F412419

General Info

Members Datasets Scaffolds Average Seq Length
335 214 670 167

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0000009|Ga0496124_0000009_394631_395140
Length 169
Sequence MSGASTLCIRHWQPNDRDAVAALIVGIQRDEFGLDIDLAAQPDLLDVAGFYGSGAGGFWVACDAGLVVGCIGLRDLGQGDGALRKMFVAPTHRGRGLSVAARLLDRLTAHAQAQQLHALFLGTTDRFLAAHRFYEKHGFLQIARADIPRAFPVMAVDSRFYVRWLKHSA

Samples

Sample ID Description Type Environment
1 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
37 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
61 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
62 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
63 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
84 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
88 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
107 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
108 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
115 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
116 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
117 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
124 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
127 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
129 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
134 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
135 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
136 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
137 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
144 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
145 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
146 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
179 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
180 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
185 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
186 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
187 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
188 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
189 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
190 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
191 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
192 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
193 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
194 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
195 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
196 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
197 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
198 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
199 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
200 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
201 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
202 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
203 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
204 2739367651 Pedobacter sp. OK291 Isolate Unclassified
205 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
206 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
207 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
208 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
209 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
210 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
211 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
212 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
213 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
214 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.12
Metatranscriptomes 0
Isolates 3.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.01
Nodule 0.6
Rhizoplane 5.67
Rhizosphere 57.31
Stem 0
Stem Tuber 0
Unclassified 2.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496124_0000009 3300048927 Bacteria 734820
2 JGI25152J39213_1002651 3300002773 Bacteria 6626
3 JGI25152J39213_1002776 3300002773 Bacteria 6343
4 JGI25150J39212_1000256 3300002774 Bacteria 28172
5 JGI25151J46595_10000916 3300003187 Bacteria 22974
6 JGI25151J46595_10002252 3300003187 Bacteria 11849
7 JGI25153J46596_10005343 3300003215 Bacteria 6748
8 JGI25404J52841_10038690 3300003659 Bacteria 1011
9 JGI25404J52841_10061410 3300003659 Bacteria 787
10 Ga0055526_1024440 3300003771 Bacteria 1976
11 Ga0055536_1000006 3300003781 Bacteria 347733
12 Ga0055528_1015924 3300003790 Bacteria 2687
13 Ga0055530_10000679 3300003791 Bacteria 28914
14 Ga0055540_1008166 3300003792 Bacteria 3810
15 Ga0065165_1019528 3300005262 Bacteria 2415
16 Ga0065714_10066880 3300005288 Bacteria 6126
17 Ga0065712_10000148 3300005290 Bacteria 47942
18 Ga0068869_100093245 3300005334 Bacteria 2268
19 Ga0070689_100681547 3300005340 Bacteria 896
20 Ga0070661_100573838 3300005344 Bacteria 910
21 Ga0070668_100471711 3300005347 Bacteria 1082
22 Ga0070668_101626384 3300005347 Bacteria 592
23 Ga0070669_100366959 3300005353 Bacteria 1172
24 Ga0070663_100724025 3300005455 Bacteria 847
25 Ga0070678_100101073 3300005456 Bacteria 2235
26 Ga0070678_101370693 3300005456 Bacteria 659
27 Ga0070686_100113069 3300005544 Bacteria 1853
28 Ga0070665_100411829 3300005548 Bacteria 1360
29 Ga0070665_100518664 3300005548 Bacteria 1203
30 Ga0070665_101748720 3300005548 Bacteria 629
31 Ga0070702_100113618 3300005615 Bacteria 1683
32 Ga0068864_101158833 3300005618 Bacteria 771
33 Ga0068866_10335279 3300005718 Bacteria 956
34 Ga0068861_101517341 3300005719 Bacteria 658
35 Ga0068851_10069938 3300005834 Bacteria 1814
36 Ga0068860_100716681 3300005843 Bacteria 1011
37 Ga0068862_100235230 3300005844 Bacteria 1663
38 Ga0081455_10137327 3300005937 Bacteria 1903
39 Ga0081540_1000990 3300005983 Bacteria 25618
40 Ga0081540_1003471 3300005983 Bacteria 12440
41 Ga0081540_1075907 3300005983 Bacteria 1534
42 Ga0075365_10052403 3300006038 Bacteria 2698
43 Ga0075368_10214033 3300006042 Bacteria 817
44 Ga0068865_100075972 3300006881 Bacteria 2397
45 Ga0079104_1000010 3300006946 Bacteria 366021
46 Ga0099795_10043101 3300007788 Bacteria 1614
47 Ga0105245_10441471 3300009098 Bacteria 1308
48 Ga0105247_10029429 3300009101 Bacteria 3328
49 Ga0105243_10113056 3300009148 Bacteria 2276
50 Ga0105243_10796793 3300009148 Bacteria 931
51 Ga0105242_10117251 3300009176 Bacteria 2279
52 Ga0105248_10183114 3300009177 Bacteria 2360
53 Ga0105237_10126978 3300009545 Bacteria 2544
54 Ga0105238_10009204 3300009551 Bacteria 9884
55 Ga0105249_10289973 3300009553 Bacteria 1638
56 Ga0105249_11203408 3300009553 Bacteria 829
57 Ga0105246_10193008 3300011119 Bacteria 1578
58 Ga0105246_10336880 3300011119 Bacteria 1231
59 Ga0105246_10345738 3300011119 Bacteria 1217
60 Ga0105246_10791108 3300011119 Bacteria 841
61 Ga0157373_10124290 3300013100 Bacteria 1814
62 Ga0157371_10000296 3300013102 Bacteria 66267
63 Ga0157371_10000383 3300013102 Bacteria 55675
64 Ga0157370_10000383 3300013104 Bacteria 55670
65 Ga0157370_10017361 3300013104 Bacteria 7263
66 Ga0157370_10111062 3300013104 Bacteria 2563
67 Ga0157370_10195236 3300013104 Bacteria 1879
68 Ga0157370_11389437 3300013104 Bacteria 632
69 Ga0157369_10000164 3300013105 Bacteria 94229
70 Ga0163162_10195013 3300013306 Bacteria 2154
71 Ga0163162_10992101 3300013306 Bacteria 949
72 Ga0157372_10029850 3300013307 Bacteria 5958
73 Ga0163163_11691917 3300014325 Bacteria 693
74 Ga0157380_10605641 3300014326 Bacteria 1085
75 Ga0182008_10003578 3300014497 Bacteria 9312
76 Ga0182006_1000546 3300015261 Bacteria 28457
77 Ga0182006_1041808 3300015261 Bacteria 1798
78 Ga0182007_10000005 3300015262 Bacteria 442702
79 Ga0183373_1002 3300015682 Bacteria 990153
80 Ga0163161_10000135 3300017792 Bacteria 69859
81 Ga0163161_10000539 3300017792 Bacteria 30832
82 Ga0213871_10007556 3300021441 Bacteria 2357
83 Ga0207425_1000497 3300025245 Bacteria 24648
84 Ga0209129_1000078 3300025258 Bacteria 192880
85 Ga0209129_1000658 3300025258 Bacteria 23033
86 Ga0209673_1000015 3300025273 Bacteria 530618
87 Ga0209673_1018030 3300025273 Bacteria 2581
88 Ga0209676_1000039 3300025292 Bacteria 443158
89 Ga0209025_1000489 3300025294 Bacteria 76167
90 Ga0209025_1000664 3300025294 Bacteria 59562
91 Ga0209025_1015932 3300025294 Bacteria 4484
92 Ga0209564_1010567 3300025295 Bacteria 4234
93 Ga0209758_1000549 3300025297 Bacteria 59562
94 Ga0209758_1009961 3300025297 Bacteria 5783
95 Ga0209758_1066940 3300025297 Bacteria 1151
96 Ga0209050_1000033 3300025298 Bacteria 442615
97 Ga0209256_1000782 3300025299 Bacteria 41037
98 Ga0209256_1044080 3300025299 Bacteria 1116
99 Ga0209051_1025138 3300025303 Bacteria 2431
100 Ga0209051_1089150 3300025303 Bacteria 863
101 Ga0209051_1104662 3300025303 Bacteria 753
102 Ga0207656_10121985 3300025321 Bacteria 1214
103 Ga0207655_1002547 3300025728 Bacteria 14590
104 Ga0207710_10180779 3300025900 Bacteria 1035
105 Ga0207681_10410290 3300025923 Bacteria 1096
106 Ga0207686_10010194 3300025934 Bacteria 5109
107 Ga0207686_10161364 3300025934 Bacteria 1571
108 Ga0207709_10148093 3300025935 Bacteria 1622
109 Ga0207691_10800091 3300025940 Bacteria 792
110 Ga0207711_10269891 3300025941 Bacteria 1565
111 Ga0207689_10227632 3300025942 Bacteria 1541
112 Ga0207678_10670320 3300026067 Bacteria 912
113 Ga0207641_10242873 3300026088 Bacteria 1679
114 Ga0207683_10085701 3300026121 Bacteria 2800
115 Ga0207683_10683638 3300026121 Bacteria 951
116 Ga0209281_1000078 3300027111 Bacteria 261622
117 Ga0209813_10157017 3300027866 Bacteria 818
118 Ga0268266_10313568 3300028379 Bacteria 1466
119 Ga0268266_10575202 3300028379 Bacteria 1081
120 Ga0268266_10840252 3300028379 Bacteria 887
121 Ga0268266_10937095 3300028379 Bacteria 838
122 Ga0268264_10490259 3300028381 Bacteria 1197
123 Ga0265318_10031938 3300028577 Unclassified 2040
124 Ga0307517_10237438 3300028786 Bacteria 1086
125 Ga0307515_10076486 3300028794 Bacteria 4439
126 Ga0265338_10404385 3300028800 Unclassified 973
127 Ga0265330_10025603 3300031235 Unclassified 2674
128 Ga0265339_10362036 3300031249 Unclassified 682
129 Ga0265331_10036056 3300031250 Unclassified 2431
130 Ga0265316_10034674 3300031344 Bacteria 4098
131 Ga0265314_10001501 3300031711 Bacteria 25863
132 Ga0265342_10021800 3300031712 Unclassified 4084
133 Ga0307405_10000009 3300031731 Bacteria 259388
134 Ga0307407_10000001 3300031903 Bacteria 570048
135 Ga0307412_10386581 3300031911 Bacteria 1135
136 Ga0307409_100004667 3300031995 Bacteria 7747
137 Ga0307416_100000026 3300032002 Bacteria 172622
138 Ga0307414_10003733 3300032004 Bacteria 8173
139 Ga0307414_10599312 3300032004 Bacteria 988
140 Ga0307411_11108356 3300032005 Bacteria 714
141 Ga0373954_0488274 3300035118 Bacteria 610
142 Ga0373925_0114060 3300037068 Bacteria 2091
143 Ga0436360_0630584 3300039438 Bacteria 10161
144 Ga0436362_0732423 3300039453 Unclassified 918
145 Ga0439459_0015040 3300042438 Bacteria 1414
146 Ga0451577_0092296 3300042876 Bacteria 2703
147 Ga0451577_0278262 3300042876 Bacteria 1516
148 Ga0466965_0108192 3300044683 Bacteria 1427
149 Ga0453684_0363158 3300044712 Bacteria 1630
150 Ga0466970_0254393 3300044765 Bacteria 985
151 Ga0451576_0214657 3300045051 Bacteria 2009
152 Ga0495617_125716 3300046452 Bacteria 824
153 Ga0495627_000076 3300046453 Bacteria 120147
154 Ga0495590_0044720 3300046457 Bacteria 1544
155 Ga0495591_000198 3300046458 Bacteria 61546
156 Ga0495591_000924 3300046458 Bacteria 20256
157 Ga0495638_0001240 3300046460 Bacteria 24046
158 Ga0495638_0503042 3300046460 Bacteria 610
159 Ga0495650_0000032 3300046471 Bacteria 425389
160 Ga0495650_0056789 3300046471 Bacteria 1587
161 Ga0495605_0000664 3300046474 Bacteria 26130
162 Ga0495605_0001499 3300046474 Bacteria 15218
163 Ga0495605_0016749 3300046474 Bacteria 3961
164 Ga0495605_0058395 3300046474 Bacteria 1854
165 Ga0495584_0014374 3300046491 Bacteria 4032
166 Ga0495585_0067771 3300046492 Bacteria 1951
167 Ga0495607_0000024 3300046501 Bacteria 159904
168 Ga0495607_0000306 3300046501 Bacteria 51378
169 Ga0495607_0022191 3300046501 Bacteria 3991
170 Ga0495607_0081520 3300046501 Bacteria 1777
171 Ga0495583_0018501 3300046506 Bacteria 3666
172 Ga0495606_0002092 3300046507 Bacteria 24304
173 Ga0495606_0034307 3300046507 Bacteria 3485
174 Ga0495606_0058978 3300046507 Bacteria 2464
175 Ga0495606_0530548 3300046507 Bacteria 589
176 Ga0495610_0000048 3300046512 Bacteria 150249
177 Ga0495610_0000501 3300046512 Bacteria 39971
178 Ga0495616_0005407 3300046513 Bacteria 7868
179 Ga0495616_0084385 3300046513 Bacteria 1514
180 Ga0495620_0186055 3300046515 Bacteria 802
181 Ga0495631_0003302 3300046518 Bacteria 8872
182 Ga0495631_0338615 3300046518 Bacteria 640
183 Ga0495632_0040715 3300046519 Bacteria 2338
184 Ga0495637_0016454 3300046520 Bacteria 3456
185 Ga0495637_0020745 3300046520 Bacteria 3017
186 Ga0495637_0206343 3300046520 Bacteria 720
187 Ga0495643_0102334 3300046522 Bacteria 1466
188 Ga0495643_0415077 3300046522 Bacteria 591
189 Ga0495644_0007413 3300046523 Bacteria 4231
190 Ga0495648_0002443 3300046524 Bacteria 17170
191 Ga0495654_0000108 3300046530 Bacteria 93555
192 Ga0495609_0022210 3300046538 Bacteria 2924
193 Ga0495597_0000676 3300046542 Bacteria 27672
194 Ga0495645_0277713 3300046543 Bacteria 1103
195 Ga0495633_0171315 3300046558 Bacteria 1000
196 Ga0495633_0216749 3300046558 Bacteria 877
197 Ga0495633_0298360 3300046558 Bacteria 732
198 Ga0495668_0040740 3300046616 Bacteria 2590
199 Ga0495668_0045838 3300046616 Bacteria 2430
200 Ga0495611_0001703 3300046648 Bacteria 10675
201 Ga0495611_0361741 3300046648 Bacteria 665
202 Ga0495625_0007909 3300046660 Bacteria 9147
203 Ga0495625_0120543 3300046660 Bacteria 1785
204 Ga0495625_0236239 3300046660 Bacteria 1192
205 Ga0495670_0061100 3300046691 Bacteria 1894
206 Ga0495671_0002801 3300046692 Bacteria 10912
207 Ga0495671_0383777 3300046692 Bacteria 673
208 Ga0495649_0003348 3300046694 Bacteria 10875
209 Ga0495649_0338990 3300046694 Bacteria 761
210 Ga0495589_0019534 3300046794 Bacteria 3472
211 Ga0495600_0217732 3300046809 Bacteria 1222
212 Ga0495660_0000021 3300046810 Bacteria 293250
213 Ga0495660_0000431 3300046810 Bacteria 35256
214 Ga0495672_0000002 3300047320 Bacteria 740116
215 Ga0495672_0008566 3300047320 Bacteria 7526
216 Ga0495672_0009809 3300047320 Bacteria 6892
217 Ga0495672_0014132 3300047320 Bacteria 5477
218 Ga0495672_0105449 3300047320 Bacteria 1521
219 Ga0495676_0480460 3300047321 Bacteria 817
220 Ga0495683_0019354 3300047323 Bacteria 3514
221 Ga0495687_067958 3300047443 Bacteria 1440
222 Ga0495673_0000081 3300047469 Bacteria 199943
223 Ga0495686_0113115 3300047472 Bacteria 1626
224 Ga0496101_0544969 3300048904 Bacteria 917
225 Ga0496102_0211685 3300048905 Bacteria 1827
226 Ga0496103_0093198 3300048906 Bacteria 1902
227 Ga0496106_0026986 3300048909 Bacteria 4276
228 Ga0496106_0302370 3300048909 Bacteria 1283
229 Ga0496106_0372712 3300048909 Bacteria 1147
230 Ga0496107_0030465 3300048910 Bacteria 3845
231 Ga0496108_0040466 3300048911 Bacteria 3886
232 Ga0496109_0017781 3300048912 Bacteria 6236
233 Ga0496109_1228361 3300048912 Bacteria 686
234 Ga0496110_0040792 3300048913 Bacteria 4046
235 Ga0496110_0438613 3300048913 Bacteria 1190
236 Ga0496111_0007015 3300048914 Bacteria 7358
237 Ga0496111_0137044 3300048914 Bacteria 1813
238 Ga0496112_0279592 3300048915 Bacteria 1616
239 Ga0496113_0115886 3300048916 Bacteria 2090
240 Ga0496114_0341212 3300048917 Bacteria 1325
241 Ga0496115_0058201 3300048918 Bacteria 3110
242 Ga0496116_0009801 3300048919 Bacteria 8121
243 Ga0496116_0015044 3300048919 Bacteria 6135
244 Ga0496116_0172793 3300048919 Bacteria 1169
245 Ga0496116_0415498 3300048919 Bacteria 589
246 Ga0496117_0009366 3300048920 Bacteria 9119
247 Ga0496117_0029567 3300048920 Bacteria 4222
248 Ga0496117_0061234 3300048920 Bacteria 2588
249 Ga0496117_0204383 3300048920 Bacteria 1113
250 Ga0496118_0000649 3300048921 Bacteria 56703
251 Ga0496118_0080410 3300048921 Bacteria 2294
252 Ga0496118_0092215 3300048921 Bacteria 2079
253 Ga0496118_0241912 3300048921 Bacteria 1032
254 Ga0496119_0022629 3300048922 Bacteria 4490
255 Ga0496119_0381652 3300048922 Bacteria 676
256 Ga0496120_0009320 3300048923 Bacteria 6981
257 Ga0496121_0000003 3300048924 Bacteria 1191431
258 Ga0496121_0013154 3300048924 Bacteria 8926
259 Ga0496121_0016060 3300048924 Bacteria 7759
260 Ga0496121_0030835 3300048924 Bacteria 4916
261 Ga0496121_0098954 3300048924 Bacteria 2255
262 Ga0496121_0114941 3300048924 Bacteria 2044
263 Ga0496121_0271828 3300048924 Bacteria 1164
264 Ga0496121_0633115 3300048924 Unclassified 654
265 Ga0496122_0067952 3300048925 Bacteria 2562
266 Ga0496122_0078852 3300048925 Bacteria 2304
267 Ga0496122_0080737 3300048925 Bacteria 2266
268 Ga0496122_0158541 3300048925 Bacteria 1384
269 Ga0496122_0159418 3300048925 Bacteria 1378
270 Ga0496122_0226740 3300048925 Bacteria 1066
271 Ga0496122_0293782 3300048925 Bacteria 880
272 Ga0496122_0440391 3300048925 Bacteria 649
273 Ga0496123_0009684 3300048926 Bacteria 8639
274 Ga0496123_0027883 3300048926 Bacteria 4194
275 Ga0496123_0055638 3300048926 Bacteria 2593
276 Ga0496124_0013275 3300048927 Bacteria 8051
277 Ga0496124_0025554 3300048927 Bacteria 5348
278 Ga0496124_0090343 3300048927 Bacteria 2498
279 Ga0496124_0092823 3300048927 Bacteria 2458
280 Ga0496124_0098227 3300048927 Bacteria 2376
281 Ga0496124_0200837 3300048927 Bacteria 1516
282 Ga0496124_0298689 3300048927 Bacteria 1164
283 Ga0496124_0346956 3300048927 Unclassified 1051
284 Ga0496124_0402633 3300048927 Bacteria 949
285 Ga0496124_0433136 3300048927 Bacteria 902
286 Ga0496124_0534758 3300048927 Bacteria 777
287 Ga0496125_0003405 3300048928 Bacteria 19331
288 Ga0496125_0010745 3300048928 Bacteria 9222
289 Ga0496125_0566091 3300048928 Bacteria 627
290 Ga0496126_0205931 3300048929 Bacteria 1658
291 Ga0496126_0366482 3300048929 Bacteria 1176
292 Ga0496126_0373861 3300048929 Bacteria 1161
293 Ga0496126_0375439 3300048929 Bacteria 1158
294 Ga0496126_0494373 3300048929 Bacteria 978
295 Ga0496126_1005101 3300048929 Bacteria 626
296 Ga0495678_000513 3300049459 Bacteria 37746
297 Ga0495678_109759 3300049459 Bacteria 942
298 Ga0495682_0000001 3300049460 Bacteria 1559116
299 nmdc:mga0yw44_192368_c1 3300050492 Bacteria 1346
300 nmdc:mga0k408_284307_c1 3300050493 Bacteria 987
301 nmdc:mga07m45_353029_c1 3300050496 Bacteria 854
302 nmdc:mga07m45_434920_c1 3300050496 Bacteria 761
303 Ga0495601_0504909 3300053077 Unclassified 780
304 Ga0500610_0020576 3300053079 Bacteria 3223
305 Ga0500643_043873 3300053087 Bacteria 1302
306 Ga0500646_0107348 3300053090 Bacteria 884
307 Ga0500583_0208268 3300053092 Bacteria 971
308 Ga0500583_0269535 3300053092 Bacteria 838
309 Ga0500641_0047328 3300053096 Bacteria 1758
310 Ga0500557_005151 3300053105 Bacteria 2831
311 Ga0500562_017472 3300053108 Bacteria 1850
312 Ga0500569_042597 3300053109 Bacteria 1337
313 Ga0500594_0005205 3300053118 Bacteria 2881
314 Ga0500621_000001 3300053126 Bacteria 1049698
315 Ga0500642_0463829 3300053130 Bacteria 541
316 Ga0500568_0002986 3300053139 Bacteria 9676
317 Ga0500573_0182322 3300053140 Bacteria 1128
318 Ga0500588_0109152 3300053146 Bacteria 963
319 Ga0500616_0004523 3300053153 Bacteria 9869
320 Ga0500627_0212037 3300053158 Bacteria 866
321 Ga0500611_061876 3300053727 Bacteria 889
322 Ga0500599_047118 3300053736 Bacteria 676
323 2586206670 2585427687 Bacteria 5544917
324 2599327689 2599185155 Bacteria 5827168
325 2739586899 2739367651 Bacteria 6359826
326 2826581907 2826581358 Bacteria 5963467
327 2842727658 2842722452 Bacteria 6263924
328 2842816839 2842815866 Bacteria 5947510
329 2842853947 2842849001 Bacteria 5924277
330 2842911137 2842909656 Bacteria 6185908
331 2849283091 2849281842 Bacteria 6065644
332 2857631925 2857627736 Bacteria 5625397
333 2945997751 2945997725 Bacteria 6404843
334 2954020203 2954016120 Bacteria 6446024
335 8006992610 8006984368 Bacteria 9651211
336 Ga0496124_0000009
337 JGI25152J39213_1002651
338 JGI25152J39213_1002776
339 JGI25150J39212_1000256
340 JGI25151J46595_10000916
341 JGI25151J46595_10002252
342 JGI25153J46596_10005343
343 JGI25404J52841_10038690
344 JGI25404J52841_10061410
345 Ga0055526_1024440
346 Ga0055536_1000006
347 Ga0055528_1015924
348 Ga0055530_10000679
349 Ga0055540_1008166
350 Ga0065165_1019528
351 Ga0065714_10066880
352 Ga0065712_10000148
353 Ga0068869_100093245
354 Ga0070689_100681547
355 Ga0070661_100573838
356 Ga0070668_100471711
357 Ga0070668_101626384
358 Ga0070669_100366959
359 Ga0070663_100724025
360 Ga0070678_100101073
361 Ga0070678_101370693
362 Ga0070686_100113069
363 Ga0070665_100411829
364 Ga0070665_100518664
365 Ga0070665_101748720
366 Ga0070702_100113618
367 Ga0068864_101158833
368 Ga0068866_10335279
369 Ga0068861_101517341
370 Ga0068851_10069938
371 Ga0068860_100716681
372 Ga0068862_100235230
373 Ga0081455_10137327
374 Ga0081540_1000990
375 Ga0081540_1003471
376 Ga0081540_1075907
377 Ga0075365_10052403
378 Ga0075368_10214033
379 Ga0068865_100075972
380 Ga0079104_1000010
381 Ga0099795_10043101
382 Ga0105245_10441471
383 Ga0105247_10029429
384 Ga0105243_10113056
385 Ga0105243_10796793
386 Ga0105242_10117251
387 Ga0105248_10183114
388 Ga0105237_10126978
389 Ga0105238_10009204
390 Ga0105249_10289973
391 Ga0105249_11203408
392 Ga0105246_10193008
393 Ga0105246_10336880
394 Ga0105246_10345738
395 Ga0105246_10791108
396 Ga0157373_10124290
397 Ga0157371_10000296
398 Ga0157371_10000383
399 Ga0157370_10000383
400 Ga0157370_10017361
401 Ga0157370_10111062
402 Ga0157370_10195236
403 Ga0157370_11389437
404 Ga0157369_10000164
405 Ga0163162_10195013
406 Ga0163162_10992101
407 Ga0157372_10029850
408 Ga0163163_11691917
409 Ga0157380_10605641
410 Ga0182008_10003578
411 Ga0182006_1000546
412 Ga0182006_1041808
413 Ga0182007_10000005
414 Ga0183373_1002
415 Ga0163161_10000135
416 Ga0163161_10000539
417 Ga0213871_10007556
418 Ga0207425_1000497
419 Ga0209129_1000078
420 Ga0209129_1000658
421 Ga0209673_1000015
422 Ga0209673_1018030
423 Ga0209676_1000039
424 Ga0209025_1000489
425 Ga0209025_1000664
426 Ga0209025_1015932
427 Ga0209564_1010567
428 Ga0209758_1000549
429 Ga0209758_1009961
430 Ga0209758_1066940
431 Ga0209050_1000033
432 Ga0209256_1000782
433 Ga0209256_1044080
434 Ga0209051_1025138
435 Ga0209051_1089150
436 Ga0209051_1104662
437 Ga0207656_10121985
438 Ga0207655_1002547
439 Ga0207710_10180779
440 Ga0207681_10410290
441 Ga0207686_10010194
442 Ga0207686_10161364
443 Ga0207709_10148093
444 Ga0207691_10800091
445 Ga0207711_10269891
446 Ga0207689_10227632
447 Ga0207678_10670320
448 Ga0207641_10242873
449 Ga0207683_10085701
450 Ga0207683_10683638
451 Ga0209281_1000078
452 Ga0209813_10157017
453 Ga0268266_10313568
454 Ga0268266_10575202
455 Ga0268266_10840252
456 Ga0268266_10937095
457 Ga0268264_10490259
458 Ga0265318_10031938
459 Ga0307517_10237438
460 Ga0307515_10076486
461 Ga0265338_10404385
462 Ga0265330_10025603
463 Ga0265339_10362036
464 Ga0265331_10036056
465 Ga0265316_10034674
466 Ga0265314_10001501
467 Ga0265342_10021800
468 Ga0307405_10000009
469 Ga0307407_10000001
470 Ga0307412_10386581
471 Ga0307409_100004667
472 Ga0307416_100000026
473 Ga0307414_10003733
474 Ga0307414_10599312
475 Ga0307411_11108356
476 Ga0373954_0488274
477 Ga0373925_0114060
478 Ga0436360_0630584
479 Ga0436362_0732423
480 Ga0439459_0015040
481 Ga0451577_0092296
482 Ga0451577_0278262
483 Ga0466965_0108192
484 Ga0453684_0363158
485 Ga0466970_0254393
486 Ga0451576_0214657
487 Ga0495617_125716
488 Ga0495627_000076
489 Ga0495590_0044720
490 Ga0495591_000198
491 Ga0495591_000924
492 Ga0495638_0001240
493 Ga0495638_0503042
494 Ga0495650_0000032
495 Ga0495650_0056789
496 Ga0495605_0000664
497 Ga0495605_0001499
498 Ga0495605_0016749
499 Ga0495605_0058395
500 Ga0495584_0014374
501 Ga0495585_0067771
502 Ga0495607_0000024
503 Ga0495607_0000306
504 Ga0495607_0022191
505 Ga0495607_0081520
506 Ga0495583_0018501
507 Ga0495606_0002092
508 Ga0495606_0034307
509 Ga0495606_0058978
510 Ga0495606_0530548
511 Ga0495610_0000048
512 Ga0495610_0000501
513 Ga0495616_0005407
514 Ga0495616_0084385
515 Ga0495620_0186055
516 Ga0495631_0003302
517 Ga0495631_0338615
518 Ga0495632_0040715
519 Ga0495637_0016454
520 Ga0495637_0020745
521 Ga0495637_0206343
522 Ga0495643_0102334
523 Ga0495643_0415077
524 Ga0495644_0007413
525 Ga0495648_0002443
526 Ga0495654_0000108
527 Ga0495609_0022210
528 Ga0495597_0000676
529 Ga0495645_0277713
530 Ga0495633_0171315
531 Ga0495633_0216749
532 Ga0495633_0298360
533 Ga0495668_0040740
534 Ga0495668_0045838
535 Ga0495611_0001703
536 Ga0495611_0361741
537 Ga0495625_0007909
538 Ga0495625_0120543
539 Ga0495625_0236239
540 Ga0495670_0061100
541 Ga0495671_0002801
542 Ga0495671_0383777
543 Ga0495649_0003348
544 Ga0495649_0338990
545 Ga0495589_0019534
546 Ga0495600_0217732
547 Ga0495660_0000021
548 Ga0495660_0000431
549 Ga0495672_0000002
550 Ga0495672_0008566
551 Ga0495672_0009809
552 Ga0495672_0014132
553 Ga0495672_0105449
554 Ga0495676_0480460
555 Ga0495683_0019354
556 Ga0495687_067958
557 Ga0495673_0000081
558 Ga0495686_0113115
559 Ga0496101_0544969
560 Ga0496102_0211685
561 Ga0496103_0093198
562 Ga0496106_0026986
563 Ga0496106_0302370
564 Ga0496106_0372712
565 Ga0496107_0030465
566 Ga0496108_0040466
567 Ga0496109_0017781
568 Ga0496109_1228361
569 Ga0496110_0040792
570 Ga0496110_0438613
571 Ga0496111_0007015
572 Ga0496111_0137044
573 Ga0496112_0279592
574 Ga0496113_0115886
575 Ga0496114_0341212
576 Ga0496115_0058201
577 Ga0496116_0009801
578 Ga0496116_0015044
579 Ga0496116_0172793
580 Ga0496116_0415498
581 Ga0496117_0009366
582 Ga0496117_0029567
583 Ga0496117_0061234
584 Ga0496117_0204383
585 Ga0496118_0000649
586 Ga0496118_0080410
587 Ga0496118_0092215
588 Ga0496118_0241912
589 Ga0496119_0022629
590 Ga0496119_0381652
591 Ga0496120_0009320
592 Ga0496121_0000003
593 Ga0496121_0013154
594 Ga0496121_0016060
595 Ga0496121_0030835
596 Ga0496121_0098954
597 Ga0496121_0114941
598 Ga0496121_0271828
599 Ga0496121_0633115
600 Ga0496122_0067952
601 Ga0496122_0078852
602 Ga0496122_0080737
603 Ga0496122_0158541
604 Ga0496122_0159418
605 Ga0496122_0226740
606 Ga0496122_0293782
607 Ga0496122_0440391
608 Ga0496123_0009684
609 Ga0496123_0027883
610 Ga0496123_0055638
611 Ga0496124_0013275
612 Ga0496124_0025554
613 Ga0496124_0090343
614 Ga0496124_0092823
615 Ga0496124_0098227
616 Ga0496124_0200837
617 Ga0496124_0298689
618 Ga0496124_0346956
619 Ga0496124_0402633
620 Ga0496124_0433136
621 Ga0496124_0534758
622 Ga0496125_0003405
623 Ga0496125_0010745
624 Ga0496125_0566091
625 Ga0496126_0205931
626 Ga0496126_0366482
627 Ga0496126_0373861
628 Ga0496126_0375439
629 Ga0496126_0494373
630 Ga0496126_1005101
631 Ga0495678_000513
632 Ga0495678_109759
633 Ga0495682_0000001
634 nmdc:mga0yw44_192368_c1
635 nmdc:mga0k408_284307_c1
636 nmdc:mga07m45_353029_c1
637 nmdc:mga07m45_434920_c1
638 Ga0495601_0504909
639 Ga0500610_0020576
640 Ga0500643_043873
641 Ga0500646_0107348
642 Ga0500583_0208268
643 Ga0500583_0269535
644 Ga0500641_0047328
645 Ga0500557_005151
646 Ga0500562_017472
647 Ga0500569_042597
648 Ga0500594_0005205
649 Ga0500621_000001
650 Ga0500642_0463829
651 Ga0500568_0002986
652 Ga0500573_0182322
653 Ga0500588_0109152
654 Ga0500616_0004523
655 Ga0500627_0212037
656 Ga0500611_061876
657 Ga0500599_047118
658 2586206670
659 2599327689
660 2739586899
661 2826581907
662 2842727658
663 2842816839
664 2842853947
665 2842911137
666 2849283091
667 2857631925
668 2945997751
669 2954020203
670 8006992610

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

23

139

0.88

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

49

147

0.84

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

54

141

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d8p-assembly1.cif.gz_A crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.9562 4 163
3d8p-assembly2.cif.gz_B crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.9528 4 163
3d8p-assembly1.cif.gz_A crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.9446 4 163
2q7b-assembly1.cif.gz_A-2 crystal structure of acetyltransferase (np_689019.1) from streptococcus agalactiae 2603 at 2.00 a resolution 0.9416 1 161
3d8p-assembly2.cif.gz_B crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.9414 4 163
ID Description Score Start End Superfamily
3d8pA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.951 4 163 3.40.630.30
3d8pA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9392 4 163 3.40.630.30
2q7bA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9244 5 161 3.40.630.30
2q7bA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8971 5 161 3.40.630.30
af_E0CYC6_80_216_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8878 44 141 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A845SRN4-F1-model_v4 GNAT family N-acetyltransferase 0.9969 4 159 GO:0008080
AF-A0A0B4WZH6-F1-model_v4 GCN5-related N-acetyltransferase protein 0.995 1 161 GO:0008080
AF-A0A3M3S969-F1-model_v4 deleted 0.9942 2 161
AF-A0A7G6AXG7-F1-model_v4 deleted 0.994 4 163
AF-A0A4R3QLE4-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9938 1 163 GO:0008080

Map