F412307

General Info

Members Datasets Scaffolds Average Seq Length
335 240 670 443

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10076125|Ga0307414_100761251
Length 420
Sequence VATIDKAGVVRKPLYRTLYGQVLVAIFGGALLGHFLPETGIALKPLGDGFVSLVKMIIAPVIFVTVATGIAGMRDTSAVGSVAFKAXSYFLFFSTLALVIGLVVGNLVQPGVGLNIDPATLDAKAVANYAASAEEQSITGFLLAIIPITLFSSVTSGSILQTLMVAILVGVAIALTRPRSDLMQDILVSFGEVVFKLVHMLMKLAPIGAFGAIAFTIGQFGIGTLANIRYLKEELILVLGTSSSEAALPNLMEKLEVAGCRRSVVGLVVPTGYSFNLDGTNIYMTLASLFIAQAVGINLSMGEQLALVLIAMISSKGAAGVTGAGFVILAATLSVIPSVPVAGMALILGVDRFMSECRALTNFVGNAVATIVVAKWEGALDRDRLAAAMAGQPIPLPEADSELHERHDLAVPAPSQEALS

Samples

Sample ID Description Type Environment
1 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
33 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
46 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
48 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
49 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
50 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
79 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
82 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
95 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
98 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
99 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
100 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
103 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
104 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
105 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
106 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
107 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
108 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
109 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
112 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
113 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
114 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
115 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
118 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
119 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
122 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
123 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
124 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
125 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
128 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
129 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
130 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
131 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
132 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
133 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
148 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
149 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
150 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
151 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
152 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
153 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
154 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
155 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 2547132374 Acidovorax radicis N35 Isolate Unclassified
158 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
159 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
160 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
161 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
162 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
163 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
164 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
165 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
166 2643221596 Acidovorax sp. Root70 Isolate Unclassified
167 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
168 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
169 2643221609 Acidovorax sp. Root217 Isolate Unclassified
170 2643221611 Acidovorax sp. Root219 Isolate Unclassified
171 2643221652 Acidovorax sp. Root402 Isolate Unclassified
172 2643221717 Acidovorax sp. Root267 Isolate Unclassified
173 2734482264 Dyella sp. AD052 Isolate Unclassified
174 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
175 2738543012 Acidovorax sp. CF301 Isolate Unclassified
176 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
177 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
178 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
179 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
180 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
181 2816332133 Acidovorax radicis 2721A Isolate Unclassified
182 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
183 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
184 2818991457 Xanthomonas translucens 569 Isolate Unclassified
185 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
186 2831864461 Roseateles noduli HZ7 Isolate Nodule
187 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
188 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
189 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
190 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
191 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
192 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
193 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
194 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
195 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
196 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
197 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
198 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
199 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
200 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
201 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
202 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
203 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
204 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
205 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
206 2919085039 Luteibacter sp. 1214 Isolate Unclassified
207 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
208 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
209 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
210 2919404418 Luteibacter sp. 3190 Isolate Unclassified
211 2919513703 Luteimonas sp. 3794 Isolate Unclassified
212 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
213 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
214 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
215 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
216 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
217 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
218 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
219 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
220 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
221 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
222 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
223 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
224 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
225 2941471342 Luteibacter sp. 621 Isolate Unclassified
226 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
227 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
228 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
229 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
230 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
231 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
232 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
233 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
234 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
235 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
236 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
237 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
238 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
239 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
240 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 74.93
Metatranscriptomes 0
Isolates 25.07

Biome Distribution

Category Percentage (%)
Aerial Root 1.19
Bulb 0
Endosphere 24.78
Nodule 1.49
Rhizoplane 0.3
Rhizosphere 48.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307414_10076125 3300032004 Bacteria 2438
2 JGI24736J21556_1002498 3300001904 Bacteria 3252
3 JGI24739J22299_10001175 3300001989 Bacteria 9803
4 JGI24735J21928_10003388 3300002067 Bacteria 5440
5 JGI24738J21930_10000047 3300002075 Bacteria 24272
6 JGI24751J29686_10000431 3300002459 Bacteria 12979
7 JGI25152J39213_1000057 3300002773 Bacteria 75426
8 JGI25150J39212_1000174 3300002774 Bacteria 36085
9 JGI25151J46595_10000109 3300003187 Bacteria 112044
10 JGI25153J46596_10000084 3300003215 Bacteria 112044
11 rootL2_10002127 3300003322 Bacteria 10396
12 Ga0055526_1003222 3300003771 Bacteria 10519
13 Ga0055526_1009286 3300003771 Bacteria 4762
14 Ga0055526_1012432 3300003771 Bacteria 3715
15 Ga0055537_1000213 3300003773 Bacteria 42839
16 Ga0055537_1000945 3300003773 Bacteria 13476
17 Ga0055524_1005291 3300003775 Bacteria 5793
18 Ga0055536_1000733 3300003781 Bacteria 22058
19 Ga0055536_1001078 3300003781 Bacteria 17194
20 Ga0055536_1001700 3300003781 Bacteria 13026
21 Ga0055536_1003006 3300003781 Bacteria 9234
22 Ga0055536_1004517 3300003781 Bacteria 7078
23 Ga0055534_1000126 3300003784 Bacteria 57340
24 Ga0055528_1000282 3300003790 Bacteria 43363
25 Ga0055530_10000164 3300003791 Bacteria 60316
26 Ga0055531_10003207 3300003794 Bacteria 10501
27 Ga0055531_10005994 3300003794 Bacteria 6978
28 Ga0055531_10006379 3300003794 Bacteria 6707
29 Ga0055531_10008566 3300003794 Bacteria 5368
30 Ga0055531_10019017 3300003794 Bacteria 2805
31 Ga0058692_1000013 3300003856 Bacteria 316299
32 Ga0055543_1001394 3300004625 Bacteria 9650
33 Ga0065165_1000101 3300005262 Bacteria 141486
34 Ga0065165_1000653 3300005262 Bacteria 50050
35 Ga0065165_1001443 3300005262 Bacteria 25758
36 Ga0065704_10079341 3300005289 Bacteria 4191
37 Ga0065704_10135378 3300005289 Bacteria 1578
38 Ga0070670_100001410 3300005331 Bacteria 19303
39 Ga0070668_100010506 3300005347 Bacteria 6881
40 Ga0070668_100040704 3300005347 Bacteria 3556
41 Ga0070674_100000262 3300005356 Bacteria 26193
42 Ga0070678_100000992 3300005456 Bacteria 14678
43 Ga0070662_100000531 3300005457 Bacteria 23047
44 Ga0068855_100053364 3300005563 Bacteria 4756
45 Ga0068855_100133049 3300005563 Bacteria 2839
46 Ga0068854_100024170 3300005578 Bacteria 4158
47 Ga0081539_10012710 3300005985 Bacteria 6445
48 Ga0081539_10015234 3300005985 Bacteria 5603
49 Ga0081539_10067588 3300005985 Bacteria 1932
50 Ga0099823_1000575 3300006944 Bacteria 25524
51 Ga0105251_10000126 3300009011 Bacteria 76832
52 Ga0105251_10002345 3300009011 Bacteria 14979
53 Ga0105244_10016356 3300009036 Bacteria 4227
54 Ga0105243_10003632 3300009148 Bacteria 12417
55 Ga0105243_10011442 3300009148 Bacteria 6713
56 Ga0105242_10006283 3300009176 Bacteria 9155
57 Ga0105237_10026434 3300009545 Bacteria 5932
58 Ga0105239_10109051 3300010375 Bacteria 3067
59 Ga0157319_1000008 3300012497 Bacteria 315600
60 Ga0157371_10011336 3300013102 Bacteria 6877
61 Ga0157370_10001042 3300013104 Bacteria 34875
62 Ga0157369_10013587 3300013105 Bacteria 9207
63 Ga0157369_10015682 3300013105 Bacteria 8539
64 Ga0157372_10024150 3300013307 Bacteria 6598
65 Ga0157380_10070452 3300014326 Bacteria 2825
66 Ga0182005_1000173 3300015265 Bacteria 44701
67 Ga0182005_1006246 3300015265 Bacteria 3658
68 Ga0209674_101897 3300025226 Bacteria 4930
69 Ga0209437_100727 3300025233 Bacteria 16722
70 Ga0207425_1000045 3300025245 Bacteria 194257
71 Ga0209129_1000202 3300025258 Bacteria 72795
72 Ga0209565_1000059 3300025263 Bacteria 189658
73 Ga0209565_1000060 3300025263 Bacteria 188543
74 Ga0209565_1000457 3300025263 Bacteria 31431
75 Ga0209673_1000047 3300025273 Bacteria 289276
76 Ga0209673_1005052 3300025273 Bacteria 6797
77 Ga0209673_1013613 3300025273 Bacteria 3199
78 Ga0209673_1020513 3300025273 Bacteria 2338
79 Ga0209130_1009224 3300025284 Bacteria 2834
80 Ga0209675_1000016 3300025291 Bacteria 391965
81 Ga0209675_1000183 3300025291 Bacteria 70391
82 Ga0209676_1000035 3300025292 Bacteria 459284
83 Ga0209676_1000037 3300025292 Bacteria 457562
84 Ga0209676_1000234 3300025292 Bacteria 119888
85 Ga0209676_1000384 3300025292 Bacteria 81053
86 Ga0209676_1000475 3300025292 Bacteria 66299
87 Ga0209676_1006150 3300025292 Bacteria 6019
88 Ga0209676_1020477 3300025292 Bacteria 2246
89 Ga0209025_1000013 3300025294 Bacteria 871757
90 Ga0209564_1000008 3300025295 Bacteria 953227
91 Ga0209564_1001657 3300025295 Bacteria 21411
92 Ga0209564_1002728 3300025295 Bacteria 13301
93 Ga0209564_1003879 3300025295 Bacteria 9616
94 Ga0209564_1010226 3300025295 Bacteria 4352
95 Ga0209758_1000014 3300025297 Bacteria 871757
96 Ga0209050_1000132 3300025298 Bacteria 185906
97 Ga0209050_1000146 3300025298 Bacteria 166930
98 Ga0209050_1000472 3300025298 Bacteria 71438
99 Ga0209050_1000901 3300025298 Bacteria 39362
100 Ga0209050_1005506 3300025298 Bacteria 7917
101 Ga0209050_1014975 3300025298 Bacteria 3295
102 Ga0209256_1001049 3300025299 Bacteria 32147
103 Ga0207426_1021572 3300025302 Bacteria 2226
104 Ga0209051_1021789 3300025303 Bacteria 2715
105 Ga0209257_1000176 3300025304 Bacteria 161436
106 Ga0209257_1000240 3300025304 Bacteria 128014
107 Ga0209257_1000536 3300025304 Bacteria 65942
108 Ga0209257_1003818 3300025304 Bacteria 12357
109 Ga0209257_1004286 3300025304 Bacteria 11239
110 Ga0209257_1007255 3300025304 Bacteria 6773
111 Ga0209257_1008221 3300025304 Bacteria 6019
112 Ga0207655_1004432 3300025728 Bacteria 9957
113 Ga0207655_1004629 3300025728 Bacteria 9661
114 Ga0207655_1032813 3300025728 Bacteria 2366
115 Ga0207713_1000773 3300025735 Bacteria 29536
116 Ga0207713_1007271 3300025735 Bacteria 6568
117 Ga0207647_10000007 3300025904 Bacteria 209754
118 Ga0207647_10001365 3300025904 Bacteria 18758
119 Ga0207671_10007318 3300025914 Bacteria 9588
120 Ga0207681_10005718 3300025923 Bacteria 7630
121 Ga0207650_10004980 3300025925 Bacteria 9076
122 Ga0207706_10002418 3300025933 Bacteria 18218
123 Ga0207686_10002760 3300025934 Bacteria 9514
124 Ga0207709_10001044 3300025935 Bacteria 20448
125 Ga0207669_10000048 3300025937 Bacteria 60914
126 Ga0207667_10009285 3300025949 Bacteria 11604
127 Ga0207668_10041494 3300025972 Bacteria 3111
128 Ga0207668_10098537 3300025972 Bacteria 2166
129 Ga0207640_10043097 3300025981 Bacteria 2882
130 Ga0207640_10122362 3300025981 Bacteria 1867
131 Ga0207674_10022381 3300026116 Bacteria 6787
132 Ga0207683_10000619 3300026121 Bacteria 32637
133 Ga0207683_10232704 3300026121 Bacteria 1681
134 Ga0209389_1009789 3300027296 Bacteria 8607
135 Ga0209371_1000007 3300027312 Bacteria 1050654
136 Ga0307515_10085966 3300028794 Bacteria 4017
137 Ga0268256_1000008 3300030500 Bacteria 1050654
138 Ga0268256_1015643 3300030500 Bacteria 2206
139 Ga0316183_1173556 3300030742 Bacteria 6174
140 Ga0307513_10012062 3300031456 Bacteria 10688
141 Ga0307413_10003565 3300031824 Bacteria 6584
142 Ga0307413_10067912 3300031824 Bacteria 2231
143 Ga0307413_10130107 3300031824 Bacteria 1721
144 Ga0307410_10003865 3300031852 Bacteria 7617
145 Ga0307407_10007535 3300031903 Bacteria 4935
146 Ga0307412_10003457 3300031911 Bacteria 8782
147 Ga0307416_100011816 3300032002 Bacteria 5850
148 Ga0307414_10001115 3300032004 Bacteria 13723
149 Ga0307414_10012354 3300032004 Bacteria 5046
150 Ga0307414_10022064 3300032004 Bacteria 4008
151 Ga0307414_10140503 3300032004 Bacteria 1890
152 Ga0307411_10003646 3300032005 Bacteria 7200
153 Ga0307411_10095118 3300032005 Bacteria 2091
154 Ga0307415_100003165 3300032126 Bacteria 8343
155 Ga0395899_0067685 3300037312 Bacteria 2620
156 Ga0395905_0000372 3300037471 Bacteria 63933
157 Ga0395901_0001674 3300038443 Bacteria 22881
158 Ga0237819_05278 3300038705 Bacteria 2041
159 Ga0495617_000176 3300046452 Bacteria 40516
160 Ga0495638_0000139 3300046460 Bacteria 114810
161 Ga0495584_0026682 3300046491 Bacteria 2927
162 Ga0495585_0000112 3300046492 Bacteria 87291
163 Ga0495607_0000067 3300046501 Bacteria 102663
164 Ga0495607_0000119 3300046501 Bacteria 82732
165 Ga0495607_0002423 3300046501 Bacteria 15227
166 Ga0495607_0014247 3300046501 Bacteria 5184
167 Ga0495583_0021924 3300046506 Bacteria 3273
168 Ga0495606_0034729 3300046507 Bacteria 3457
169 Ga0495606_0050614 3300046507 Bacteria 2716
170 Ga0495616_0008743 3300046513 Bacteria 5967
171 Ga0495631_0000124 3300046518 Bacteria 51693
172 Ga0495631_0000847 3300046518 Bacteria 19421
173 Ga0495632_0037681 3300046519 Bacteria 2452
174 Ga0495643_0001568 3300046522 Bacteria 20340
175 Ga0495643_0002296 3300046522 Bacteria 15441
176 Ga0495648_0000331 3300046524 Bacteria 52275
177 Ga0495609_0002642 3300046538 Bacteria 10869
178 Ga0495668_0000053 3300046616 Bacteria 209976
179 Ga0495611_0000002 3300046648 Bacteria 705677
180 Ga0495625_0000002 3300046660 Bacteria 813323
181 Ga0495625_0000351 3300046660 Bacteria 70408
182 Ga0495625_0064312 3300046660 Bacteria 2587
183 Ga0495661_0000700 3300046665 Bacteria 33318
184 Ga0495670_0000006 3300046691 Bacteria 255322
185 Ga0495670_0001387 3300046691 Bacteria 11844
186 Ga0495671_0000220 3300046692 Bacteria 49354
187 Ga0495589_0000067 3300046794 Bacteria 99395
188 Ga0495660_0000432 3300046810 Bacteria 35230
189 Ga0495672_0000087 3300047320 Bacteria 154275
190 Ga0495677_0001298 3300047445 Bacteria 9983
191 Ga0495679_000003 3300047446 Bacteria 787868
192 Ga0495673_0008404 3300047469 Bacteria 5817
193 Ga0495686_0000522 3300047472 Bacteria 55463
194 Ga0495686_0013963 3300047472 Bacteria 5553
195 Ga0496116_0104653 3300048919 Bacteria 1681
196 Ga0496117_0000368 3300048920 Bacteria 78448
197 Ga0496117_0018500 3300048920 Bacteria 5765
198 Ga0496118_0002837 3300048921 Bacteria 22651
199 Ga0496118_0002870 3300048921 Bacteria 22495
200 Ga0496118_0068654 3300048921 Bacteria 2573
201 Ga0496119_0000779 3300048922 Bacteria 42634
202 Ga0496120_0000458 3300048923 Bacteria 64377
203 Ga0496121_0000075 3300048924 Bacteria 240437
204 Ga0496122_0000896 3300048925 Bacteria 55027
205 Ga0496122_0000990 3300048925 Bacteria 50743
206 Ga0496122_0009852 3300048925 Bacteria 9963
207 Ga0496123_0000097 3300048926 Bacteria 173894
208 Ga0496123_0000137 3300048926 Bacteria 152169
209 Ga0496124_0000115 3300048927 Bacteria 164929
210 Ga0496124_0000343 3300048927 Bacteria 85220
211 Ga0496124_0000725 3300048927 Bacteria 54102
212 Ga0496124_0002387 3300048927 Bacteria 24716
213 Ga0496124_0088494 3300048927 Bacteria 2531
214 Ga0496124_0146608 3300048927 Bacteria 1856
215 Ga0496125_0019893 3300048928 Bacteria 6314
216 Ga0496125_0072016 3300048928 Bacteria 2696
217 Ga0496125_0131103 3300048928 Bacteria 1764
218 Ga0496126_0082866 3300048929 Bacteria 2832
219 Ga0495678_000026 3300049459 Bacteria 226978
220 Ga0495682_0001649 3300049460 Bacteria 11491
221 Ga0501031_0016117 3300049568 Bacteria 4853
222 Ga0501031_0067966 3300049568 Bacteria 2321
223 Ga0501032_0035931 3300049569 Bacteria 3384
224 Ga0501032_0048235 3300049569 Bacteria 2875
225 Ga0501033_0009947 3300049570 Bacteria 7301
226 Ga0501034_0002864 3300049571 Bacteria 20079
227 Ga0501034_0025292 3300049571 Bacteria 6043
228 Ga0501036_0074327 3300049572 Bacteria 2874
229 Ga0501037_0058384 3300049573 Bacteria 2816
230 Ga0501038_0012954 3300049574 Bacteria 7608
231 Ga0501038_0090158 3300049574 Bacteria 2570
232 Ga0501039_0020871 3300049575 Bacteria 5021
233 Ga0501046_0135045 3300049580 Bacteria 1869
234 Ga0501047_0002891 3300049581 Bacteria 16289
235 Ga0501070_0036328 3300049586 Bacteria 4115
236 Ga0501035_0015360 3300049822 Bacteria 7066
237 Ga0501044_0011336 3300049823 Bacteria 9658
238 Ga0501044_0037198 3300049823 Bacteria 5088
239 Ga0500643_000031 3300053087 Bacteria 204488
240 Ga0500643_001241 3300053087 Bacteria 15107
241 Ga0500643_004843 3300053087 Bacteria 5944
242 Ga0500566_0000203 3300053094 Bacteria 31188
243 Ga0500595_007345 3300053119 Bacteria 4576
244 Ga0500658_0030181 3300053134 Bacteria 2113
245 Ga0500559_0020035 3300053136 Bacteria 2827
246 Ga0500568_0002683 3300053139 Bacteria 10316
247 Ga0500627_0000035 3300053158 Bacteria 80123
248 Ga0500627_0000196 3300053158 Bacteria 17442
249 Ga0500645_000212 3300053730 Bacteria 44287
250 Ga0500596_003063 3300053735 Bacteria 3215
251 Ga0501082_0000866 3300060353 Bacteria 26762
252 2548501488 2547132374 Bacteria 5530232
253 2578457067 2576861471 Bacteria 4648976
254 2585261490 2582581305 Bacteria 4895574
255 2595446667 2593339238 Bacteria 4182970
256 2596375207 2595698237 Bacteria 6712432
257 2600228853 2599185359 Bacteria 4772316
258 2643835260 2643221563 Bacteria 4726935
259 2643907715 2643221579 Bacteria 4443405
260 2643914012 2643221581 Bacteria 3893603
261 2643994391 2643221596 Bacteria 5006805
262 2644040237 2643221605 Bacteria 4772303
263 2644056186 2643221608 Bacteria 4724829
264 2644061414 2643221609 Bacteria 6756331
265 2644074945 2643221611 Bacteria 6820941
266 2644295227 2643221652 Bacteria 5140275
267 2644648963 2643221717 Bacteria 5676132
268 2735834473 2734482264 Unclassified 5014763
269 2738745160 2738541281 Bacteria 5112672
270 2739243110 2738543012 Bacteria 7115078
271 2739354390 2738543032 Bacteria 5115625
272 2747949183 2747842428 Bacteria 4689383
273 2748018548 2747842501 Bacteria 5293829
274 2765580432 2765235840 Bacteria 4663337
275 2793062618 2791355196 Bacteria 7323613
276 2816473682 2816332133 Bacteria 7249298
277 2816518534 2816332141 Bacteria 4436036
278 2819563697 2818991440 Bacteria 4774720
279 2819661216 2818991457 Bacteria 5323295
280 2819714689 2818991466 Bacteria 4748179
281 2831869173 2831864461 Bacteria 6502356
282 2839138344 2839138175 Bacteria 6549354
283 2842394358 2842391507 Bacteria 4486072
284 2842702115 2842698319 Bacteria 5190321
285 2842759055 2842757796 Bacteria 3981385
286 2842782915 2842780639 Bacteria 4337790
287 2842917987 2842914999 Bacteria 4419378
288 2852652201 2852649853 Bacteria 4036942
289 2852654774 2852653556 Bacteria 4050083
290 2852684446 2852680915 Bacteria 4100189
291 2852687082 2852684882 Bacteria 5463342
292 2857445653 2857442823 Bacteria 4562550
293 2874223105 2874220319 Bacteria 4594709
294 2879166940 2879163058 Bacteria 4223965
295 2885430687 2885429604 Bacteria 3642894
296 2886849333 2886848708 Bacteria 5632523
297 2894414345 2894414249 Bacteria 4405451
298 2898716470 2898713307 Bacteria 4110805
299 2904463992 2904463128 Bacteria 4775606
300 2904480131 2904479285 Bacteria 5073931
301 2919087670 2919085039 Bacteria 4532964
302 2919092534 2919089067 Bacteria 4560942
303 2919131140 2919130084 Bacteria 5301837
304 2919137301 2919134579 Bacteria 4480386
305 2919405476 2919404418 Bacteria 4232372
306 2919514276 2919513703 Bacteria 3844312
307 2928027482 2928027323 Bacteria 4382488
308 2928126584 2928125067 Bacteria 5937560
309 2928499002 2928496128 Bacteria 4631123
310 2928517942 2928515477 Bacteria 4448421
311 2928529195 2928526807 Bacteria 4760224
312 2928968736 2928968154 Bacteria 4633371
313 2929196381 2929195423 Bacteria 5325372
314 2931383444 2931380184 Bacteria 4455911
315 2932423083 2932422444 Bacteria 4678430
316 2937614432 2937610967 Bacteria 4618818
317 2939589733 2939589442 Bacteria 4214238
318 2939624184 2939622612 Bacteria 4698046
319 2939630185 2939626828 Bacteria 4695272
320 2941474846 2941471342 Bacteria 5018624
321 2941478827 2941475908 Bacteria 4145589
322 2961049870 2961047084 Bacteria 4594415
323 2961064969 2961064222 Bacteria 4749990
324 2974307712 2974307012 Bacteria 4172388
325 2974321038 2974320154 Bacteria 4571377
326 2977248432 2977247770 Bacteria 4160543
327 2984517084 2984514374 Bacteria 4172479
328 2984558217 2984555340 Bacteria 4247089
329 2984567404 2984564862 Bacteria 4339992
330 2987608712 2987605356 Bacteria 4187822
331 2990715315 2990710928 Bacteria 5002431
332 2993358469 2993356040 Bacteria 4247105
333 3000867708 3000865235 Bacteria 3106258
334 3003670873 3003665799 Bacteria 7279786
335 8001848610 8001845381 Bacteria 5804942
336 Ga0307414_10076125
337 JGI24736J21556_1002498
338 JGI24739J22299_10001175
339 JGI24735J21928_10003388
340 JGI24738J21930_10000047
341 JGI24751J29686_10000431
342 JGI25152J39213_1000057
343 JGI25150J39212_1000174
344 JGI25151J46595_10000109
345 JGI25153J46596_10000084
346 rootL2_10002127
347 Ga0055526_1003222
348 Ga0055526_1009286
349 Ga0055526_1012432
350 Ga0055537_1000213
351 Ga0055537_1000945
352 Ga0055524_1005291
353 Ga0055536_1000733
354 Ga0055536_1001078
355 Ga0055536_1001700
356 Ga0055536_1003006
357 Ga0055536_1004517
358 Ga0055534_1000126
359 Ga0055528_1000282
360 Ga0055530_10000164
361 Ga0055531_10003207
362 Ga0055531_10005994
363 Ga0055531_10006379
364 Ga0055531_10008566
365 Ga0055531_10019017
366 Ga0058692_1000013
367 Ga0055543_1001394
368 Ga0065165_1000101
369 Ga0065165_1000653
370 Ga0065165_1001443
371 Ga0065704_10079341
372 Ga0065704_10135378
373 Ga0070670_100001410
374 Ga0070668_100010506
375 Ga0070668_100040704
376 Ga0070674_100000262
377 Ga0070678_100000992
378 Ga0070662_100000531
379 Ga0068855_100053364
380 Ga0068855_100133049
381 Ga0068854_100024170
382 Ga0081539_10012710
383 Ga0081539_10015234
384 Ga0081539_10067588
385 Ga0099823_1000575
386 Ga0105251_10000126
387 Ga0105251_10002345
388 Ga0105244_10016356
389 Ga0105243_10003632
390 Ga0105243_10011442
391 Ga0105242_10006283
392 Ga0105237_10026434
393 Ga0105239_10109051
394 Ga0157319_1000008
395 Ga0157371_10011336
396 Ga0157370_10001042
397 Ga0157369_10013587
398 Ga0157369_10015682
399 Ga0157372_10024150
400 Ga0157380_10070452
401 Ga0182005_1000173
402 Ga0182005_1006246
403 Ga0209674_101897
404 Ga0209437_100727
405 Ga0207425_1000045
406 Ga0209129_1000202
407 Ga0209565_1000059
408 Ga0209565_1000060
409 Ga0209565_1000457
410 Ga0209673_1000047
411 Ga0209673_1005052
412 Ga0209673_1013613
413 Ga0209673_1020513
414 Ga0209130_1009224
415 Ga0209675_1000016
416 Ga0209675_1000183
417 Ga0209676_1000035
418 Ga0209676_1000037
419 Ga0209676_1000234
420 Ga0209676_1000384
421 Ga0209676_1000475
422 Ga0209676_1006150
423 Ga0209676_1020477
424 Ga0209025_1000013
425 Ga0209564_1000008
426 Ga0209564_1001657
427 Ga0209564_1002728
428 Ga0209564_1003879
429 Ga0209564_1010226
430 Ga0209758_1000014
431 Ga0209050_1000132
432 Ga0209050_1000146
433 Ga0209050_1000472
434 Ga0209050_1000901
435 Ga0209050_1005506
436 Ga0209050_1014975
437 Ga0209256_1001049
438 Ga0207426_1021572
439 Ga0209051_1021789
440 Ga0209257_1000176
441 Ga0209257_1000240
442 Ga0209257_1000536
443 Ga0209257_1003818
444 Ga0209257_1004286
445 Ga0209257_1007255
446 Ga0209257_1008221
447 Ga0207655_1004432
448 Ga0207655_1004629
449 Ga0207655_1032813
450 Ga0207713_1000773
451 Ga0207713_1007271
452 Ga0207647_10000007
453 Ga0207647_10001365
454 Ga0207671_10007318
455 Ga0207681_10005718
456 Ga0207650_10004980
457 Ga0207706_10002418
458 Ga0207686_10002760
459 Ga0207709_10001044
460 Ga0207669_10000048
461 Ga0207667_10009285
462 Ga0207668_10041494
463 Ga0207668_10098537
464 Ga0207640_10043097
465 Ga0207640_10122362
466 Ga0207674_10022381
467 Ga0207683_10000619
468 Ga0207683_10232704
469 Ga0209389_1009789
470 Ga0209371_1000007
471 Ga0307515_10085966
472 Ga0268256_1000008
473 Ga0268256_1015643
474 Ga0316183_1173556
475 Ga0307513_10012062
476 Ga0307413_10003565
477 Ga0307413_10067912
478 Ga0307413_10130107
479 Ga0307410_10003865
480 Ga0307407_10007535
481 Ga0307412_10003457
482 Ga0307416_100011816
483 Ga0307414_10001115
484 Ga0307414_10012354
485 Ga0307414_10022064
486 Ga0307414_10140503
487 Ga0307411_10003646
488 Ga0307411_10095118
489 Ga0307415_100003165
490 Ga0395899_0067685
491 Ga0395905_0000372
492 Ga0395901_0001674
493 Ga0237819_05278
494 Ga0495617_000176
495 Ga0495638_0000139
496 Ga0495584_0026682
497 Ga0495585_0000112
498 Ga0495607_0000067
499 Ga0495607_0000119
500 Ga0495607_0002423
501 Ga0495607_0014247
502 Ga0495583_0021924
503 Ga0495606_0034729
504 Ga0495606_0050614
505 Ga0495616_0008743
506 Ga0495631_0000124
507 Ga0495631_0000847
508 Ga0495632_0037681
509 Ga0495643_0001568
510 Ga0495643_0002296
511 Ga0495648_0000331
512 Ga0495609_0002642
513 Ga0495668_0000053
514 Ga0495611_0000002
515 Ga0495625_0000002
516 Ga0495625_0000351
517 Ga0495625_0064312
518 Ga0495661_0000700
519 Ga0495670_0000006
520 Ga0495670_0001387
521 Ga0495671_0000220
522 Ga0495589_0000067
523 Ga0495660_0000432
524 Ga0495672_0000087
525 Ga0495677_0001298
526 Ga0495679_000003
527 Ga0495673_0008404
528 Ga0495686_0000522
529 Ga0495686_0013963
530 Ga0496116_0104653
531 Ga0496117_0000368
532 Ga0496117_0018500
533 Ga0496118_0002837
534 Ga0496118_0002870
535 Ga0496118_0068654
536 Ga0496119_0000779
537 Ga0496120_0000458
538 Ga0496121_0000075
539 Ga0496122_0000896
540 Ga0496122_0000990
541 Ga0496122_0009852
542 Ga0496123_0000097
543 Ga0496123_0000137
544 Ga0496124_0000115
545 Ga0496124_0000343
546 Ga0496124_0000725
547 Ga0496124_0002387
548 Ga0496124_0088494
549 Ga0496124_0146608
550 Ga0496125_0019893
551 Ga0496125_0072016
552 Ga0496125_0131103
553 Ga0496126_0082866
554 Ga0495678_000026
555 Ga0495682_0001649
556 Ga0501031_0016117
557 Ga0501031_0067966
558 Ga0501032_0035931
559 Ga0501032_0048235
560 Ga0501033_0009947
561 Ga0501034_0002864
562 Ga0501034_0025292
563 Ga0501036_0074327
564 Ga0501037_0058384
565 Ga0501038_0012954
566 Ga0501038_0090158
567 Ga0501039_0020871
568 Ga0501046_0135045
569 Ga0501047_0002891
570 Ga0501070_0036328
571 Ga0501035_0015360
572 Ga0501044_0011336
573 Ga0501044_0037198
574 Ga0500643_000031
575 Ga0500643_001241
576 Ga0500643_004843
577 Ga0500566_0000203
578 Ga0500595_007345
579 Ga0500658_0030181
580 Ga0500559_0020035
581 Ga0500568_0002683
582 Ga0500627_0000035
583 Ga0500627_0000196
584 Ga0500645_000212
585 Ga0500596_003063
586 Ga0501082_0000866
587 2548501488
588 2578457067
589 2585261490
590 2595446667
591 2596375207
592 2600228853
593 2643835260
594 2643907715
595 2643914012
596 2643994391
597 2644040237
598 2644056186
599 2644061414
600 2644074945
601 2644295227
602 2644648963
603 2735834473
604 2738745160
605 2739243110
606 2739354390
607 2747949183
608 2748018548
609 2765580432
610 2793062618
611 2816473682
612 2816518534
613 2819563697
614 2819661216
615 2819714689
616 2831869173
617 2839138344
618 2842394358
619 2842702115
620 2842759055
621 2842782915
622 2842917987
623 2852652201
624 2852654774
625 2852684446
626 2852687082
627 2857445653
628 2874223105
629 2879166940
630 2885430687
631 2886849333
632 2894414345
633 2898716470
634 2904463992
635 2904480131
636 2919087670
637 2919092534
638 2919131140
639 2919137301
640 2919405476
641 2919514276
642 2928027482
643 2928126584
644 2928499002
645 2928517942
646 2928529195
647 2928968736
648 2929196381
649 2931383444
650 2932423083
651 2937614432
652 2939589733
653 2939624184
654 2939630185
655 2941474846
656 2941478827
657 2961049870
658 2961064969
659 2974307712
660 2974321038
661 2977248432
662 2984517084
663 2984558217
664 2984567404
665 2987608712
666 2990715315
667 2993358469
668 3000867708
669 3003670873
670 8001848610

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00375

SDF

Sodium:dicarboxylate symporter family

225

376

0.98

PF00375

SDF

Sodium:dicarboxylate symporter family

18

231

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nwl-assembly1.cif.gz_C crystal structure of gltph in complex with l-asp 0.865 19 410
1xfh-assembly1.cif.gz_A structure of glutamate transporter homolog from pyrococcus horikoshii 0.8639 18 409
2nwl-assembly1.cif.gz_A crystal structure of gltph in complex with l-asp 0.8615 19 410
7bct-assembly1.cif.gz_A asct2 in the presence of the inhibitor era-21 in the outward-open conformation. 0.8614 18 412
6uwf-assembly1.cif.gz_A gltph in complex with l-aspartate and sodium ions in outward-facing state 0.8591 18 410
ID Description Score Start End Superfamily
af_P0A830_1_408_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9632 12 415 1.10.3860.10
af_P0A830_1_408_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9518 12 415 1.10.3860.10
af_P71906_20_424_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9481 18 415 1.10.3860.10
af_P21345_1_417_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9369 14 416 1.10.3860.10
af_P71906_20_424_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.93 18 415 1.10.3860.10
ID Description Score Start End GO Terms
AF-A0A258BB26-F1-model_v4 C4-dicarboxylate transporter DctA 0.9805 227 424 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778
AF-A0A4Y3J673-F1-model_v4 C4-dicarboxylate ABC transporter 0.9791 57 426 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778
AF-A0A5Q0RUQ4-F1-model_v4 deleted 0.9783 16 426
AF-A0A7Y8BIS1-F1-model_v4 Dicarboxylate/amino acid:cation symporter 0.9767 15 424 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778
AF-N8RC33-F1-model_v4 C4-dicarboxylate transporter DctA 0.9764 18 426 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778

Map