074327 | |||
| 564 | Ga0501037_0058384 | |||
| 565 | Ga0501038_0012954 | |||
| 566 | Ga0501038_0090158 | |||
| 567 | Ga0501039_0020871 | |||
| 568 | Ga0501046_0135045 | |||
| 569 | Ga0501047_0002891 | |||
| 570 | Ga0501070_0036328 | |||
| 571 | Ga0501035_0015360 | |||
| 572 | Ga0501044_0011336 | |||
| 573 | Ga0501044_0037198 | |||
| 574 | Ga0500643_000031 | |||
| 575 | Ga0500643_001241 | |||
| 576 | Ga0500643_004843 | |||
| 577 | Ga0500566_0000203 | |||
| 578 | Ga0500595_007345 | |||
| 579 | Ga0500658_0030181 | |||
| 580 | Ga0500559_0020035 | |||
| 581 | Ga0500568_0002683 | |||
| 582 | Ga0500627_0000035 | |||
| 583 | Ga0500627_0000196 | |||
| 584 | Ga0500645_000212 | |||
| 585 | Ga0500596_003063 | |||
| 586 | Ga0501082_0000866 | |||
| 587 | 2548501488 | |||
| 588 | 2578457067 | |||
| 589 | 2585261490 | |||
| 590 | 2595446667 | |||
| 591 | 2596375207 | |||
| 592 | 2600228853 | |||
| 593 | 2643835260 | |||
| 594 | 2643907715 | |||
| 595 | 2643914012 | |||
| 596 | 2643994391 | |||
| 597 | 2644040237 | |||
| 598 | 2644056186 | |||
| 599 | 2644061414 | |||
| 600 | 2644074945 | |||
| 601 | 2644295227 | |||
| 602 | 2644648963 | |||
| 603 | 2735834473 | |||
| 604 | 2738745160 | |||
| 605 | 2739243110 | |||
| 606 | 2739354390 | |||
| 607 | 2747949183 | |||
| 608 | 2748018548 | |||
| 609 | 2765580432 | |||
| 610 | 2793062618 | |||
| 611 | 2816473682 | |||
| 612 | 2816518534 | |||
| 613 | 2819563697 | |||
| 614 | 2819661216 | |||
| 615 | 2819714689 | |||
| 616 | 2831869173 | |||
| 617 | 2839138344 | |||
| 618 | 2842394358 | |||
| 619 | 2842702115 | |||
| 620 | 2842759055 | |||
| 621 | 2842782915 | |||
| 622 | 2842917987 | |||
| 623 | 2852652201 | |||
| 624 | 2852654774 | |||
| 625 | 2852684446 | |||
| 626 | 2852687082 | |||
| 627 | 2857445653 | |||
| 628 | 2874223105 | |||
| 629 | 2879166940 | |||
| 630 | 2885430687 | |||
| 631 | 2886849333 | |||
| 632 | 2894414345 | |||
| 633 | 2898716470 | |||
| 634 | 2904463992 | |||
| 635 | 2904480131 | |||
| 636 | 2919087670 | |||
| 637 | 2919092534 | |||
| 638 | 2919131140 | |||
| 639 | 2919137301 | |||
| 640 | 2919405476 | |||
| 641 | 2919514276 | |||
| 642 | 2928027482 | |||
| 643 | 2928126584 | |||
| 644 | 2928499002 | |||
| 645 | 2928517942 | |||
| 646 | 2928529195 | |||
| 647 | 2928968736 | |||
| 648 | 2929196381 | |||
| 649 | 2931383444 | |||
| 650 | 2932423083 | |||
| 651 | 2937614432 | |||
| 652 | 2939589733 | |||
| 653 | 2939624184 | |||
| 654 | 2939630185 | |||
| 655 | 2941474846 | |||
| 656 | 2941478827 | |||
| 657 | 2961049870 | |||
| 658 | 2961064969 | |||
| 659 | 2974307712 | |||
| 660 | 2974321038 | |||
| 661 | 2977248432 | |||
| 662 | 2984517084 | |||
| 663 | 2984558217 | |||
| 664 | 2984567404 | |||
| 665 | 2987608712 | |||
| 666 | 2990715315 | |||
| 667 | 2993358469 | |||
| 668 | 3000867708 | |||
| 669 | 3003670873 | |||
| 670 | 8001848610 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2nwl-assembly1.cif.gz_C | crystal structure of gltph in complex with l-asp | 0.865 | 19 | 410 |
| 1xfh-assembly1.cif.gz_A | structure of glutamate transporter homolog from pyrococcus horikoshii | 0.8639 | 18 | 409 |
| 2nwl-assembly1.cif.gz_A | crystal structure of gltph in complex with l-asp | 0.8615 | 19 | 410 |
| 7bct-assembly1.cif.gz_A | asct2 in the presence of the inhibitor era-21 in the outward-open conformation. | 0.8614 | 18 | 412 |
| 6uwf-assembly1.cif.gz_A | gltph in complex with l-aspartate and sodium ions in outward-facing state | 0.8591 | 18 | 410 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A830_1_408_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.9632 | 12 | 415 | 1.10.3860.10 |
| af_P0A830_1_408_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.9518 | 12 | 415 | 1.10.3860.10 |
| af_P71906_20_424_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.9481 | 18 | 415 | 1.10.3860.10 |
| af_P21345_1_417_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.9369 | 14 | 416 | 1.10.3860.10 |
| af_P71906_20_424_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.93 | 18 | 415 | 1.10.3860.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258BB26-F1-model_v4 | C4-dicarboxylate transporter DctA | 0.9805 | 227 | 424 |
GO:0005886
GO:0015138 GO:0015141 GO:0015366 GO:0070778 |
| AF-A0A4Y3J673-F1-model_v4 | C4-dicarboxylate ABC transporter | 0.9791 | 57 | 426 |
GO:0005886
GO:0015138 GO:0015141 GO:0015366 GO:0070778 |
| AF-A0A5Q0RUQ4-F1-model_v4 | deleted | 0.9783 | 16 | 426 |
|
| AF-A0A7Y8BIS1-F1-model_v4 | Dicarboxylate/amino acid:cation symporter | 0.9767 | 15 | 424 |
GO:0005886
GO:0015138 GO:0015141 GO:0015366 GO:0070778 |
| AF-N8RC33-F1-model_v4 | C4-dicarboxylate transporter DctA | 0.9764 | 18 | 426 |
GO:0005886
GO:0015138 GO:0015141 GO:0015366 GO:0070778 |