F412351

General Info

Members Datasets Scaffolds Average Seq Length
335 204 670 322

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0064552|Ga0466969_0064552_320_1369
Length 349
Sequence MSDRYSRQTVLPEVGAAGQERLRGASVLVVGAGGLGCAVLQYLCAAGVGRLIIIDPDRVEESNLHRQPLYRMSDLGALKVEASRAALLQVNPDVCIETLAERLTPANVSAAVSKAQLIVDAADSFAATYVLSDECHAVGKPLISASVLGLSGYVGAFCGGAPSYRAVFPEMPRQAGSCAQSGVLGTAVGVMGTLQAHMTLALALDLKAAPGLERLPRDAEQASGGPADGAARCAALGQLITVDFRTLRFGGFSFANAQEPAGAAIPFIDPTEVADTDIVIDLRSLTEAPVSPFASALRIGVDTVERAEEQLPQGRRIVLCCRTGVRAWRAARALQRQGHSNVALIALGD

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
67 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
81 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
167 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
186 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
187 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
188 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
189 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
190 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
191 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
192 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
193 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
194 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
195 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
196 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
197 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
198 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
199 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
200 2841760612 Bosea sp. Tri-49 Isolate Nodule
201 2844104063 Bosea sp. Tri-39 Isolate Nodule
202 2851182111 Bosea sp. Tri-44 Isolate Nodule
203 2851246043 Bosea sp. Tri-54 Isolate Nodule
204 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.72
Metatranscriptomes 0.3
Isolates 2.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.36
Nodule 1.49
Rhizoplane 3.28
Rhizosphere 77.01
Stem 0
Stem Tuber 0
Unclassified 11.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0064552 3300044656 Bacteria 1772
2 rootL2_10082985 3300003322 Bacteria 3721
3 Ga0065165_1000132 3300005262 Bacteria 128732
4 Ga0070658_10004845 3300005327 Bacteria 10959
5 Ga0070683_100048777 3300005329 Bacteria 3915
6 Ga0070683_100208036 3300005329 Unclassified 1858
7 Ga0070666_10006053 3300005335 Bacteria 7430
8 Ga0070682_100058587 3300005337 Bacteria 2429
9 Ga0068868_100084470 3300005338 Bacteria 2550
10 Ga0070661_100019304 3300005344 Bacteria 4859
11 Ga0070671_100002471 3300005355 Bacteria 14293
12 Ga0070671_100052893 3300005355 Bacteria 3376
13 Ga0070673_100030920 3300005364 Bacteria 4013
14 Ga0070667_100019356 3300005367 Bacteria 5647
15 Ga0070667_100094182 3300005367 Bacteria 2580
16 Ga0070667_100196671 3300005367 Unclassified 1787
17 Ga0070714_100125247 3300005435 Bacteria 2290
18 Ga0070713_100000397 3300005436 Bacteria 27956
19 Ga0070713_100028752 3300005436 Bacteria 4393
20 Ga0070713_100051968 3300005436 Bacteria 3391
21 Ga0070710_10031700 3300005437 Bacteria 2857
22 Ga0070711_100095159 3300005439 Bacteria 2155
23 Ga0070705_100046086 3300005440 Bacteria 2512
24 Ga0070708_100044953 3300005445 Bacteria 3888
25 Ga0070678_100011994 3300005456 Bacteria 5368
26 Ga0070681_10004986 3300005458 Bacteria 12781
27 Ga0070681_10006133 3300005458 Bacteria 11669
28 Ga0070681_10029396 3300005458 Bacteria 5519
29 Ga0070681_10192364 3300005458 Unclassified 1960
30 Ga0068867_100140656 3300005459 Bacteria 1886
31 Ga0070706_100034527 3300005467 Bacteria 4672
32 Ga0070698_100005048 3300005471 Bacteria 14467
33 Ga0070699_100029046 3300005518 Bacteria 4767
34 Ga0070699_100143135 3300005518 Bacteria 2112
35 Ga0070699_100551732 3300005518 Unclassified 1049
36 Ga0070679_100028958 3300005530 Bacteria 5463
37 Ga0070679_100053779 3300005530 Bacteria 4008
38 Ga0070679_100148106 3300005530 Bacteria 2325
39 Ga0070684_100198238 3300005535 Bacteria 1828
40 Ga0070697_100133115 3300005536 Bacteria 2086
41 Ga0068853_100097326 3300005539 Bacteria 2597
42 Ga0068853_100326202 3300005539 Bacteria 1424
43 Ga0070686_100085638 3300005544 Unclassified 2096
44 Ga0070695_100026405 3300005545 Bacteria 3592
45 Ga0070665_100004850 3300005548 Bacteria 13977
46 Ga0070665_100009408 3300005548 Bacteria 9890
47 Ga0070665_100019793 3300005548 Bacteria 6757
48 Ga0070665_100061097 3300005548 Bacteria 3777
49 Ga0070665_100107949 3300005548 Bacteria 2786
50 Ga0070665_100151476 3300005548 Bacteria 2322
51 Ga0070665_100172827 3300005548 Bacteria 2161
52 Ga0070665_100266188 3300005548 Bacteria 1715
53 Ga0068855_100000456 3300005563 Bacteria 50301
54 Ga0068855_100042393 3300005563 Bacteria 5392
55 Ga0068855_100052408 3300005563 Bacteria 4803
56 Ga0068855_100214883 3300005563 Bacteria 2159
57 Ga0068855_100308973 3300005563 Bacteria 1750
58 Ga0070664_100065265 3300005564 Bacteria 3105
59 Ga0068857_100045550 3300005577 Bacteria 3892
60 Ga0068856_100044148 3300005614 Bacteria 4385
61 Ga0068859_100020031 3300005617 Bacteria 6717
62 Ga0068859_100409726 3300005617 Bacteria 1451
63 Ga0068851_10074340 3300005834 Unclassified 1764
64 Ga0068863_100007033 3300005841 Bacteria 11025
65 Ga0068863_100015599 3300005841 Bacteria 7299
66 Ga0068863_100050965 3300005841 Bacteria 3924
67 Ga0068858_100000542 3300005842 Bacteria 39272
68 Ga0068858_100005019 3300005842 Bacteria 12969
69 Ga0068858_100023857 3300005842 Bacteria 5699
70 Ga0068858_100226650 3300005842 Bacteria 1771
71 Ga0068858_100263092 3300005842 Bacteria 1640
72 Ga0068860_100001034 3300005843 Bacteria 30629
73 Ga0068860_100004915 3300005843 Bacteria 13619
74 Ga0068860_100179993 3300005843 Bacteria 2043
75 Ga0068862_100032154 3300005844 Bacteria 4432
76 Ga0081455_10001725 3300005937 Bacteria 26473
77 Ga0081455_10037419 3300005937 Bacteria 4310
78 Ga0081455_10054516 3300005937 Bacteria 3407
79 Ga0081539_10003921 3300005985 Bacteria 17277
80 Ga0081539_10004477 3300005985 Bacteria 15388
81 Ga0075365_10087909 3300006038 Unclassified 2113
82 Ga0075364_10083393 3300006051 Bacteria 2115
83 Ga0070715_10001423 3300006163 Bacteria 6928
84 Ga0070716_100044238 3300006173 Bacteria 2494
85 Ga0070712_100070729 3300006175 Bacteria 2494
86 Ga0070712_100183848 3300006175 Unclassified 1631
87 Ga0075362_10005463 3300006177 Bacteria 4652
88 Ga0075362_10011850 3300006177 Bacteria 3445
89 Ga0075367_10094668 3300006178 Bacteria 1821
90 Ga0075369_10004840 3300006186 Bacteria 5010
91 Ga0075366_10010533 3300006195 Bacteria 5192
92 Ga0097621_100062095 3300006237 Unclassified 3067
93 Ga0068871_100051163 3300006358 Plasmid 3344
94 Ga0068871_100062057 3300006358 Bacteria 3054
95 Ga0068871_100063310 3300006358 Bacteria 3025
96 Ga0097620_100020032 3300006931 Bacteria 6717
97 Ga0097620_100409725 3300006931 Bacteria 1451
98 Ga0105240_10000420 3300009093 Bacteria 78578
99 Ga0105240_10006821 3300009093 Bacteria 16702
100 Ga0105240_10015909 3300009093 Bacteria 10206
101 Ga0105240_10018310 3300009093 Bacteria 9413
102 Ga0105240_10064440 3300009093 Bacteria 4554
103 Ga0105240_10066081 3300009093 Bacteria 4488
104 Ga0105240_10076621 3300009093 Bacteria 4122
105 Ga0105240_10090871 3300009093 Bacteria 3731
106 Ga0105240_10135897 3300009093 Bacteria 2945
107 Ga0105240_10168712 3300009093 Unclassified 2594
108 Ga0111539_10572683 3300009094 Bacteria 1315
109 Ga0105245_10027152 3300009098 Bacteria 5043
110 Ga0105247_10000359 3300009101 Bacteria 39147
111 Ga0105247_10082029 3300009101 Unclassified 2034
112 Ga0105241_10505957 3300009174 Bacteria 1078
113 Ga0105242_10002762 3300009176 Bacteria 13735
114 Ga0105248_10035899 3300009177 Bacteria 5545
115 Ga0105248_10061836 3300009177 Bacteria 4205
116 Ga0105237_10135637 3300009545 Bacteria 2455
117 Ga0105237_10196815 3300009545 Bacteria 2015
118 Ga0105238_10001541 3300009551 Bacteria 23092
119 Ga0105238_10056394 3300009551 Bacteria 3942
120 Ga0105238_10113339 3300009551 Unclassified 2691
121 Ga0105238_10220777 3300009551 Unclassified 1871
122 Ga0105249_10018075 3300009553 Bacteria 6267
123 Ga0105249_10036911 3300009553 Bacteria 4434
124 Ga0105035_101723 3300009988 Bacteria 1545
125 Ga0099796_10034563 3300010159 Unclassified 1670
126 Ga0105239_10039820 3300010375 Bacteria 5149
127 Ga0105239_10206848 3300010375 Bacteria 2199
128 Ga0105239_10286479 3300010375 Unclassified 1855
129 Ga0105246_10047687 3300011119 Bacteria 2927
130 Ga0157370_10017473 3300013104 Bacteria 7237
131 Ga0157370_10055563 3300013104 Bacteria 3771
132 Ga0157369_10011238 3300013105 Bacteria 10176
133 Ga0157369_10179502 3300013105 Unclassified 2228
134 Ga0157378_10016752 3300013297 Bacteria 6421
135 Ga0157372_10019757 3300013307 Bacteria 7260
136 Ga0157372_10150017 3300013307 Bacteria 2690
137 Ga0157372_10519095 3300013307 Bacteria 1389
138 Ga0163163_10062455 3300014325 Bacteria 3691
139 Ga0182008_10015029 3300014497 Bacteria 4047
140 Ga0157379_10067384 3300014968 Bacteria 3200
141 Ga0157379_10115802 3300014968 Unclassified 2410
142 Ga0157379_10344768 3300014968 Unclassified 1363
143 Ga0157376_10076274 3300014969 Bacteria 2864
144 Ga0182007_10008070 3300015262 Bacteria 4348
145 Ga0206353_10462851 3300020082 Bacteria 1325
146 Ga0213874_10000509 3300021377 Bacteria 7798
147 Ga0213871_10003393 3300021441 Bacteria 3064
148 Ga0209026_1000010 3300025250 Bacteria 511986
149 Ga0209130_1000327 3300025284 Bacteria 54775
150 Ga0207426_1010390 3300025302 Bacteria 3614
151 Ga0207692_10045489 3300025898 Bacteria 2196
152 Ga0207710_10005711 3300025900 Bacteria 5343
153 Ga0207710_10088233 3300025900 Unclassified 1448
154 Ga0207647_10084671 3300025904 Unclassified 1897
155 Ga0207685_10009080 3300025905 Bacteria 2871
156 Ga0207699_10001022 3300025906 Bacteria 13212
157 Ga0207699_10091672 3300025906 Bacteria 1909
158 Ga0207705_10031713 3300025909 Bacteria 3774
159 Ga0207684_10205849 3300025910 Bacteria 1697
160 Ga0207707_10080546 3300025912 Bacteria 2844
161 Ga0207707_10095791 3300025912 Bacteria 2594
162 Ga0207707_10189435 3300025912 Bacteria 1795
163 Ga0207695_10017905 3300025913 Bacteria 8207
164 Ga0207695_10032020 3300025913 Bacteria 5759
165 Ga0207695_10044617 3300025913 Bacteria 4713
166 Ga0207695_10076166 3300025913 Bacteria 3411
167 Ga0207695_10080892 3300025913 Bacteria 3289
168 Ga0207695_10081416 3300025913 Bacteria 3276
169 Ga0207695_10160414 3300025913 Unclassified 2181
170 Ga0207671_10083552 3300025914 Bacteria 2397
171 Ga0207693_10000673 3300025915 Bacteria 30672
172 Ga0207649_10010921 3300025920 Bacteria 4994
173 Ga0207652_10022444 3300025921 Bacteria 5222
174 Ga0207652_10136236 3300025921 Bacteria 2193
175 Ga0207694_10029976 3300025924 Bacteria 4154
176 Ga0207694_10154659 3300025924 Bacteria 1849
177 Ga0207694_10214025 3300025924 Bacteria 1570
178 Ga0207659_10272656 3300025926 Bacteria 1380
179 Ga0207700_10098246 3300025928 Bacteria 2328
180 Ga0207644_10228420 3300025931 Bacteria 1478
181 Ga0207690_10022316 3300025932 Bacteria 3935
182 Ga0207690_10186181 3300025932 Bacteria 1567
183 Ga0207665_10013173 3300025939 Bacteria 5438
184 Ga0207665_10143096 3300025939 Bacteria 1707
185 Ga0207691_10129865 3300025940 Bacteria 2226
186 Ga0207711_10424772 3300025941 Unclassified 1236
187 Ga0207667_10001926 3300025949 Bacteria 26045
188 Ga0207667_10026338 3300025949 Bacteria 6356
189 Ga0207667_10044995 3300025949 Bacteria 4675
190 Ga0207667_10051462 3300025949 Bacteria 4342
191 Ga0207667_10169519 3300025949 Bacteria 2244
192 Ga0207667_10377407 3300025949 Bacteria 1445
193 Ga0207651_10051268 3300025960 Bacteria 2807
194 Ga0207658_10075450 3300025986 Unclassified 2565
195 Ga0207703_10001716 3300026035 Bacteria 19682
196 Ga0207678_10284715 3300026067 Unclassified 1419
197 Ga0207702_10036824 3300026078 Bacteria 4093
198 Ga0207702_10074949 3300026078 Bacteria 2922
199 Ga0207641_10000106 3300026088 Bacteria 121316
200 Ga0207648_10121731 3300026089 Bacteria 2294
201 Ga0207674_10043086 3300026116 Bacteria 4655
202 Ga0207683_10018935 3300026121 Bacteria 5874
203 Ga0268266_10002158 3300028379 Bacteria 21584
204 Ga0268266_10002983 3300028379 Bacteria 17447
205 Ga0268266_10027913 3300028379 Bacteria 4800
206 Ga0268266_10073944 3300028379 Bacteria 2959
207 Ga0268266_10447565 3300028379 Bacteria 1227
208 Ga0268264_10000188 3300028381 Bacteria 129042
209 Ga0265334_10015508 3300028573 Bacteria 3163
210 Ga0307515_10068007 3300028794 Bacteria 4903
211 Ga0307511_10000348 3300030521 Bacteria 49134
212 Ga0307511_10011017 3300030521 Bacteria 8926
213 Ga0265332_10034756 3300031238 Bacteria 2190
214 Ga0265340_10004596 3300031247 Bacteria 7684
215 Ga0307509_10000002 3300031507 Bacteria 607551
216 Ga0307509_10229853 3300031507 Bacteria 1659
217 Ga0307508_10184778 3300031616 Bacteria 1687
218 Ga0307406_10096093 3300031901 Bacteria 2007
219 Ga0307416_100358274 3300032002 Bacteria 1480
220 Ga0373936_0001707 3300035113 Bacteria 8062
221 Ga0373931_0025111 3300035691 Bacteria 3026
222 Ga0373927_0077965 3300035695 Bacteria 2146
223 Ga0373927_0135910 3300035695 Bacteria 1607
224 Ga0373937_0026169 3300036401 Bacteria 5272
225 Ga0373937_0030721 3300036401 Bacteria 4865
226 Ga0373925_0080892 3300037068 Bacteria 2470
227 Ga0395899_0009795 3300037312 Bacteria 7353
228 Ga0395899_0016573 3300037312 Bacteria 5620
229 Ga0395899_0068673 3300037312 Bacteria 2598
230 Ga0395900_0007979 3300037418 Bacteria 10895
231 Ga0395900_0012665 3300037418 Bacteria 8623
232 Ga0395898_0006242 3300037466 Bacteria 12763
233 Ga0395898_0108924 3300037466 Bacteria 2656
234 Ga0395898_0247371 3300037466 Bacteria 1700
235 Ga0395905_0174106 3300037471 Bacteria 2021
236 Ga0395901_0002054 3300038443 Bacteria 20648
237 Ga0395901_0003392 3300038443 Bacteria 16043
238 Ga0395901_0151759 3300038443 Bacteria 2434
239 Ga0395901_0345533 3300038443 Bacteria 1536
240 Ga0436360_1021191 3300039438 Unclassified 1716
241 Ga0436360_1376989 3300039438 Bacteria 11305
242 Ga0436361_0685736 3300039447 Bacteria 2320
243 Ga0436363_1569227 3300039450 Bacteria 9740
244 Ga0436363_1676543 3300039450 Bacteria 1145
245 Ga0436362_0082311 3300039453 Bacteria 5594
246 Ga0436362_1130171 3300039453 Bacteria 2657
247 Ga0466969_0005906 3300044656 Bacteria 6510
248 Ga0466969_0007699 3300044656 Bacteria 5729
249 Ga0466961_0003120 3300044693 Bacteria 10312
250 Ga0466961_0067386 3300044693 Bacteria 2274
251 Ga0466964_0003100 3300044706 Bacteria 6048
252 Ga0466971_0000538 3300044719 Bacteria 15029
253 Ga0466970_0018079 3300044765 Bacteria 3648
254 Ga0466957_0053972 3300044842 Bacteria 2451
255 Ga0466960_0027673 3300044901 Bacteria 2589
256 Ga0466959_0025140 3300045049 Bacteria 4411
257 Ga0466959_0118174 3300045049 Unclassified 1887
258 Ga0466959_0151720 3300045049 Bacteria 1633
259 Ga0466958_0112415 3300045836 Bacteria 1701
260 Ga0495580_0004619 3300046472 Bacteria 11560
261 Ga0495580_0090088 3300046472 Bacteria 2135
262 Ga0495618_0147181 3300046514 Unclassified 1505
263 Ga0495632_0070560 3300046519 Unclassified 1680
264 Ga0495668_0201330 3300046616 Unclassified 1090
265 Ga0495687_043727 3300047443 Bacteria 1950
266 Ga0496102_0006186 3300048905 Bacteria 10204
267 Ga0496102_0115253 3300048905 Bacteria 2507
268 Ga0496103_0019493 3300048906 Bacteria 4074
269 Ga0496103_0101083 3300048906 Bacteria 1825
270 Ga0496105_0211780 3300048908 Bacteria 1580
271 Ga0496107_0005388 3300048910 Bacteria 8753
272 Ga0496110_0010247 3300048913 Bacteria 7614
273 Ga0496111_0056794 3300048914 Bacteria 2833
274 Ga0496112_0048367 3300048915 Bacteria 4170
275 Ga0496114_0013758 3300048917 Bacteria 6485
276 Ga0496115_0153396 3300048918 Bacteria 1902
277 Ga0496116_0007140 3300048919 Bacteria 9992
278 Ga0496117_0000110 3300048920 Bacteria 184627
279 Ga0496118_0000014 3300048921 Bacteria 561628
280 Ga0496119_0000203 3300048922 Bacteria 84250
281 Ga0496119_0052522 3300048922 Bacteria 2495
282 Ga0496119_0093099 3300048922 Unclassified 1708
283 Ga0496119_0242124 3300048922 Unclassified 913
284 Ga0496120_0000018 3300048923 Bacteria 263952
285 Ga0496120_0089741 3300048923 Bacteria 1644
286 Ga0496120_0153418 3300048923 Unclassified 1155
287 Ga0496121_0001306 3300048924 Bacteria 42785
288 Ga0496121_0143923 3300048924 Unclassified 1764
289 Ga0496124_0032798 3300048927 Bacteria 4580
290 Ga0496125_0000568 3300048928 Bacteria 63393
291 Ga0496125_0005340 3300048928 Bacteria 14354
292 Ga0496125_0143029 3300048928 Unclassified 1659
293 Ga0496126_0019198 3300048929 Bacteria 6738
294 Ga0501032_0014065 3300049569 Bacteria 5677
295 Ga0501034_0001246 3300049571 Bacteria 34606
296 Ga0501034_0001285 3300049571 Bacteria 33952
297 Ga0501034_0139025 3300049571 Bacteria 2409
298 Ga0501034_0248718 3300049571 Bacteria 1723
299 Ga0501037_0129548 3300049573 Bacteria 1810
300 Ga0501043_0012714 3300049579 Bacteria 6581
301 Ga0501046_0009097 3300049580 Bacteria 8608
302 Ga0501047_0024895 3300049581 Bacteria 5748
303 Ga0501047_0111712 3300049581 Bacteria 2615
304 Ga0501068_0019566 3300049584 Bacteria 3934
305 Ga0501044_0065928 3300049823 Bacteria 3693
306 nmdc:mga03683_405_c2 3300050489 Bacteria 8154
307 nmdc:mga0yw44_152268_c1 3300050492 Bacteria 1509
308 nmdc:mga0yw44_21392_c1 3300050492 Bacteria 3607
309 nmdc:mga06z11_77756_c1 3300050494 Bacteria 1772
310 nmdc:mga07m45_62144_c1 3300050496 Unclassified 2116
311 nmdc:mga08y16_785780_c1 3300050511 Bacteria 946
312 nmdc:mga0sz30_1802_c1 3300050516 Bacteria 7615
313 nmdc:mga0sz30_4471_c2 3300050516 Bacteria 4614
314 Ga0500644_0006737 3300053088 Bacteria 2959
315 Ga0500644_0059544 3300053088 Unclassified 1340
316 Ga0500583_0001345 3300053092 Bacteria 7024
317 Ga0500583_0074249 3300053092 Bacteria 1631
318 Ga0500651_0028041 3300053093 Bacteria 3541
319 Ga0500651_0163955 3300053093 Unclassified 1328
320 Ga0500641_0003063 3300053096 Bacteria 5928
321 Ga0500588_0008545 3300053146 Unclassified 2397
322 Ga0500616_0012975 3300053153 Bacteria 4853
323 Ga0500622_0035807 3300053156 Unclassified 2596
324 Ga0500637_0038445 3300053178 Bacteria 2696
325 Ga0466962_0014340 3300061719 Bacteria 3819
326 2538834080 2537561836 Bacteria 3910579
327 2643828996 2643221562 Bacteria 4048635
328 2643895827 2643221577 Bacteria 3710843
329 2644478019 2643221685 Bacteria 3673288
330 2834580959 2834578030 Bacteria 3530182
331 2841764601 2841760612 Bacteria 6454112
332 2844107951 2844104063 Bacteria 6440972
333 2851187882 2851182111 Bacteria 6047226
334 2851250057 2851246043 Bacteria 6439203
335 8057533347 8057529695 Bacteria 6306553
336 Ga0466969_0064552
337 rootL2_10082985
338 Ga0065165_1000132
339 Ga0070658_10004845
340 Ga0070683_100048777
341 Ga0070683_100208036
342 Ga0070666_10006053
343 Ga0070682_100058587
344 Ga0068868_100084470
345 Ga0070661_100019304
346 Ga0070671_100002471
347 Ga0070671_100052893
348 Ga0070673_100030920
349 Ga0070667_100019356
350 Ga0070667_100094182
351 Ga0070667_100196671
352 Ga0070714_100125247
353 Ga0070713_100000397
354 Ga0070713_100028752
355 Ga0070713_100051968
356 Ga0070710_10031700
357 Ga0070711_100095159
358 Ga0070705_100046086
359 Ga0070708_100044953
360 Ga0070678_100011994
361 Ga0070681_10004986
362 Ga0070681_10006133
363 Ga0070681_10029396
364 Ga0070681_10192364
365 Ga0068867_100140656
366 Ga0070706_100034527
367 Ga0070698_100005048
368 Ga0070699_100029046
369 Ga0070699_100143135
370 Ga0070699_100551732
371 Ga0070679_100028958
372 Ga0070679_100053779
373 Ga0070679_100148106
374 Ga0070684_100198238
375 Ga0070697_100133115
376 Ga0068853_100097326
377 Ga0068853_100326202
378 Ga0070686_100085638
379 Ga0070695_100026405
380 Ga0070665_100004850
381 Ga0070665_100009408
382 Ga0070665_100019793
383 Ga0070665_100061097
384 Ga0070665_100107949
385 Ga0070665_100151476
386 Ga0070665_100172827
387 Ga0070665_100266188
388 Ga0068855_100000456
389 Ga0068855_100042393
390 Ga0068855_100052408
391 Ga0068855_100214883
392 Ga0068855_100308973
393 Ga0070664_100065265
394 Ga0068857_100045550
395 Ga0068856_100044148
396 Ga0068859_100020031
397 Ga0068859_100409726
398 Ga0068851_10074340
399 Ga0068863_100007033
400 Ga0068863_100015599
401 Ga0068863_100050965
402 Ga0068858_100000542
403 Ga0068858_100005019
404 Ga0068858_100023857
405 Ga0068858_100226650
406 Ga0068858_100263092
407 Ga0068860_100001034
408 Ga0068860_100004915
409 Ga0068860_100179993
410 Ga0068862_100032154
411 Ga0081455_10001725
412 Ga0081455_10037419
413 Ga0081455_10054516
414 Ga0081539_10003921
415 Ga0081539_10004477
416 Ga0075365_10087909
417 Ga0075364_10083393
418 Ga0070715_10001423
419 Ga0070716_100044238
420 Ga0070712_100070729
421 Ga0070712_100183848
422 Ga0075362_10005463
423 Ga0075362_10011850
424 Ga0075367_10094668
425 Ga0075369_10004840
426 Ga0075366_10010533
427 Ga0097621_100062095
428 Ga0068871_100051163
429 Ga0068871_100062057
430 Ga0068871_100063310
431 Ga0097620_100020032
432 Ga0097620_100409725
433 Ga0105240_10000420
434 Ga0105240_10006821
435 Ga0105240_10015909
436 Ga0105240_10018310
437 Ga0105240_10064440
438 Ga0105240_10066081
439 Ga0105240_10076621
440 Ga0105240_10090871
441 Ga0105240_10135897
442 Ga0105240_10168712
443 Ga0111539_10572683
444 Ga0105245_10027152
445 Ga0105247_10000359
446 Ga0105247_10082029
447 Ga0105241_10505957
448 Ga0105242_10002762
449 Ga0105248_10035899
450 Ga0105248_10061836
451 Ga0105237_10135637
452 Ga0105237_10196815
453 Ga0105238_10001541
454 Ga0105238_10056394
455 Ga0105238_10113339
456 Ga0105238_10220777
457 Ga0105249_10018075
458 Ga0105249_10036911
459 Ga0105035_101723
460 Ga0099796_10034563
461 Ga0105239_10039820
462 Ga0105239_10206848
463 Ga0105239_10286479
464 Ga0105246_10047687
465 Ga0157370_10017473
466 Ga0157370_10055563
467 Ga0157369_10011238
468 Ga0157369_10179502
469 Ga0157378_10016752
470 Ga0157372_10019757
471 Ga0157372_10150017
472 Ga0157372_10519095
473 Ga0163163_10062455
474 Ga0182008_10015029
475 Ga0157379_10067384
476 Ga0157379_10115802
477 Ga0157379_10344768
478 Ga0157376_10076274
479 Ga0182007_10008070
480 Ga0206353_10462851
481 Ga0213874_10000509
482 Ga0213871_10003393
483 Ga0209026_1000010
484 Ga0209130_1000327
485 Ga0207426_1010390
486 Ga0207692_10045489
487 Ga0207710_10005711
488 Ga0207710_10088233
489 Ga0207647_10084671
490 Ga0207685_10009080
491 Ga0207699_10001022
492 Ga0207699_10091672
493 Ga0207705_10031713
494 Ga0207684_10205849
495 Ga0207707_10080546
496 Ga0207707_10095791
497 Ga0207707_10189435
498 Ga0207695_10017905
499 Ga0207695_10032020
500 Ga0207695_10044617
501 Ga0207695_10076166
502 Ga0207695_10080892
503 Ga0207695_10081416
504 Ga0207695_10160414
505 Ga0207671_10083552
506 Ga0207693_10000673
507 Ga0207649_10010921
508 Ga0207652_10022444
509 Ga0207652_10136236
510 Ga0207694_10029976
511 Ga0207694_10154659
512 Ga0207694_10214025
513 Ga0207659_10272656
514 Ga0207700_10098246
515 Ga0207644_10228420
516 Ga0207690_10022316
517 Ga0207690_10186181
518 Ga0207665_10013173
519 Ga0207665_10143096
520 Ga0207691_10129865
521 Ga0207711_10424772
522 Ga0207667_10001926
523 Ga0207667_10026338
524 Ga0207667_10044995
525 Ga0207667_10051462
526 Ga0207667_10169519
527 Ga0207667_10377407
528 Ga0207651_10051268
529 Ga0207658_10075450
530 Ga0207703_10001716
531 Ga0207678_10284715
532 Ga0207702_10036824
533 Ga0207702_10074949
534 Ga0207641_10000106
535 Ga0207648_10121731
536 Ga0207674_10043086
537 Ga0207683_10018935
538 Ga0268266_10002158
539 Ga0268266_10002983
540 Ga0268266_10027913
541 Ga0268266_10073944
542 Ga0268266_10447565
543 Ga0268264_10000188
544 Ga0265334_10015508
545 Ga0307515_10068007
546 Ga0307511_10000348
547 Ga0307511_10011017
548 Ga0265332_10034756
549 Ga0265340_10004596
550 Ga0307509_10000002
551 Ga0307509_10229853
552 Ga0307508_10184778
553 Ga0307406_10096093
554 Ga0307416_100358274
555 Ga0373936_0001707
556 Ga0373931_0025111
557 Ga0373927_0077965
558 Ga0373927_0135910
559 Ga0373937_0026169
560 Ga0373937_0030721
561 Ga0373925_0080892
562 Ga0395899_0009795
563 Ga0395899_0016573
564 Ga0395899_0068673
565 Ga0395900_0007979
566 Ga0395900_0012665
567 Ga0395898_0006242
568 Ga0395898_0108924
569 Ga0395898_0247371
570 Ga0395905_0174106
571 Ga0395901_0002054
572 Ga0395901_0003392
573 Ga0395901_0151759
574 Ga0395901_0345533
575 Ga0436360_1021191
576 Ga0436360_1376989
577 Ga0436361_0685736
578 Ga0436363_1569227
579 Ga0436363_1676543
580 Ga0436362_0082311
581 Ga0436362_1130171
582 Ga0466969_0005906
583 Ga0466969_0007699
584 Ga0466961_0003120
585 Ga0466961_0067386
586 Ga0466964_0003100
587 Ga0466971_0000538
588 Ga0466970_0018079
589 Ga0466957_0053972
590 Ga0466960_0027673
591 Ga0466959_0025140
592 Ga0466959_0118174
593 Ga0466959_0151720
594 Ga0466958_0112415
595 Ga0495580_0004619
596 Ga0495580_0090088
597 Ga0495618_0147181
598 Ga0495632_0070560
599 Ga0495668_0201330
600 Ga0495687_043727
601 Ga0496102_0006186
602 Ga0496102_0115253
603 Ga0496103_0019493
604 Ga0496103_0101083
605 Ga0496105_0211780
606 Ga0496107_0005388
607 Ga0496110_0010247
608 Ga0496111_0056794
609 Ga0496112_0048367
610 Ga0496114_0013758
611 Ga0496115_0153396
612 Ga0496116_0007140
613 Ga0496117_0000110
614 Ga0496118_0000014
615 Ga0496119_0000203
616 Ga0496119_0052522
617 Ga0496119_0093099
618 Ga0496119_0242124
619 Ga0496120_0000018
620 Ga0496120_0089741
621 Ga0496120_0153418
622 Ga0496121_0001306
623 Ga0496121_0143923
624 Ga0496124_0032798
625 Ga0496125_0000568
626 Ga0496125_0005340
627 Ga0496125_0143029
628 Ga0496126_0019198
629 Ga0501032_0014065
630 Ga0501034_0001246
631 Ga0501034_0001285
632 Ga0501034_0139025
633 Ga0501034_0248718
634 Ga0501037_0129548
635 Ga0501043_0012714
636 Ga0501046_0009097
637 Ga0501047_0024895
638 Ga0501047_0111712
639 Ga0501068_0019566
640 Ga0501044_0065928
641 nmdc:mga03683_405_c2
642 nmdc:mga0yw44_152268_c1
643 nmdc:mga0yw44_21392_c1
644 nmdc:mga06z11_77756_c1
645 nmdc:mga07m45_62144_c1
646 nmdc:mga08y16_785780_c1
647 nmdc:mga0sz30_1802_c1
648 nmdc:mga0sz30_4471_c2
649 Ga0500644_0006737
650 Ga0500644_0059544
651 Ga0500583_0001345
652 Ga0500583_0074249
653 Ga0500651_0028041
654 Ga0500651_0163955
655 Ga0500641_0003063
656 Ga0500588_0008545
657 Ga0500616_0012975
658 Ga0500622_0035807
659 Ga0500637_0038445
660 Ga0466962_0014340
661 2538834080
662 2643828996
663 2643895827
664 2644478019
665 2834580959
666 2841764601
667 2844107951
668 2851187882
669 2851250057
670 8057533347

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00899

ThiF

ThiF family

5

217

0.97

PF00581

Rhodanese

Rhodanese-like domain

271

348

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jwa-assembly1.cif.gz_B-2 structure of the atp-bound moeb-moad protein complex 0.969 2 220
7sol-assembly1.cif.gz_A crystal structures of the bispecific ubiquitin/fat10 activating enzyme, uba6 0.9501 11 158
7pvn-assembly1.cif.gz_A crystal structure of human uba6 in complex with atp 0.9499 11 157
6o82-assembly1.cif.gz_A s. pombe ubiquitin e1 complex with a ubiquitin-amp mimic 0.9496 7 156
7pvn-assembly2.cif.gz_B crystal structure of human uba6 in complex with atp 0.949 11 158
ID Description Score Start End Superfamily
af_Q6H7A7_75_268_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9863 2 150 3.40.50.720
af_A0A1D6II59_3_109_3.50.50.80 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;Ubiquitin-activating enzyme E1, inactive adenylation domain, subdomain 1 0.9642 11 94 3.50.50.80
af_L7N674_15_263_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9597 2 222 3.40.50.720
af_O44510_10_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9497 2 228 3.40.50.720
1jwbB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9494 2 228 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2J0N1C4-F1-model_v4 Adenylyltransferase 0.9956 2 96 GO:0004792
GO:0005829
GO:0008146
GO:0008641
GO:0016779
AF-A0A356FT47-F1-model_v4 THIF-type NAD/FAD binding fold domain-containing protein 0.9953 2 127 GO:0004792
GO:0005829
GO:0008146
GO:0008641
GO:0016779
AF-A0A2S5NTV2-F1-model_v4 Molybdopterin biosynthesis protein MoeB 0.9951 2 91 GO:0004792
GO:0005737
GO:0016779
GO:0042292
AF-A0A349E792-F1-model_v4 THIF-type NAD/FAD binding fold domain-containing protein 0.9934 2 95 GO:0004792
GO:0005829
GO:0008146
GO:0008641
GO:0016779
AF-A0A3C0GNI2-F1-model_v4 Molybdopterin biosynthesis protein MoeB 0.993 2 135 GO:0004792
GO:0005524
GO:0005829
GO:0008146
GO:0008641
GO:0016779

Map