F412408

General Info

Members Datasets Scaffolds Average Seq Length
335 145 670 173

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0051475|Ga0496110_0051475_488_1111
Length 207
Sequence MGRKLTFNRPAGTSDENRHLISRRTGFGAGLAREVVMMKSFLFSLGLLAFSVPAAAAGGPTDPQIAHIAYTAGTIDIAAAEQALARSHNKAVRDFAQGMVRDHKAVNDKALALVKKLHVTPEPNPTSAGLSKSAAATLKRLSHLHGPAFDRAYAENEVAYHRTVNGALSTTLIPSASNAELKSLLSTGLTLFQEHQAHAEQLVKELK

Samples

Sample ID Description Type Environment
1 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
61 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
106 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
114 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
122 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.61
Metatranscriptomes 2.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 3.88
Rhizosphere 95.22
Stem 0
Stem Tuber 0
Unclassified 8.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496110_0051475 3300048913 Bacteria 3619
2 JGI24736J21556_1000117 3300001904 Bacteria 13577
3 JGI24736J21556_1006851 3300001904 Bacteria 1917
4 JGI24741J21665_1006677 3300001915 Bacteria 2296
5 JGI24741J21665_1010128 3300001915 Bacteria 1702
6 JGI24740J21852_10004032 3300001979 Bacteria 6358
7 JGI24740J21852_10038234 3300001979 Bacteria 1474
8 JGI24740J21852_10038744 3300001979 Bacteria 1459
9 JGI24740J21852_10041986 3300001979 Bacteria 1374
10 JGI24739J22299_10064117 3300001989 Bacteria 1155
11 JGI24737J22298_10022218 3300001990 Bacteria 2016
12 JGI24737J22298_10047574 3300001990 Bacteria 1307
13 JGI24735J21928_10008058 3300002067 Bacteria 3420
14 rootH2_10144827 3300003320 Bacteria 1960
15 rootH1_10034718 3300003323 Bacteria 4110
16 Ga0070683_100259377 3300005329 Bacteria 1653
17 Ga0070683_100283461 3300005329 Bacteria 1576
18 Ga0070670_100231160 3300005331 Bacteria 1609
19 Ga0070680_100004470 3300005336 Bacteria 10532
20 Ga0070680_100010643 3300005336 Bacteria 7095
21 Ga0070660_100001347 3300005339 Bacteria 16688
22 Ga0070660_100132106 3300005339 Bacteria 1998
23 Ga0070660_100404870 3300005339 Bacteria 1129
24 Ga0070660_100621589 3300005339 Bacteria 904
25 Ga0070661_100119074 3300005344 Bacteria 1976
26 Ga0070661_100185326 3300005344 Bacteria 1585
27 Ga0070661_101333347 3300005344 Bacteria 602
28 Ga0070692_10051871 3300005345 Bacteria 2135
29 Ga0070668_100126959 3300005347 Bacteria 2044
30 Ga0070671_100095470 3300005355 Bacteria 2492
31 Ga0070671_100105429 3300005355 Bacteria 2366
32 Ga0070674_100445936 3300005356 Unclassified 1067
33 Ga0070673_101165813 3300005364 Unclassified 721
34 Ga0070659_100005514 3300005366 Bacteria 9088
35 Ga0070659_100094939 3300005366 Bacteria 2395
36 Ga0070714_100041839 3300005435 Bacteria 3868
37 Ga0070714_100090546 3300005435 Bacteria 2679
38 Ga0070714_100258802 3300005435 Bacteria 1611
39 Ga0070714_100542855 3300005435 Bacteria 1112
40 Ga0070714_100547680 3300005435 Bacteria 1107
41 Ga0070713_100008342 3300005436 Bacteria 7347
42 Ga0070713_100999882 3300005436 Bacteria 807
43 Ga0070711_101181440 3300005439 Bacteria 661
44 Ga0070663_100182382 3300005455 Bacteria 1629
45 Ga0070663_100198639 3300005455 Unclassified 1564
46 Ga0070663_100556264 3300005455 Bacteria 960
47 Ga0070678_100543880 3300005456 Unclassified 1030
48 Ga0070662_100042609 3300005457 Bacteria 3243
49 Ga0070662_100072334 3300005457 Bacteria 2545
50 Ga0070681_10016990 3300005458 Bacteria 7271
51 Ga0070681_10464245 3300005458 Bacteria 1178
52 Ga0068867_100409854 3300005459 Unclassified 1145
53 Ga0068853_100025213 3300005539 Bacteria 4989
54 Ga0068853_100288467 3300005539 Bacteria 1514
55 Ga0070672_100096407 3300005543 Unclassified 2393
56 Ga0070693_100117867 3300005547 Bacteria 1643
57 Ga0068855_100015129 3300005563 Bacteria 9291
58 Ga0070664_100105201 3300005564 Bacteria 2458
59 Ga0070664_100155640 3300005564 Bacteria 2019
60 Ga0070664_100624269 3300005564 Bacteria 1000
61 Ga0068857_100005865 3300005577 Bacteria 10487
62 Ga0068857_100020042 3300005577 Bacteria 5879
63 Ga0068857_100979048 3300005577 Bacteria 813
64 Ga0068854_100158556 3300005578 Bacteria 1750
65 Ga0068854_100175205 3300005578 Bacteria 1671
66 Ga0068854_100176170 3300005578 Bacteria 1667
67 Ga0068854_100833154 3300005578 Unclassified 806
68 Ga0068856_100022339 3300005614 Bacteria 6149
69 Ga0068856_100511869 3300005614 Bacteria 1221
70 Ga0068856_100684003 3300005614 Bacteria 1046
71 Ga0068856_100771063 3300005614 Bacteria 982
72 Ga0068856_100911824 3300005614 Bacteria 898
73 Ga0068852_100019828 3300005616 Bacteria 5333
74 Ga0068852_100030521 3300005616 Bacteria 4438
75 Ga0068852_100039319 3300005616 Bacteria 3982
76 Ga0068852_100184784 3300005616 Bacteria 1962
77 Ga0068852_100220562 3300005616 Bacteria 1803
78 Ga0068852_100283756 3300005616 Bacteria 1597
79 Ga0068852_100373574 3300005616 Unclassified 1397
80 Ga0068851_10120603 3300005834 Bacteria 1409
81 Ga0068851_10124237 3300005834 Bacteria 1390
82 Ga0068851_10135653 3300005834 Bacteria 1334
83 Ga0068863_100427238 3300005841 Bacteria 1298
84 Ga0068860_100723418 3300005843 Unclassified 1006
85 Ga0070717_10012883 3300006028 Bacteria 6386
86 Ga0075365_10366967 3300006038 Bacteria 1015
87 Ga0068865_100015170 3300006881 Bacteria 4910
88 Ga0105240_10007155 3300009093 Bacteria 16257
89 Ga0105240_10297160 3300009093 Bacteria 1849
90 Ga0105241_10159554 3300009174 Bacteria 1852
91 Ga0105248_10017490 3300009177 Bacteria 7906
92 Ga0105248_10088944 3300009177 Bacteria 3476
93 Ga0105248_10212574 3300009177 Bacteria 2179
94 Ga0105237_10372543 3300009545 Bacteria 1433
95 Ga0105238_10026814 3300009551 Bacteria 5874
96 Ga0105239_10327387 3300010375 Bacteria 1728
97 Ga0105239_10409645 3300010375 Bacteria 1535
98 Ga0105239_10667564 3300010375 Bacteria 1188
99 Ga0157373_10003770 3300013100 Bacteria 11467
100 Ga0157373_10070448 3300013100 Bacteria 2471
101 Ga0157373_10073760 3300013100 Bacteria 2408
102 Ga0157371_10010561 3300013102 Bacteria 7177
103 Ga0157371_10219600 3300013102 Bacteria 1365
104 Ga0157371_10347453 3300013102 Bacteria 1079
105 Ga0157371_10366088 3300013102 Unclassified 1051
106 Ga0157370_10001815 3300013104 Bacteria 26338
107 Ga0157370_10124174 3300013104 Bacteria 2410
108 Ga0157370_10453037 3300013104 Bacteria 1179
109 Ga0157370_10508899 3300013104 Bacteria 1106
110 Ga0157370_11622224 3300013104 Bacteria 581
111 Ga0157369_10000256 3300013105 Bacteria 73068
112 Ga0157369_10001571 3300013105 Bacteria 27954
113 Ga0157369_10015792 3300013105 Bacteria 8506
114 Ga0157369_10314895 3300013105 Bacteria 1627
115 Ga0157369_10343973 3300013105 Bacteria 1549
116 Ga0157369_10588157 3300013105 Bacteria 1149
117 Ga0157374_10219218 3300013296 Bacteria 1867
118 Ga0163162_10141755 3300013306 Bacteria 2517
119 Ga0157372_10076275 3300013307 Bacteria 3785
120 Ga0157372_10113929 3300013307 Bacteria 3099
121 Ga0157372_10533037 3300013307 Bacteria 1369
122 Ga0157372_10648746 3300013307 Bacteria 1229
123 Ga0157372_10899455 3300013307 Bacteria 1027
124 Ga0163163_10055651 3300014325 Bacteria 3910
125 Ga0197907_10673626 3300020069 Bacteria 2135
126 Ga0206356_10267260 3300020070 Bacteria 1599
127 Ga0206355_1185753 3300020076 Bacteria 1255
128 Ga0206354_11529994 3300020081 Bacteria 820
129 Ga0154015_1027679 3300020610 Bacteria 577
130 Ga0154015_1120478 3300020610 Bacteria 1789
131 Ga0224712_10013540 3300022467 Bacteria 2600
132 Ga0207656_10120227 3300025321 Bacteria 1222
133 Ga0207656_10151562 3300025321 Bacteria 1098
134 Ga0207647_10002620 3300025904 Bacteria 13601
135 Ga0207647_10063010 3300025904 Bacteria 2257
136 Ga0207647_10143145 3300025904 Bacteria 1401
137 Ga0207685_10202793 3300025905 Unclassified 933
138 Ga0207705_10000003 3300025909 Bacteria 709270
139 Ga0207705_10014104 3300025909 Bacteria 5757
140 Ga0207705_10067943 3300025909 Bacteria 2580
141 Ga0207705_10197851 3300025909 Bacteria 1522
142 Ga0207654_10228010 3300025911 Bacteria 1239
143 Ga0207654_10720071 3300025911 Bacteria 718
144 Ga0207707_10130046 3300025912 Bacteria 2202
145 Ga0207695_10002589 3300025913 Bacteria 26529
146 Ga0207695_10004896 3300025913 Bacteria 18049
147 Ga0207695_10543194 3300025913 Bacteria 1044
148 Ga0207663_10493907 3300025916 Bacteria 950
149 Ga0207660_10009882 3300025917 Bacteria 6181
150 Ga0207660_10335071 3300025917 Bacteria 1210
151 Ga0207657_10002388 3300025919 Bacteria 20300
152 Ga0207657_10002957 3300025919 Bacteria 18228
153 Ga0207657_10030487 3300025919 Bacteria 4895
154 Ga0207657_10065465 3300025919 Bacteria 3098
155 Ga0207657_10164723 3300025919 Bacteria 1799
156 Ga0207649_10007823 3300025920 Bacteria 5815
157 Ga0207649_10106911 3300025920 Bacteria 1862
158 Ga0207652_10040251 3300025921 Bacteria 3968
159 Ga0207652_10835673 3300025921 Bacteria 816
160 Ga0207694_10081653 3300025924 Bacteria 2540
161 Ga0207694_11461585 3300025924 Bacteria 577
162 Ga0207650_10144845 3300025925 Bacteria 1870
163 Ga0207700_10079529 3300025928 Bacteria 2553
164 Ga0207664_10075556 3300025929 Bacteria 2724
165 Ga0207664_10121316 3300025929 Bacteria 2188
166 Ga0207664_10186714 3300025929 Bacteria 1783
167 Ga0207644_10025726 3300025931 Bacteria 4048
168 Ga0207644_10130094 3300025931 Bacteria 1926
169 Ga0207644_11204734 3300025931 Bacteria 636
170 Ga0207690_10029992 3300025932 Bacteria 3464
171 Ga0207690_10209161 3300025932 Bacteria 1486
172 Ga0207706_10025207 3300025933 Bacteria 5331
173 Ga0207706_10044200 3300025933 Bacteria 3949
174 Ga0207669_10323020 3300025937 Unclassified 1182
175 Ga0207704_10036634 3300025938 Bacteria 2824
176 Ga0207691_10023128 3300025940 Bacteria 5851
177 Ga0207711_10022420 3300025941 Bacteria 5280
178 Ga0207711_10139279 3300025941 Bacteria 2182
179 Ga0207711_10898900 3300025941 Unclassified 823
180 Ga0207679_10043607 3300025945 Bacteria 3231
181 Ga0207679_10284988 3300025945 Bacteria 1418
182 Ga0207679_10290944 3300025945 Bacteria 1404
183 Ga0207667_10016249 3300025949 Bacteria 8410
184 Ga0207667_10022365 3300025949 Bacteria 6987
185 Ga0207667_10071853 3300025949 Bacteria 3597
186 Ga0207667_10346473 3300025949 Bacteria 1515
187 Ga0207640_10001261 3300025981 Bacteria 13744
188 Ga0207640_10018303 3300025981 Bacteria 4115
189 Ga0207640_10127567 3300025981 Bacteria 1834
190 Ga0207640_10435879 3300025981 Unclassified 1076
191 Ga0207640_10769235 3300025981 Unclassified 832
192 Ga0207640_10862332 3300025981 Bacteria 789
193 Ga0207658_10168066 3300025986 Bacteria 1804
194 Ga0207639_10007563 3300026041 Bacteria 7409
195 Ga0207639_10048961 3300026041 Bacteria 3202
196 Ga0207678_10015645 3300026067 Bacteria 6668
197 Ga0207678_10046244 3300026067 Bacteria 3763
198 Ga0207702_10015728 3300026078 Bacteria 6264
199 Ga0207702_10063532 3300026078 Bacteria 3157
200 Ga0207702_10079131 3300026078 Bacteria 2848
201 Ga0207702_10165920 3300026078 Bacteria 2020
202 Ga0207702_10429005 3300026078 Unclassified 1279
203 Ga0207641_10022478 3300026088 Bacteria 5190
204 Ga0207648_10441367 3300026089 Unclassified 1184
205 Ga0207676_10339701 3300026095 Bacteria 1385
206 Ga0207674_10004573 3300026116 Bacteria 16617
207 Ga0207674_10015574 3300026116 Bacteria 8350
208 Ga0207674_10051270 3300026116 Bacteria 4212
209 Ga0207683_10297912 3300026121 Unclassified 1475
210 Ga0207698_10005143 3300026142 Bacteria 8042
211 Ga0207698_10012876 3300026142 Bacteria 5494
212 Ga0207698_10046089 3300026142 Bacteria 3289
213 Ga0207698_10398016 3300026142 Unclassified 1315
214 Ga0265331_10000007 3300031250 Bacteria 331074
215 Ga0307408_100304612 3300031548 Bacteria 1336
216 Ga0307406_10647193 3300031901 Bacteria 877
217 Ga0307409_100344178 3300031995 Bacteria 1404
218 Ga0307411_10412658 3300032005 Bacteria 1119
219 Ga0373930_0031764 3300034816 Bacteria 1090
220 Ga0373923_0139528 3300035111 Bacteria 1095
221 Ga0373935_0037678 3300035692 Bacteria 3026
222 Ga0395899_0000105 3300037312 Bacteria 146163
223 Ga0395899_0011331 3300037312 Bacteria 6830
224 Ga0395899_0175035 3300037312 Bacteria 1509
225 Ga0395899_0264252 3300037312 Unclassified 1176
226 Ga0395899_0323166 3300037312 Bacteria 1039
227 Ga0395899_0527135 3300037312 Bacteria 762
228 Ga0395900_0001979 3300037418 Bacteria 23128
229 Ga0395900_0020857 3300037418 Bacteria 6696
230 Ga0395900_0021017 3300037418 Bacteria 6670
231 Ga0395900_0037423 3300037418 Bacteria 5003
232 Ga0395900_0049937 3300037418 Bacteria 4309
233 Ga0395900_0089534 3300037418 Bacteria 3163
234 Ga0395900_0102845 3300037418 Bacteria 2934
235 Ga0395900_0178017 3300037418 Bacteria 2163
236 Ga0395900_0202020 3300037418 Bacteria 2010
237 Ga0395900_0533882 3300037418 Unclassified 1120
238 Ga0395900_0632479 3300037418 Bacteria 1008
239 Ga0395900_0906732 3300037418 Bacteria 804
240 Ga0395898_0033353 3300037466 Bacteria 5139
241 Ga0395898_0053268 3300037466 Plasmid 3952
242 Ga0395898_0120267 3300037466 Bacteria 2516
243 Ga0395898_0229479 3300037466 Bacteria 1770
244 Ga0395898_0645908 3300037466 Bacteria 1000
245 Ga0395898_0811632 3300037466 Bacteria 875
246 Ga0395905_0011281 3300037471 Bacteria 8637
247 Ga0395905_0023060 3300037471 Bacteria 5884
248 Ga0395905_0042666 3300037471 Bacteria 4256
249 Ga0395905_0579356 3300037471 Bacteria 1023
250 Ga0395905_0699794 3300037471 Bacteria 916
251 Ga0395901_0005588 3300038443 Bacteria 12729
252 Ga0395901_0005792 3300038443 Bacteria 12518
253 Ga0395901_0028431 3300038443 Bacteria 5749
254 Ga0395901_0230120 3300038443 Bacteria 1935
255 Ga0395901_0352515 3300038443 Bacteria 1518
256 Ga0395901_0449580 3300038443 Bacteria 1318
257 Ga0395901_0547442 3300038443 Bacteria 1173
258 Ga0395901_1575001 3300038443 Bacteria 611
259 Ga0466969_0002081 3300044656 Bacteria 10681
260 Ga0466969_0060432 3300044656 Bacteria 1842
261 Ga0466972_0129140 3300044658 Bacteria 1190
262 Ga0466972_0198266 3300044658 Bacteria 940
263 Ga0453683_0064819 3300044673 Bacteria 2284
264 Ga0466965_0060167 3300044683 Bacteria 1897
265 Ga0466965_0285829 3300044683 Bacteria 892
266 Ga0466966_0002468 3300044684 Bacteria 12107
267 Ga0466966_0011045 3300044684 Bacteria 5995
268 Ga0466966_0044674 3300044684 Bacteria 2836
269 Ga0466966_0070968 3300044684 Bacteria 2183
270 Ga0466966_0262204 3300044684 Bacteria 1040
271 Ga0466966_0572942 3300044684 Bacteria 679
272 Ga0466961_0100659 3300044693 Bacteria 1820
273 Ga0466961_0252363 3300044693 Unclassified 1083
274 Ga0466963_0003992 3300044694 Bacteria 8534
275 Ga0466963_0006173 3300044694 Bacteria 7073
276 Ga0466963_0102648 3300044694 Bacteria 1958
277 Ga0466964_0011370 3300044706 Bacteria 3362
278 Ga0466964_0290470 3300044706 Bacteria 820
279 Ga0466971_0134330 3300044719 Bacteria 1150
280 Ga0466968_0040730 3300044735 Bacteria 1959
281 Ga0466970_0046374 3300044765 Bacteria 2314
282 Ga0466970_0059934 3300044765 Bacteria 2038
283 Ga0466970_0092068 3300044765 Bacteria 1646
284 Ga0466970_0121569 3300044765 Bacteria 1430
285 Ga0466970_0233898 3300044765 Bacteria 1027
286 Ga0466957_0006888 3300044842 Bacteria 6422
287 Ga0466957_0009753 3300044842 Bacteria 5485
288 Ga0466957_0033920 3300044842 Bacteria 3062
289 Ga0466957_0136504 3300044842 Bacteria 1577
290 Ga0466957_0177955 3300044842 Bacteria 1388
291 Ga0466959_0081602 3300045049 Bacteria 2330
292 Ga0466959_0083481 3300045049 Bacteria 2300
293 Ga0466959_0108584 3300045049 Bacteria 1982
294 Ga0466959_0171284 3300045049 Bacteria 1523
295 Ga0466959_0650666 3300045049 Bacteria 707
296 Ga0466958_0002165 3300045836 Bacteria 9784
297 Ga0466958_0053068 3300045836 Bacteria 2458
298 Ga0466958_0650392 3300045836 Bacteria 686
299 Ga0466967_0013172 3300045976 Bacteria 6375
300 Ga0466967_0040681 3300045976 Bacteria 4003
301 Ga0466967_0054637 3300045976 Bacteria 3516
302 Ga0466967_0062396 3300045976 Bacteria 3308
303 Ga0466967_0500271 3300045976 Bacteria 1193
304 Ga0466967_1261090 3300045976 Bacteria 736
305 Ga0466967_1366396 3300045976 Bacteria 705
306 Ga0466967_1535458 3300045976 Bacteria 663
307 Ga0496100_0147228 3300048903 Bacteria 1676
308 Ga0496101_1078310 3300048904 Unclassified 631
309 Ga0496107_0004715 3300048910 Bacteria 9265
310 Ga0496107_0059022 3300048910 Bacteria 2776
311 Ga0496107_0197680 3300048910 Bacteria 1494
312 Ga0496108_0351386 3300048911 Unclassified 1286
313 Ga0496109_0005139 3300048912 Bacteria 10924
314 Ga0496111_0064781 3300048914 Bacteria 2652
315 Ga0496111_0158100 3300048914 Bacteria 1682
316 Ga0496112_0026958 3300048915 Bacteria 5538
317 Ga0496113_1276846 3300048916 Bacteria 571
318 Ga0496114_0044162 3300048917 Bacteria 3697
319 Ga0501032_0234078 3300049569 Unclassified 1194
320 Ga0501036_0077192 3300049572 Bacteria 2818
321 Ga0501036_0080133 3300049572 Bacteria 2761
322 Ga0501036_0349309 3300049572 Unclassified 1235
323 Ga0501038_0215901 3300049574 Bacteria 1532
324 Ga0501047_0037365 3300049581 Bacteria 4696
325 Ga0501047_0179760 3300049581 Bacteria 1982
326 Ga0501047_0344042 3300049581 Unclassified 1329
327 Ga0501070_0235785 3300049586 Bacteria 1498
328 Ga0501035_0338169 3300049822 Bacteria 1262
329 Ga0501044_0029829 3300049823 Bacteria 5750
330 Ga0501044_0286407 3300049823 Unclassified 1580
331 Ga0501044_0625620 3300049823 Bacteria 967
332 Ga0587077_080248 3300059493 Bacteria 747
333 Ga0466962_0063097 3300061719 Bacteria 1769
334 Ga0466962_0208864 3300061719 Bacteria 955
335 Ga0466962_0223992 3300061719 Bacteria 921
336 Ga0496110_0051475
337 JGI24736J21556_1000117
338 JGI24736J21556_1006851
339 JGI24741J21665_1006677
340 JGI24741J21665_1010128
341 JGI24740J21852_10004032
342 JGI24740J21852_10038234
343 JGI24740J21852_10038744
344 JGI24740J21852_10041986
345 JGI24739J22299_10064117
346 JGI24737J22298_10022218
347 JGI24737J22298_10047574
348 JGI24735J21928_10008058
349 rootH2_10144827
350 rootH1_10034718
351 Ga0070683_100259377
352 Ga0070683_100283461
353 Ga0070670_100231160
354 Ga0070680_100004470
355 Ga0070680_100010643
356 Ga0070660_100001347
357 Ga0070660_100132106
358 Ga0070660_100404870
359 Ga0070660_100621589
360 Ga0070661_100119074
361 Ga0070661_100185326
362 Ga0070661_101333347
363 Ga0070692_10051871
364 Ga0070668_100126959
365 Ga0070671_100095470
366 Ga0070671_100105429
367 Ga0070674_100445936
368 Ga0070673_101165813
369 Ga0070659_100005514
370 Ga0070659_100094939
371 Ga0070714_100041839
372 Ga0070714_100090546
373 Ga0070714_100258802
374 Ga0070714_100542855
375 Ga0070714_100547680
376 Ga0070713_100008342
377 Ga0070713_100999882
378 Ga0070711_101181440
379 Ga0070663_100182382
380 Ga0070663_100198639
381 Ga0070663_100556264
382 Ga0070678_100543880
383 Ga0070662_100042609
384 Ga0070662_100072334
385 Ga0070681_10016990
386 Ga0070681_10464245
387 Ga0068867_100409854
388 Ga0068853_100025213
389 Ga0068853_100288467
390 Ga0070672_100096407
391 Ga0070693_100117867
392 Ga0068855_100015129
393 Ga0070664_100105201
394 Ga0070664_100155640
395 Ga0070664_100624269
396 Ga0068857_100005865
397 Ga0068857_100020042
398 Ga0068857_100979048
399 Ga0068854_100158556
400 Ga0068854_100175205
401 Ga0068854_100176170
402 Ga0068854_100833154
403 Ga0068856_100022339
404 Ga0068856_100511869
405 Ga0068856_100684003
406 Ga0068856_100771063
407 Ga0068856_100911824
408 Ga0068852_100019828
409 Ga0068852_100030521
410 Ga0068852_100039319
411 Ga0068852_100184784
412 Ga0068852_100220562
413 Ga0068852_100283756
414 Ga0068852_100373574
415 Ga0068851_10120603
416 Ga0068851_10124237
417 Ga0068851_10135653
418 Ga0068863_100427238
419 Ga0068860_100723418
420 Ga0070717_10012883
421 Ga0075365_10366967
422 Ga0068865_100015170
423 Ga0105240_10007155
424 Ga0105240_10297160
425 Ga0105241_10159554
426 Ga0105248_10017490
427 Ga0105248_10088944
428 Ga0105248_10212574
429 Ga0105237_10372543
430 Ga0105238_10026814
431 Ga0105239_10327387
432 Ga0105239_10409645
433 Ga0105239_10667564
434 Ga0157373_10003770
435 Ga0157373_10070448
436 Ga0157373_10073760
437 Ga0157371_10010561
438 Ga0157371_10219600
439 Ga0157371_10347453
440 Ga0157371_10366088
441 Ga0157370_10001815
442 Ga0157370_10124174
443 Ga0157370_10453037
444 Ga0157370_10508899
445 Ga0157370_11622224
446 Ga0157369_10000256
447 Ga0157369_10001571
448 Ga0157369_10015792
449 Ga0157369_10314895
450 Ga0157369_10343973
451 Ga0157369_10588157
452 Ga0157374_10219218
453 Ga0163162_10141755
454 Ga0157372_10076275
455 Ga0157372_10113929
456 Ga0157372_10533037
457 Ga0157372_10648746
458 Ga0157372_10899455
459 Ga0163163_10055651
460 Ga0197907_10673626
461 Ga0206356_10267260
462 Ga0206355_1185753
463 Ga0206354_11529994
464 Ga0154015_1027679
465 Ga0154015_1120478
466 Ga0224712_10013540
467 Ga0207656_10120227
468 Ga0207656_10151562
469 Ga0207647_10002620
470 Ga0207647_10063010
471 Ga0207647_10143145
472 Ga0207685_10202793
473 Ga0207705_10000003
474 Ga0207705_10014104
475 Ga0207705_10067943
476 Ga0207705_10197851
477 Ga0207654_10228010
478 Ga0207654_10720071
479 Ga0207707_10130046
480 Ga0207695_10002589
481 Ga0207695_10004896
482 Ga0207695_10543194
483 Ga0207663_10493907
484 Ga0207660_10009882
485 Ga0207660_10335071
486 Ga0207657_10002388
487 Ga0207657_10002957
488 Ga0207657_10030487
489 Ga0207657_10065465
490 Ga0207657_10164723
491 Ga0207649_10007823
492 Ga0207649_10106911
493 Ga0207652_10040251
494 Ga0207652_10835673
495 Ga0207694_10081653
496 Ga0207694_11461585
497 Ga0207650_10144845
498 Ga0207700_10079529
499 Ga0207664_10075556
500 Ga0207664_10121316
501 Ga0207664_10186714
502 Ga0207644_10025726
503 Ga0207644_10130094
504 Ga0207644_11204734
505 Ga0207690_10029992
506 Ga0207690_10209161
507 Ga0207706_10025207
508 Ga0207706_10044200
509 Ga0207669_10323020
510 Ga0207704_10036634
511 Ga0207691_10023128
512 Ga0207711_10022420
513 Ga0207711_10139279
514 Ga0207711_10898900
515 Ga0207679_10043607
516 Ga0207679_10284988
517 Ga0207679_10290944
518 Ga0207667_10016249
519 Ga0207667_10022365
520 Ga0207667_10071853
521 Ga0207667_10346473
522 Ga0207640_10001261
523 Ga0207640_10018303
524 Ga0207640_10127567
525 Ga0207640_10435879
526 Ga0207640_10769235
527 Ga0207640_10862332
528 Ga0207658_10168066
529 Ga0207639_10007563
530 Ga0207639_10048961
531 Ga0207678_10015645
532 Ga0207678_10046244
533 Ga0207702_10015728
534 Ga0207702_10063532
535 Ga0207702_10079131
536 Ga0207702_10165920
537 Ga0207702_10429005
538 Ga0207641_10022478
539 Ga0207648_10441367
540 Ga0207676_10339701
541 Ga0207674_10004573
542 Ga0207674_10015574
543 Ga0207674_10051270
544 Ga0207683_10297912
545 Ga0207698_10005143
546 Ga0207698_10012876
547 Ga0207698_10046089
548 Ga0207698_10398016
549 Ga0265331_10000007
550 Ga0307408_100304612
551 Ga0307406_10647193
552 Ga0307409_100344178
553 Ga0307411_10412658
554 Ga0373930_0031764
555 Ga0373923_0139528
556 Ga0373935_0037678
557 Ga0395899_0000105
558 Ga0395899_0011331
559 Ga0395899_0175035
560 Ga0395899_0264252
561 Ga0395899_0323166
562 Ga0395899_0527135
563 Ga0395900_0001979
564 Ga0395900_0020857
565 Ga0395900_0021017
566 Ga0395900_0037423
567 Ga0395900_0049937
568 Ga0395900_0089534
569 Ga0395900_0102845
570 Ga0395900_0178017
571 Ga0395900_0202020
572 Ga0395900_0533882
573 Ga0395900_0632479
574 Ga0395900_0906732
575 Ga0395898_0033353
576 Ga0395898_0053268
577 Ga0395898_0120267
578 Ga0395898_0229479
579 Ga0395898_0645908
580 Ga0395898_0811632
581 Ga0395905_0011281
582 Ga0395905_0023060
583 Ga0395905_0042666
584 Ga0395905_0579356
585 Ga0395905_0699794
586 Ga0395901_0005588
587 Ga0395901_0005792
588 Ga0395901_0028431
589 Ga0395901_0230120
590 Ga0395901_0352515
591 Ga0395901_0449580
592 Ga0395901_0547442
593 Ga0395901_1575001
594 Ga0466969_0002081
595 Ga0466969_0060432
596 Ga0466972_0129140
597 Ga0466972_0198266
598 Ga0453683_0064819
599 Ga0466965_0060167
600 Ga0466965_0285829
601 Ga0466966_0002468
602 Ga0466966_0011045
603 Ga0466966_0044674
604 Ga0466966_0070968
605 Ga0466966_0262204
606 Ga0466966_0572942
607 Ga0466961_0100659
608 Ga0466961_0252363
609 Ga0466963_0003992
610 Ga0466963_0006173
611 Ga0466963_0102648
612 Ga0466964_0011370
613 Ga0466964_0290470
614 Ga0466971_0134330
615 Ga0466968_0040730
616 Ga0466970_0046374
617 Ga0466970_0059934
618 Ga0466970_0092068
619 Ga0466970_0121569
620 Ga0466970_0233898
621 Ga0466957_0006888
622 Ga0466957_0009753
623 Ga0466957_0033920
624 Ga0466957_0136504
625 Ga0466957_0177955
626 Ga0466959_0081602
627 Ga0466959_0083481
628 Ga0466959_0108584
629 Ga0466959_0171284
630 Ga0466959_0650666
631 Ga0466958_0002165
632 Ga0466958_0053068
633 Ga0466958_0650392
634 Ga0466967_0013172
635 Ga0466967_0040681
636 Ga0466967_0054637
637 Ga0466967_0062396
638 Ga0466967_0500271
639 Ga0466967_1261090
640 Ga0466967_1366396
641 Ga0466967_1535458
642 Ga0496100_0147228
643 Ga0496101_1078310
644 Ga0496107_0004715
645 Ga0496107_0059022
646 Ga0496107_0197680
647 Ga0496108_0351386
648 Ga0496109_0005139
649 Ga0496111_0064781
650 Ga0496111_0158100
651 Ga0496112_0026958
652 Ga0496113_1276846
653 Ga0496114_0044162
654 Ga0501032_0234078
655 Ga0501036_0077192
656 Ga0501036_0080133
657 Ga0501036_0349309
658 Ga0501038_0215901
659 Ga0501047_0037365
660 Ga0501047_0179760
661 Ga0501047_0344042
662 Ga0501070_0235785
663 Ga0501035_0338169
664 Ga0501044_0029829
665 Ga0501044_0286407
666 Ga0501044_0625620
667 Ga0587077_080248
668 Ga0466962_0063097
669 Ga0466962_0208864
670 Ga0466962_0223992

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13628

DUF4142

Domain of unknown function (DUF4142)

60

202

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7s5c-assembly1.cif.gz_J m. xanthus ferritin-like protein encb 0.9389 116 173
7s5c-assembly1.cif.gz_J m. xanthus ferritin-like protein encb 0.8949 116 173
3fse-assembly1.cif.gz_A crystal structure of a two-domain protein containing dj-1/thij/pfpi-like and ferritin-like domains (ava_4496) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.8905 29 171
3k6c-assembly1.cif.gz_A crystal structure of protein ne0167 from nitrosomonas europaea 0.8878 108 171
4etr-assembly1.cif.gz_A x-ray structure of pa2169 from pseudomonas aeruginosa 0.8724 29 173
ID Description Score Start End Superfamily
af_Q3E6X7_36_176_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.9765 117 172 1.20.140.40
af_Q9CA10_47_189_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.9506 113 172 1.20.140.40
3fseA02 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8844 29 171 1.20.1260.10
4etrA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8724 29 173 1.20.1260.10
4etrB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8618 28 173 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A2N8MDQ7-F1-model_v4 DUF4142 domain-containing protein 0.9991 25 173
AF-A0A0M2RB10-F1-model_v4 DUF4142 domain-containing protein 0.9971 26 173
AF-A0A0H2MHX2-F1-model_v4 DUF4142 domain-containing protein 0.9965 26 173
AF-A0A1E5A0R0-F1-model_v4 DUF4142 domain-containing protein 0.9963 26 172
AF-A0A5N1IS72-F1-model_v4 DUF4142 domain-containing protein 0.9963 25 172

Map