F412309

General Info

Members Datasets Scaffolds Average Seq Length
335 197 670 273

Family's Representative Sequence

Representative Sequence 3300034816|Ga0373930_0000792|Ga0373930_0000792_199_1149
Length 316
Sequence VGHRDSSGCDPAACAGQPGRAIRLRALSLVGGERPPLSKSGTPKPRRRRTWLFVAGADEAAHRAAARSGADAIILELEDFTPPELRPKARAHAAEVLDEWRAAGALAGVRINPLETCGRDDLVGVLAGRPDFIMMSKVDSPAQVKALEAETGGAVDLVPNIENAAGLLNAYAIAKASKRVVAALVASEDMAASLGAVRSRRGGELAYVRSRFLVECRAAGVEAIDCPYTFSDVEGAAADARYARRLGYRMKSLVDPSHVAAVNRALTPNLARARRIVAAFEKARAQGKDRARLDGALIEVPAYAAAKRLLESDGQS

Samples

Sample ID Description Type Environment
1 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
136 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
137 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
138 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
139 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
143 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
144 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
154 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
155 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
156 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
157 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.19
Rhizosphere 98.81
Stem 0
Stem Tuber 0
Unclassified 6.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373930_0000792 3300034816 Bacteria 4501
2 Ga0070676_10066422 3300005328 Bacteria 2155
3 Ga0070690_100000497 3300005330 Bacteria 19649
4 Ga0070670_100004995 3300005331 Bacteria 11159
5 Ga0070670_100326090 3300005331 Unclassified 1346
6 Ga0068869_100002100 3300005334 Bacteria 11972
7 Ga0068869_100003023 3300005334 Bacteria 10223
8 Ga0070666_10153687 3300005335 Bacteria 1606
9 Ga0070680_100001571 3300005336 Bacteria 16654
10 Ga0070680_100111580 3300005336 Bacteria 2276
11 Ga0070682_100016604 3300005337 Bacteria 4284
12 Ga0068868_100004467 3300005338 Bacteria 9813
13 Ga0070689_100009090 3300005340 Bacteria 7034
14 Ga0070689_100128926 3300005340 Bacteria 2027
15 Ga0070689_100199007 3300005340 Unclassified 1635
16 Ga0070691_10001745 3300005341 Bacteria 9442
17 Ga0070691_10105959 3300005341 Bacteria 1401
18 Ga0070687_100000268 3300005343 Bacteria 17660
19 Ga0070687_100169842 3300005343 Bacteria 1297
20 Ga0070692_10000432 3300005345 Bacteria 12705
21 Ga0070692_10035049 3300005345 Bacteria 2539
22 Ga0070668_100009967 3300005347 Bacteria 7039
23 Ga0070668_100233705 3300005347 Unclassified 1521
24 Ga0070669_100039985 3300005353 Bacteria 3408
25 Ga0070671_100024708 3300005355 Bacteria 4921
26 Ga0070671_100153948 3300005355 Bacteria 1942
27 Ga0070674_100253865 3300005356 Bacteria 1382
28 Ga0070673_100017095 3300005364 Bacteria 5147
29 Ga0070714_100056577 3300005435 Bacteria 3355
30 Ga0070701_10000083 3300005438 Bacteria 26254
31 Ga0070705_100000645 3300005440 Bacteria 19939
32 Ga0070705_100196203 3300005440 Bacteria 1380
33 Ga0070700_100000249 3300005441 Bacteria 29271
34 Ga0070694_100000382 3300005444 Bacteria 23947
35 Ga0070694_100006472 3300005444 Bacteria 7113
36 Ga0070694_100022921 3300005444 Bacteria 4008
37 Ga0070694_100034603 3300005444 Bacteria 3333
38 Ga0070694_100101742 3300005444 Bacteria 2033
39 Ga0070663_100133321 3300005455 Bacteria 1889
40 Ga0070681_10000281 3300005458 Bacteria 40930
41 Ga0070681_10030881 3300005458 Bacteria 5378
42 Ga0068867_100000534 3300005459 Bacteria 25071
43 Ga0068867_100001706 3300005459 Bacteria 15301
44 Ga0070698_100040611 3300005471 Bacteria 4780
45 Ga0070698_100146687 3300005471 Bacteria 2308
46 Ga0070699_100321171 3300005518 Bacteria 1391
47 Ga0070679_100007368 3300005530 Bacteria 10280
48 Ga0070679_100073416 3300005530 Bacteria 3413
49 Ga0068853_100260598 3300005539 Bacteria 1594
50 Ga0070672_100087553 3300005543 Bacteria 2506
51 Ga0070686_100000299 3300005544 Bacteria 33122
52 Ga0070686_100409523 3300005544 Unclassified 1033
53 Ga0070686_100426761 3300005544 Bacteria 1014
54 Ga0070695_100000816 3300005545 Bacteria 16788
55 Ga0070695_100009787 3300005545 Bacteria 5710
56 Ga0070695_100073265 3300005545 Bacteria 2247
57 Ga0070695_100217744 3300005545 Unclassified 1374
58 Ga0070695_100226385 3300005545 Bacteria 1350
59 Ga0070696_100002955 3300005546 Bacteria 11296
60 Ga0070696_100006964 3300005546 Bacteria 7545
61 Ga0070696_100049778 3300005546 Bacteria 2912
62 Ga0070696_100281085 3300005546 Bacteria 1269
63 Ga0070693_100000281 3300005547 Bacteria 23879
64 Ga0070693_100265755 3300005547 Bacteria 1143
65 Ga0070704_100000420 3300005549 Bacteria 19697
66 Ga0070704_100002847 3300005549 Bacteria 9807
67 Ga0070704_100115214 3300005549 Bacteria 2053
68 Ga0070704_100322452 3300005549 Bacteria 1295
69 Ga0070704_100367231 3300005549 Bacteria 1219
70 Ga0068855_100002028 3300005563 Bacteria 25117
71 Ga0070664_100421110 3300005564 Bacteria 1223
72 Ga0068857_100003057 3300005577 Bacteria 13841
73 Ga0068854_100003188 3300005578 Bacteria 10238
74 Ga0070702_100004547 3300005615 Bacteria 6347
75 Ga0070702_100381638 3300005615 Bacteria 1002
76 Ga0068859_100002465 3300005617 Bacteria 18831
77 Ga0068859_100017570 3300005617 Bacteria 7192
78 Ga0068859_100023069 3300005617 Bacteria 6240
79 Ga0068859_100067069 3300005617 Bacteria 3623
80 Ga0068864_100013535 3300005618 Bacteria 6763
81 Ga0068864_100585884 3300005618 Bacteria 1081
82 Ga0068866_10000506 3300005718 Bacteria 18014
83 Ga0068861_100000192 3300005719 Bacteria 32743
84 Ga0068861_100204624 3300005719 Bacteria 1659
85 Ga0068870_10008856 3300005840 Bacteria 4544
86 Ga0068870_10095825 3300005840 Bacteria 1668
87 Ga0068863_100024732 3300005841 Bacteria 5727
88 Ga0068858_100005818 3300005842 Bacteria 12045
89 Ga0068858_100010718 3300005842 Bacteria 8674
90 Ga0068860_100002610 3300005843 Bacteria 18852
91 Ga0068860_100003281 3300005843 Bacteria 16651
92 Ga0068862_100005986 3300005844 Bacteria 10126
93 Ga0068862_100328736 3300005844 Bacteria 1413
94 Ga0068862_100402189 3300005844 Bacteria 1281
95 Ga0081539_10001221 3300005985 Bacteria 45911
96 Ga0097621_100004557 3300006237 Bacteria 9670
97 Ga0097621_100348628 3300006237 Bacteria 1316
98 Ga0068871_100006222 3300006358 Bacteria 8418
99 Ga0075428_100012898 3300006844 Bacteria 9297
100 Ga0075428_100084931 3300006844 Bacteria 3453
101 Ga0075430_100074840 3300006846 Bacteria 2839
102 Ga0075431_100003399 3300006847 Bacteria 15428
103 Ga0075431_100023520 3300006847 Bacteria 6305
104 Ga0075431_100060716 3300006847 Bacteria 3901
105 Ga0075433_10046433 3300006852 Bacteria 3777
106 Ga0075434_100000013 3300006871 Bacteria 83380
107 Ga0075429_100000901 3300006880 Bacteria 23511
108 Ga0075429_100100749 3300006880 Bacteria 2521
109 Ga0068865_100000300 3300006881 Bacteria 27230
110 Ga0075436_100005856 3300006914 Bacteria 8445
111 Ga0075436_100011736 3300006914 Bacteria 6014
112 Ga0075436_100094933 3300006914 Bacteria 2074
113 Ga0075436_100223874 3300006914 Unclassified 1335
114 Ga0097620_100002465 3300006931 Bacteria 18831
115 Ga0097620_100017569 3300006931 Bacteria 7192
116 Ga0097620_100023071 3300006931 Bacteria 6240
117 Ga0097620_100067069 3300006931 Bacteria 3623
118 Ga0075435_100000852 3300007076 Bacteria 19080
119 Ga0075435_100003697 3300007076 Bacteria 10424
120 Ga0075435_100052323 3300007076 Bacteria 3292
121 Ga0099794_10027392 3300007265 Unclassified 2642
122 Ga0105250_10135956 3300009092 Unclassified 1016
123 Ga0111539_10042374 3300009094 Bacteria 5466
124 Ga0111539_10090749 3300009094 Bacteria 3590
125 Ga0111539_10261768 3300009094 Bacteria 2013
126 Ga0105245_10000821 3300009098 Bacteria 28312
127 Ga0105247_10018367 3300009101 Bacteria 4196
128 Ga0114129_10057361 3300009147 Bacteria 5450
129 Ga0114129_10073781 3300009147 Bacteria 4753
130 Ga0114129_10122767 3300009147 Bacteria 3574
131 Ga0114129_10151351 3300009147 Bacteria 3175
132 Ga0105243_10001374 3300009148 Bacteria 21561
133 Ga0105241_10081780 3300009174 Bacteria 2531
134 Ga0105242_10007413 3300009176 Bacteria 8448
135 Ga0105242_10222358 3300009176 Bacteria 1688
136 Ga0105248_10005793 3300009177 Bacteria 13581
137 Ga0105248_10054514 3300009177 Bacteria 4484
138 Ga0105249_10000348 3300009553 Bacteria 46377
139 Ga0105249_10281024 3300009553 Bacteria 1662
140 Ga0105249_10321030 3300009553 Unclassified 1560
141 Ga0105239_10203197 3300010375 Bacteria 2220
142 Ga0157378_10001675 3300013297 Bacteria 19966
143 Ga0163162_10065618 3300013306 Bacteria 3678
144 Ga0163162_10193428 3300013306 Bacteria 2162
145 Ga0157375_10024939 3300013308 Bacteria 5544
146 Ga0157375_10027711 3300013308 Bacteria 5300
147 Ga0157380_10320906 3300014326 Bacteria 1436
148 Ga0157377_10276995 3300014745 Bacteria 1098
149 Ga0157379_10000219 3300014968 Bacteria 44603
150 Ga0157379_10233506 3300014968 Bacteria 1668
151 Ga0207642_10000533 3300025899 Bacteria 11649
152 Ga0207680_10103122 3300025903 Bacteria 1837
153 Ga0207680_10220972 3300025903 Bacteria 1299
154 Ga0207645_10074626 3300025907 Bacteria 2171
155 Ga0207643_10010779 3300025908 Bacteria 4928
156 Ga0207643_10033481 3300025908 Bacteria 2875
157 Ga0207643_10058782 3300025908 Bacteria 2192
158 Ga0207707_10009521 3300025912 Bacteria 8428
159 Ga0207707_10022575 3300025912 Bacteria 5500
160 Ga0207660_10109231 3300025917 Bacteria 2079
161 Ga0207662_10000155 3300025918 Bacteria 32464
162 Ga0207662_10262050 3300025918 Bacteria 1138
163 Ga0207652_10013379 3300025921 Bacteria 6644
164 Ga0207652_10192527 3300025921 Bacteria 1834
165 Ga0207646_10187959 3300025922 Bacteria 1866
166 Ga0207646_10471293 3300025922 Bacteria 1132
167 Ga0207650_10003272 3300025925 Bacteria 11165
168 Ga0207650_10059181 3300025925 Unclassified 2855
169 Ga0207650_10158044 3300025925 Bacteria 1794
170 Ga0207687_10004271 3300025927 Bacteria 9555
171 Ga0207664_10042076 3300025929 Bacteria 3564
172 Ga0207644_10103349 3300025931 Bacteria 2144
173 Ga0207706_10093321 3300025933 Bacteria 2647
174 Ga0207686_10000347 3300025934 Bacteria 33269
175 Ga0207686_10089329 3300025934 Bacteria 2030
176 Ga0207709_10000647 3300025935 Bacteria 28268
177 Ga0207670_10201411 3300025936 Unclassified 1513
178 Ga0207669_10163815 3300025937 Bacteria 1574
179 Ga0207704_10002446 3300025938 Bacteria 8354
180 Ga0207691_10022855 3300025940 Bacteria 5894
181 Ga0207691_10044431 3300025940 Bacteria 4090
182 Ga0207691_10257081 3300025940 Bacteria 1506
183 Ga0207711_10009594 3300025941 Bacteria 8067
184 Ga0207689_10001602 3300025942 Bacteria 21425
185 Ga0207689_10002111 3300025942 Bacteria 18686
186 Ga0207667_10038575 3300025949 Bacteria 5100
187 Ga0207651_10121603 3300025960 Bacteria 1981
188 Ga0207651_10175183 3300025960 Bacteria 1696
189 Ga0207712_10004246 3300025961 Bacteria 9039
190 Ga0207712_10274255 3300025961 Bacteria 1373
191 Ga0207712_10354675 3300025961 Unclassified 1220
192 Ga0207668_10003111 3300025972 Bacteria 9720
193 Ga0207668_10003330 3300025972 Bacteria 9410
194 Ga0207640_10002134 3300025981 Bacteria 10621
195 Ga0207658_10022667 3300025986 Bacteria 4374
196 Ga0207677_10002515 3300026023 Bacteria 9609
197 Ga0207677_10262428 3300026023 Bacteria 1409
198 Ga0207703_10001278 3300026035 Bacteria 23343
199 Ga0207703_10005929 3300026035 Bacteria 9790
200 Ga0207703_10315561 3300026035 Bacteria 1430
201 Ga0207639_10269568 3300026041 Bacteria 1493
202 Ga0207678_10070304 3300026067 Bacteria 3001
203 Ga0207708_10000502 3300026075 Bacteria 30107
204 Ga0207641_10149343 3300026088 Unclassified 2115
205 Ga0207641_10167998 3300026088 Bacteria 2000
206 Ga0207641_10226777 3300026088 Bacteria 1735
207 Ga0207641_10340471 3300026088 Bacteria 1427
208 Ga0207648_10001446 3300026089 Bacteria 26151
209 Ga0207648_10002261 3300026089 Bacteria 20835
210 Ga0207648_10022751 3300026089 Bacteria 5624
211 Ga0207676_10001174 3300026095 Bacteria 19678
212 Ga0207674_10002529 3300026116 Bacteria 23045
213 Ga0207675_100000334 3300026118 Bacteria 45029
214 Ga0207675_100071050 3300026118 Bacteria 3254
215 Ga0207675_100249957 3300026118 Bacteria 1716
216 Ga0207698_10160448 3300026142 Unclassified 1966
217 Ga0207698_10374118 3300026142 Bacteria 1353
218 Ga0209967_1003162 3300027364 Bacteria 2161
219 Ga0209996_1002953 3300027395 Bacteria 2123
220 Ga0209968_1007407 3300027526 Bacteria 1661
221 Ga0209999_1004411 3300027543 Bacteria 2530
222 Ga0207428_10069586 3300027907 Bacteria 2767
223 Ga0207428_10151073 3300027907 Unclassified 1768
224 Ga0268266_10026500 3300028379 Bacteria 4933
225 Ga0268265_10003429 3300028380 Bacteria 11406
226 Ga0268264_10002240 3300028381 Bacteria 17151
227 Ga0307408_100115727 3300031548 Bacteria 2068
228 Ga0307408_100354647 3300031548 Unclassified 1246
229 Ga0307405_10141802 3300031731 Bacteria 1677
230 Ga0307407_10125384 3300031903 Bacteria 1635
231 Ga0307412_10044294 3300031911 Bacteria 2903
232 Ga0307416_100273075 3300032002 Bacteria 1661
233 Ga0307416_100709024 3300032002 Unclassified 1096
234 Ga0307411_10164575 3300032005 Bacteria 1666
235 Ga0373938_0007419 3300034957 Bacteria 1928
236 Ga0373940_0001330 3300035088 Bacteria 4407
237 Ga0373944_0060942 3300035089 Bacteria 1210
238 Ga0373949_0003409 3300035090 Bacteria 3793
239 Ga0373949_0049266 3300035090 Unclassified 1057
240 Ga0373951_0005820 3300035091 Bacteria 2848
241 Ga0373923_0034389 3300035111 Bacteria 2057
242 Ga0373932_0003854 3300035112 Bacteria 3577
243 Ga0373939_0004151 3300035114 Unclassified 3415
244 Ga0373939_0007471 3300035114 Bacteria 2655
245 Ga0373945_0005160 3300035116 Bacteria 4173
246 Ga0373942_0005132 3300035207 Bacteria 3036
247 Ga0373931_0000452 3300035691 Bacteria 16749
248 Ga0373931_0014473 3300035691 Bacteria 3857
249 Ga0373931_0059081 3300035691 Bacteria 2061
250 Ga0373931_0243052 3300035691 Unclassified 1092
251 Ga0373931_0398946 3300035691 Unclassified 870
252 Ga0373927_0010513 3300035695 Bacteria 6168
253 Ga0373933_0220128 3300035724 Bacteria 1218
254 Ga0373947_0146445 3300035725 Bacteria 1518
255 Ga0373937_0129492 3300036401 Bacteria 2356
256 Ga0373925_0219360 3300037068 Bacteria 1517
257 Ga0439439_0029399 3300041406 Bacteria 1395
258 Ga0451807_0017135 3300041486 Bacteria 2085
259 Ga0439443_000328 3300042003 Bacteria 3958
260 Ga0439446_0006978 3300042156 Bacteria 2960
261 Ga0439434_0002530 3300042435 Bacteria 5322
262 Ga0439435_0000038 3300042436 Bacteria 14468
263 Ga0439435_0003248 3300042436 Bacteria 3358
264 Ga0439460_0000260 3300042461 Bacteria 10871
265 Ga0451576_0017056 3300045051 Bacteria 7992
266 Ga0451576_0090466 3300045051 Bacteria 3183
267 Ga0451576_0349708 3300045051 Bacteria 1547
268 Ga0451576_0843273 3300045051 Unclassified 962
269 Ga0495603_0053006 3300046455 Bacteria 2407
270 Ga0495580_0013907 3300046472 Bacteria 6126
271 Ga0495582_0229680 3300046473 Bacteria 1062
272 Ga0495594_0045009 3300046499 Bacteria 2422
273 Ga0495630_0299684 3300046517 Bacteria 1228
274 Ga0495666_0020142 3300046526 Bacteria 3308
275 Ga0495586_0002644 3300046535 Bacteria 9686
276 Ga0495647_0000634 3300046681 Bacteria 10380
277 Ga0495658_0014117 3300046683 Bacteria 4074
278 Ga0495669_0192720 3300046684 Bacteria 973
279 Ga0495676_0032303 3300047321 Bacteria 4420
280 Ga0496102_0020329 3300048905 Bacteria 5868
281 Ga0496114_0620747 3300048917 Bacteria 952
282 Ga0496114_0666457 3300048917 Bacteria 914
283 Ga0501036_0088134 3300049572 Bacteria 2623
284 Ga0501039_0017722 3300049575 Bacteria 5463
285 Ga0501039_0115466 3300049575 Bacteria 2101
286 Ga0501039_0128755 3300049575 Bacteria 1986
287 Ga0501040_0033905 3300049576 Bacteria 3460
288 Ga0501041_0074657 3300049577 Bacteria 2084
289 Ga0501041_0212838 3300049577 Bacteria 1212
290 Ga0501042_0372563 3300049578 Bacteria 1033
291 Ga0501046_0096670 3300049580 Bacteria 2269
292 Ga0501048_0072749 3300049582 Bacteria 2427
293 Ga0501069_0086865 3300049585 Bacteria 1766
294 Ga0501071_0004929 3300049587 Bacteria 8520
295 Ga0501071_0025684 3300049587 Bacteria 4128
296 Ga0501071_0321143 3300049587 Bacteria 1176
297 Ga0501071_0330392 3300049587 Unclassified 1159
298 Ga0501072_0052347 3300049588 Bacteria 3215
299 Ga0501074_0167968 3300049590 Bacteria 1566
300 Ga0501075_0013204 3300049591 Bacteria 5891
301 Ga0501075_0097819 3300049591 Bacteria 2227
302 Ga0501076_0063133 3300049592 Bacteria 2951
303 Ga0501080_0000418 3300049742 Bacteria 32644
304 Ga0501080_0188875 3300049742 Bacteria 1894
305 Ga0501080_0189925 3300049742 Bacteria 1888
306 Ga0501081_0036686 3300049743 Bacteria 3343
307 Ga0501045_0031954 3300049824 Bacteria 3813
308 Ga0501045_0081906 3300049824 Bacteria 2380
309 nmdc:mga05p37_134313_c1 3300050507 Bacteria 3035
310 nmdc:mga05p37_200_c1 3300050507 Bacteria 59779
311 nmdc:mga05p37_38025_c1 3300050507 Bacteria 5902
312 nmdc:mga05p37_78704_c1 3300050507 Bacteria 4060
313 nmdc:mga09592_103887_c1 3300050508 Bacteria 2435
314 nmdc:mga09592_10_c1 3300050508 Bacteria 106937
315 nmdc:mga09592_179019_c1 3300050508 Bacteria 1834
316 nmdc:mga09592_269739_c1 3300050508 Bacteria 1476
317 nmdc:mga09592_328_c1 3300050508 Bacteria 34777
318 nmdc:mga0qj67_199053_c1 3300050509 Bacteria 1628
319 nmdc:mga06r32_355171_c1 3300050510 Bacteria 1450
320 nmdc:mga06r32_41847_c1 3300050510 Bacteria 4354
321 nmdc:mga08y16_11238_c1 3300050511 Bacteria 9405
322 nmdc:mga08y16_117281_c1 3300050511 Bacteria 2771
323 nmdc:mga08y16_15605_c1 3300050511 Bacteria 7987
324 nmdc:mga08y16_251728_c1 3300050511 Bacteria 1825
325 nmdc:mga0n895_46_c1 3300050512 Bacteria 73853
326 nmdc:mga0rr50_1113_c1 3300050513 Bacteria 14599
327 nmdc:mga0rr50_32804_c1 3300050513 Bacteria 3704
328 nmdc:mga08x19_1643_c1 3300050514 Bacteria 13812
329 nmdc:mga08x19_3204_c1 3300050514 Bacteria 9815
330 nmdc:mga08x19_51888_c1 3300050514 Bacteria 2636
331 nmdc:mga08x19_60019_c1 3300050514 Bacteria 2463
332 nmdc:mga0a205_166909_c1 3300050515 Bacteria 2097
333 nmdc:mga0a205_29225_c1 3300050515 Bacteria 5275
334 Ga0530510_0033776 3300061734 Bacteria 3683
335 Ga0530510_0172986 3300061734 Bacteria 1600
336 Ga0373930_0000792
337 Ga0070676_10066422
338 Ga0070690_100000497
339 Ga0070670_100004995
340 Ga0070670_100326090
341 Ga0068869_100002100
342 Ga0068869_100003023
343 Ga0070666_10153687
344 Ga0070680_100001571
345 Ga0070680_100111580
346 Ga0070682_100016604
347 Ga0068868_100004467
348 Ga0070689_100009090
349 Ga0070689_100128926
350 Ga0070689_100199007
351 Ga0070691_10001745
352 Ga0070691_10105959
353 Ga0070687_100000268
354 Ga0070687_100169842
355 Ga0070692_10000432
356 Ga0070692_10035049
357 Ga0070668_100009967
358 Ga0070668_100233705
359 Ga0070669_100039985
360 Ga0070671_100024708
361 Ga0070671_100153948
362 Ga0070674_100253865
363 Ga0070673_100017095
364 Ga0070714_100056577
365 Ga0070701_10000083
366 Ga0070705_100000645
367 Ga0070705_100196203
368 Ga0070700_100000249
369 Ga0070694_100000382
370 Ga0070694_100006472
371 Ga0070694_100022921
372 Ga0070694_100034603
373 Ga0070694_100101742
374 Ga0070663_100133321
375 Ga0070681_10000281
376 Ga0070681_10030881
377 Ga0068867_100000534
378 Ga0068867_100001706
379 Ga0070698_100040611
380 Ga0070698_100146687
381 Ga0070699_100321171
382 Ga0070679_100007368
383 Ga0070679_100073416
384 Ga0068853_100260598
385 Ga0070672_100087553
386 Ga0070686_100000299
387 Ga0070686_100409523
388 Ga0070686_100426761
389 Ga0070695_100000816
390 Ga0070695_100009787
391 Ga0070695_100073265
392 Ga0070695_100217744
393 Ga0070695_100226385
394 Ga0070696_100002955
395 Ga0070696_100006964
396 Ga0070696_100049778
397 Ga0070696_100281085
398 Ga0070693_100000281
399 Ga0070693_100265755
400 Ga0070704_100000420
401 Ga0070704_100002847
402 Ga0070704_100115214
403 Ga0070704_100322452
404 Ga0070704_100367231
405 Ga0068855_100002028
406 Ga0070664_100421110
407 Ga0068857_100003057
408 Ga0068854_100003188
409 Ga0070702_100004547
410 Ga0070702_100381638
411 Ga0068859_100002465
412 Ga0068859_100017570
413 Ga0068859_100023069
414 Ga0068859_100067069
415 Ga0068864_100013535
416 Ga0068864_100585884
417 Ga0068866_10000506
418 Ga0068861_100000192
419 Ga0068861_100204624
420 Ga0068870_10008856
421 Ga0068870_10095825
422 Ga0068863_100024732
423 Ga0068858_100005818
424 Ga0068858_100010718
425 Ga0068860_100002610
426 Ga0068860_100003281
427 Ga0068862_100005986
428 Ga0068862_100328736
429 Ga0068862_100402189
430 Ga0081539_10001221
431 Ga0097621_100004557
432 Ga0097621_100348628
433 Ga0068871_100006222
434 Ga0075428_100012898
435 Ga0075428_100084931
436 Ga0075430_100074840
437 Ga0075431_100003399
438 Ga0075431_100023520
439 Ga0075431_100060716
440 Ga0075433_10046433
441 Ga0075434_100000013
442 Ga0075429_100000901
443 Ga0075429_100100749
444 Ga0068865_100000300
445 Ga0075436_100005856
446 Ga0075436_100011736
447 Ga0075436_100094933
448 Ga0075436_100223874
449 Ga0097620_100002465
450 Ga0097620_100017569
451 Ga0097620_100023071
452 Ga0097620_100067069
453 Ga0075435_100000852
454 Ga0075435_100003697
455 Ga0075435_100052323
456 Ga0099794_10027392
457 Ga0105250_10135956
458 Ga0111539_10042374
459 Ga0111539_10090749
460 Ga0111539_10261768
461 Ga0105245_10000821
462 Ga0105247_10018367
463 Ga0114129_10057361
464 Ga0114129_10073781
465 Ga0114129_10122767
466 Ga0114129_10151351
467 Ga0105243_10001374
468 Ga0105241_10081780
469 Ga0105242_10007413
470 Ga0105242_10222358
471 Ga0105248_10005793
472 Ga0105248_10054514
473 Ga0105249_10000348
474 Ga0105249_10281024
475 Ga0105249_10321030
476 Ga0105239_10203197
477 Ga0157378_10001675
478 Ga0163162_10065618
479 Ga0163162_10193428
480 Ga0157375_10024939
481 Ga0157375_10027711
482 Ga0157380_10320906
483 Ga0157377_10276995
484 Ga0157379_10000219
485 Ga0157379_10233506
486 Ga0207642_10000533
487 Ga0207680_10103122
488 Ga0207680_10220972
489 Ga0207645_10074626
490 Ga0207643_10010779
491 Ga0207643_10033481
492 Ga0207643_10058782
493 Ga0207707_10009521
494 Ga0207707_10022575
495 Ga0207660_10109231
496 Ga0207662_10000155
497 Ga0207662_10262050
498 Ga0207652_10013379
499 Ga0207652_10192527
500 Ga0207646_10187959
501 Ga0207646_10471293
502 Ga0207650_10003272
503 Ga0207650_10059181
504 Ga0207650_10158044
505 Ga0207687_10004271
506 Ga0207664_10042076
507 Ga0207644_10103349
508 Ga0207706_10093321
509 Ga0207686_10000347
510 Ga0207686_10089329
511 Ga0207709_10000647
512 Ga0207670_10201411
513 Ga0207669_10163815
514 Ga0207704_10002446
515 Ga0207691_10022855
516 Ga0207691_10044431
517 Ga0207691_10257081
518 Ga0207711_10009594
519 Ga0207689_10001602
520 Ga0207689_10002111
521 Ga0207667_10038575
522 Ga0207651_10121603
523 Ga0207651_10175183
524 Ga0207712_10004246
525 Ga0207712_10274255
526 Ga0207712_10354675
527 Ga0207668_10003111
528 Ga0207668_10003330
529 Ga0207640_10002134
530 Ga0207658_10022667
531 Ga0207677_10002515
532 Ga0207677_10262428
533 Ga0207703_10001278
534 Ga0207703_10005929
535 Ga0207703_10315561
536 Ga0207639_10269568
537 Ga0207678_10070304
538 Ga0207708_10000502
539 Ga0207641_10149343
540 Ga0207641_10167998
541 Ga0207641_10226777
542 Ga0207641_10340471
543 Ga0207648_10001446
544 Ga0207648_10002261
545 Ga0207648_10022751
546 Ga0207676_10001174
547 Ga0207674_10002529
548 Ga0207675_100000334
549 Ga0207675_100071050
550 Ga0207675_100249957
551 Ga0207698_10160448
552 Ga0207698_10374118
553 Ga0209967_1003162
554 Ga0209996_1002953
555 Ga0209968_1007407
556 Ga0209999_1004411
557 Ga0207428_10069586
558 Ga0207428_10151073
559 Ga0268266_10026500
560 Ga0268265_10003429
561 Ga0268264_10002240
562 Ga0307408_100115727
563 Ga0307408_100354647
564 Ga0307405_10141802
565 Ga0307407_10125384
566 Ga0307412_10044294
567 Ga0307416_100273075
568 Ga0307416_100709024
569 Ga0307411_10164575
570 Ga0373938_0007419
571 Ga0373940_0001330
572 Ga0373944_0060942
573 Ga0373949_0003409
574 Ga0373949_0049266
575 Ga0373951_0005820
576 Ga0373923_0034389
577 Ga0373932_0003854
578 Ga0373939_0004151
579 Ga0373939_0007471
580 Ga0373945_0005160
581 Ga0373942_0005132
582 Ga0373931_0000452
583 Ga0373931_0014473
584 Ga0373931_0059081
585 Ga0373931_0243052
586 Ga0373931_0398946
587 Ga0373927_0010513
588 Ga0373933_0220128
589 Ga0373947_0146445
590 Ga0373937_0129492
591 Ga0373925_0219360
592 Ga0439439_0029399
593 Ga0451807_0017135
594 Ga0439443_000328
595 Ga0439446_0006978
596 Ga0439434_0002530
597 Ga0439435_0000038
598 Ga0439435_0003248
599 Ga0439460_0000260
600 Ga0451576_0017056
601 Ga0451576_0090466
602 Ga0451576_0349708
603 Ga0451576_0843273
604 Ga0495603_0053006
605 Ga0495580_0013907
606 Ga0495582_0229680
607 Ga0495594_0045009
608 Ga0495630_0299684
609 Ga0495666_0020142
610 Ga0495586_0002644
611 Ga0495647_0000634
612 Ga0495658_0014117
613 Ga0495669_0192720
614 Ga0495676_0032303
615 Ga0496102_0020329
616 Ga0496114_0620747
617 Ga0496114_0666457
618 Ga0501036_0088134
619 Ga0501039_0017722
620 Ga0501039_0115466
621 Ga0501039_0128755
622 Ga0501040_0033905
623 Ga0501041_0074657
624 Ga0501041_0212838
625 Ga0501042_0372563
626 Ga0501046_0096670
627 Ga0501048_0072749
628 Ga0501069_0086865
629 Ga0501071_0004929
630 Ga0501071_0025684
631 Ga0501071_0321143
632 Ga0501071_0330392
633 Ga0501072_0052347
634 Ga0501074_0167968
635 Ga0501075_0013204
636 Ga0501075_0097819
637 Ga0501076_0063133
638 Ga0501080_0000418
639 Ga0501080_0188875
640 Ga0501080_0189925
641 Ga0501081_0036686
642 Ga0501045_0031954
643 Ga0501045_0081906
644 nmdc:mga05p37_134313_c1
645 nmdc:mga05p37_200_c1
646 nmdc:mga05p37_38025_c1
647 nmdc:mga05p37_78704_c1
648 nmdc:mga09592_103887_c1
649 nmdc:mga09592_10_c1
650 nmdc:mga09592_179019_c1
651 nmdc:mga09592_269739_c1
652 nmdc:mga09592_328_c1
653 nmdc:mga0qj67_199053_c1
654 nmdc:mga06r32_355171_c1
655 nmdc:mga06r32_41847_c1
656 nmdc:mga08y16_11238_c1
657 nmdc:mga08y16_117281_c1
658 nmdc:mga08y16_15605_c1
659 nmdc:mga08y16_251728_c1
660 nmdc:mga0n895_46_c1
661 nmdc:mga0rr50_1113_c1
662 nmdc:mga0rr50_32804_c1
663 nmdc:mga08x19_1643_c1
664 nmdc:mga08x19_3204_c1
665 nmdc:mga08x19_51888_c1
666 nmdc:mga08x19_60019_c1
667 nmdc:mga0a205_166909_c1
668 nmdc:mga0a205_29225_c1
669 Ga0530510_0033776
670 Ga0530510_0172986

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03328

HpcH_HpaI

HpcH/HpaI aldolase/citrate lyase family

49

256

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vxc-assembly1.cif.gz_A crystal structure analysis of human clybl in complex with free coash 0.9227 13 284
1sgj-assembly1.cif.gz_C crystal structure of citrate lyase beta subunit 0.9076 13 234
3qll-assembly1.cif.gz_A crystal structure of ripc from yersinia pestis 0.9037 12 240
4l9z-assembly1.cif.gz_A crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, oxalate, and coa 0.9028 12 285
3qll-assembly1.cif.gz_A crystal structure of ripc from yersinia pestis 0.8917 12 240
ID Description Score Start End Superfamily
af_A0A0R4IAX5_410_529_1.20.1220.12 Mainly Alpha;Up-down Bundle;Malate Synthase G; Chain: A; Domain 4;Malate synthase, domain III 0.9498 240 280 1.20.1220.12
af_Q1JPT8_41_343_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9379 13 282 3.20.20.60
af_Q93167_15_324_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.911 8 284 3.20.20.60
3qllC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9065 12 240 3.20.20.60
3qllC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8943 12 240 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A2E6QJV7-F1-model_v4 CoA ester lyase 0.9724 16 284 GO:0000287
GO:0006107
GO:0016829
AF-A0A7C5LTA7-F1-model_v4 CoA ester lyase 0.9682 11 244 GO:0000287
GO:0006107
GO:0016829
AF-A0A220RJM3-F1-model_v4 deleted 0.9605 16 237
AF-A0A2V6RC67-F1-model_v4 CoA ester lyase 0.9513 11 284 GO:0000287
GO:0006107
GO:0016829
AF-A0A7Z9INP7-F1-model_v4 CoA ester lyase 0.9513 14 284 GO:0000287
GO:0006107
GO:0016829

Map