F412428

General Info

Members Datasets Scaffolds Average Seq Length
335 191 670 147

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0170545|Ga0501034_0170545_658_1101
Length 147
Sequence MSASPTPATGMSFDPAFLMERLRTYGHGGALGITYVDHGADWCALALPYDEHLVAGPNGILASGPIVSLMDMATSMSLWIRLGRFRPQATLDLRVDYLRPARPGQTITGRGECYGATRSVGFVRGTAHDGDPADPVAHVSGTFMFTD

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
77 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
156 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
157 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
167 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
182 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
183 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
184 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
185 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
186 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
187 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
188 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
189 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
190 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
191 2739367865 Novosphingobium sp. GV013 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.97
Nodule 0
Rhizoplane 1.79
Rhizosphere 79.7
Stem 0
Stem Tuber 0
Unclassified 2.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0170545 3300049571 Bacteria 2143
2 LJQas_1006858 3300000549 Bacteria 1409
3 JGI24739J22299_10011761 3300001989 Bacteria 3225
4 JGI24739J22299_10019562 3300001989 Bacteria 2422
5 JGI24739J22299_10027687 3300001989 Bacteria 1980
6 JGI24737J22298_10002759 3300001990 Bacteria 6211
7 JGI24737J22298_10016968 3300001990 Bacteria 2348
8 JGI24737J22298_10146657 3300001990 Bacteria 697
9 JGI24735J21928_10012987 3300002067 Bacteria 2625
10 JGI24735J21928_10016142 3300002067 Bacteria 2322
11 JGI24735J21928_10019954 3300002067 Bacteria 2056
12 JGI24738J21930_10000648 3300002075 Bacteria 10051
13 JGI24744J21845_10001869 3300002077 Bacteria 4226
14 JGI25164J39214_1010745 3300002772 Bacteria 883
15 JGI25165J46597_1000023 3300003214 Bacteria 338873
16 rootH1_10107509 3300003316 Bacteria 2016
17 rootH2_10068880 3300003320 Bacteria 1676
18 rootH2_10194905 3300003320 Bacteria 1149
19 rootL2_10273647 3300003322 Bacteria 1182
20 rootH1_10040023 3300003323 Bacteria 1254
21 rootH1_10295821 3300003323 Bacteria 1113
22 Ga0055542_1008441 3300003762 Bacteria 2019
23 Ga0065707_10554733 3300005295 Bacteria 718
24 Ga0070658_10000029 3300005327 Bacteria 156910
25 Ga0070658_10000536 3300005327 Bacteria 32936
26 Ga0070658_10000851 3300005327 Bacteria 26060
27 Ga0070658_10011762 3300005327 Bacteria 7024
28 Ga0070658_10145909 3300005327 Bacteria 1979
29 Ga0070658_10404738 3300005327 Unclassified 1172
30 Ga0070658_10781842 3300005327 Bacteria 829
31 Ga0070676_10000031 3300005328 Bacteria 42113
32 Ga0070677_10000460 3300005333 Bacteria 13951
33 Ga0070666_10166751 3300005335 Bacteria 1541
34 Ga0070680_100006474 3300005336 Bacteria 8906
35 Ga0068868_100000007 3300005338 Bacteria 123028
36 Ga0070660_100000700 3300005339 Bacteria 22233
37 Ga0070660_100000715 3300005339 Bacteria 21980
38 Ga0070660_100005309 3300005339 Bacteria 8914
39 Ga0070660_100006043 3300005339 Bacteria 8371
40 Ga0070660_100015926 3300005339 Bacteria 5444
41 Ga0070660_100376421 3300005339 Bacteria 1172
42 Ga0070661_100000055 3300005344 Bacteria 88266
43 Ga0070661_100528276 3300005344 Bacteria 947
44 Ga0070692_10015367 3300005345 Bacteria 3621
45 Ga0070675_100014811 3300005354 Bacteria 6154
46 Ga0070675_100034822 3300005354 Bacteria 4088
47 Ga0070673_100000022 3300005364 Bacteria 92156
48 Ga0070673_100589708 3300005364 Bacteria 1013
49 Ga0070659_100000004 3300005366 Bacteria 267958
50 Ga0070659_100006080 3300005366 Bacteria 8707
51 Ga0070659_101151587 3300005366 Bacteria 685
52 Ga0070663_100001359 3300005455 Bacteria 13373
53 Ga0070678_100044311 3300005456 Bacteria 3176
54 Ga0070662_100014545 3300005457 Bacteria 5261
55 Ga0070681_10122957 3300005458 Bacteria 2528
56 Ga0068867_100000023 3300005459 Bacteria 92322
57 Ga0070679_100000017 3300005530 Bacteria 129377
58 Ga0070679_100727806 3300005530 Bacteria 935
59 Ga0068853_100146360 3300005539 Bacteria 2123
60 Ga0068853_100936439 3300005539 Bacteria 833
61 Ga0070672_100077795 3300005543 Bacteria 2654
62 Ga0070686_100000218 3300005544 Bacteria 39821
63 Ga0070696_100171724 3300005546 Bacteria 1603
64 Ga0070693_100044595 3300005547 Bacteria 2509
65 Ga0070665_100000054 3300005548 Bacteria 244426
66 Ga0070665_100914005 3300005548 Bacteria 890
67 Ga0070665_101376850 3300005548 Bacteria 715
68 Ga0068855_100000031 3300005563 Bacteria 170268
69 Ga0068855_100073516 3300005563 Bacteria 3972
70 Ga0070664_100450047 3300005564 Bacteria 1182
71 Ga0068857_100129981 3300005577 Bacteria 2271
72 Ga0068854_100043461 3300005578 Bacteria 3185
73 Ga0068854_100056189 3300005578 Bacteria 2836
74 Ga0068854_100126342 3300005578 Bacteria 1948
75 Ga0068856_100024524 3300005614 Bacteria 5872
76 Ga0068856_100139144 3300005614 Bacteria 2434
77 Ga0068852_100000627 3300005616 Bacteria 23092
78 Ga0068852_100859444 3300005616 Bacteria 923
79 Ga0068866_10133491 3300005718 Bacteria 1415
80 Ga0068863_100011069 3300005841 Bacteria 8748
81 Ga0068860_100001425 3300005843 Bacteria 25889
82 Ga0097621_100010552 3300006237 Bacteria 6767
83 Ga0075370_10478931 3300006353 Bacteria 750
84 Ga0068871_100010769 3300006358 Bacteria 6690
85 Ga0068865_100000031 3300006881 Bacteria 88580
86 Ga0105240_10003725 3300009093 Bacteria 23553
87 Ga0105240_10094922 3300009093 Bacteria 3637
88 Ga0105240_10318037 3300009093 Bacteria 1775
89 Ga0105240_11314132 3300009093 Bacteria 762
90 Ga0105245_10013418 3300009098 Bacteria 7137
91 Ga0105245_10346468 3300009098 Bacteria 1471
92 Ga0105247_10003119 3300009101 Bacteria 10945
93 Ga0105243_10000156 3300009148 Bacteria 78467
94 Ga0105243_11275822 3300009148 Bacteria 751
95 Ga0105243_12312116 3300009148 Bacteria 575
96 Ga0105241_10426340 3300009174 Bacteria 1168
97 Ga0105242_10004742 3300009176 Bacteria 10529
98 Ga0105248_10017071 3300009177 Bacteria 7994
99 Ga0105237_10028430 3300009545 Bacteria 5695
100 Ga0105237_10314783 3300009545 Bacteria 1568
101 Ga0105238_10273674 3300009551 Bacteria 1669
102 Ga0105238_12062408 3300009551 Bacteria 604
103 Ga0105249_10031092 3300009553 Bacteria 4827
104 Ga0105239_10001121 3300010375 Bacteria 36892
105 Ga0105239_10076889 3300010375 Bacteria 3672
106 Ga0105239_10752168 3300010375 Bacteria 1116
107 Ga0105239_11073479 3300010375 Bacteria 927
108 Ga0105239_13100509 3300010375 Bacteria 541
109 Ga0105246_10055066 3300011119 Bacteria 2744
110 Ga0105246_11524679 3300011119 Bacteria 629
111 Ga0157373_10110090 3300013100 Bacteria 1936
112 Ga0157373_10582932 3300013100 Bacteria 813
113 Ga0157371_10123433 3300013102 Bacteria 1842
114 Ga0157370_10000017 3300013104 Bacteria 169971
115 Ga0157369_10010900 3300013105 Bacteria 10354
116 Ga0157369_10014895 3300013105 Bacteria 8776
117 Ga0157374_10000656 3300013296 Bacteria 30436
118 Ga0157378_10000504 3300013297 Bacteria 37070
119 Ga0157378_10659032 3300013297 Bacteria 1063
120 Ga0163162_10047022 3300013306 Bacteria 4325
121 Ga0157372_10185041 3300013307 Bacteria 2412
122 Ga0157372_10204927 3300013307 Bacteria 2285
123 Ga0157372_10280767 3300013307 Bacteria 1936
124 Ga0157380_10672288 3300014326 Bacteria 1036
125 Ga0157380_11655808 3300014326 Bacteria 696
126 Ga0157376_10000124 3300014969 Bacteria 53299
127 Ga0163161_10331454 3300017792 Bacteria 1205
128 Ga0213873_10000027 3300021358 Bacteria 73909
129 Ga0213874_10142843 3300021377 Bacteria 830
130 Ga0213876_10000004 3300021384 Bacteria 943822
131 Ga0213876_10000395 3300021384 Bacteria 36646
132 Ga0213876_10002246 3300021384 Bacteria 11402
133 Ga0213876_10027171 3300021384 Bacteria 3020
134 Ga0207427_100774 3300025231 Bacteria 14552
135 Ga0209026_1002932 3300025250 Bacteria 5962
136 Ga0209148_1000059 3300025254 Bacteria 350224
137 Ga0209148_1001344 3300025254 Bacteria 12962
138 Ga0209233_1000003 3300025261 Bacteria 1607366
139 Ga0209455_1001597 3300025272 Bacteria 9959
140 Ga0209455_1032626 3300025272 Bacteria 863
141 Ga0207642_10107273 3300025899 Bacteria 1415
142 Ga0207710_10003845 3300025900 Bacteria 6638
143 Ga0207688_10200726 3300025901 Bacteria 1195
144 Ga0207680_10283324 3300025903 Bacteria 1152
145 Ga0207647_10000710 3300025904 Bacteria 26130
146 Ga0207647_10218224 3300025904 Bacteria 1100
147 Ga0207647_10248178 3300025904 Bacteria 1021
148 Ga0207647_10394452 3300025904 Bacteria 780
149 Ga0207645_10016352 3300025907 Bacteria 4912
150 Ga0207645_10198261 3300025907 Bacteria 1320
151 Ga0207705_10000002 3300025909 Bacteria 2046852
152 Ga0207705_10000178 3300025909 Bacteria 67084
153 Ga0207705_10000243 3300025909 Bacteria 53479
154 Ga0207705_10023638 3300025909 Bacteria 4384
155 Ga0207705_10114196 3300025909 Bacteria 1998
156 Ga0207705_10596530 3300025909 Bacteria 859
157 Ga0207707_10012541 3300025912 Bacteria 7368
158 Ga0207695_10024973 3300025913 Bacteria 6705
159 Ga0207695_10063772 3300025913 Bacteria 3797
160 Ga0207695_10262964 3300025913 Bacteria 1622
161 Ga0207695_11068708 3300025913 Bacteria 687
162 Ga0207671_10001063 3300025914 Bacteria 33331
163 Ga0207660_10030106 3300025917 Bacteria 3729
164 Ga0207657_10000519 3300025919 Bacteria 40709
165 Ga0207657_10001372 3300025919 Bacteria 25957
166 Ga0207657_10019103 3300025919 Bacteria 6519
167 Ga0207657_10019782 3300025919 Bacteria 6382
168 Ga0207657_10030954 3300025919 Bacteria 4851
169 Ga0207657_10401041 3300025919 Bacteria 1079
170 Ga0207657_10581269 3300025919 Bacteria 875
171 Ga0207649_10000018 3300025920 Bacteria 225137
172 Ga0207649_10356520 3300025920 Bacteria 1084
173 Ga0207652_10000001 3300025921 Bacteria 1006643
174 Ga0207659_10008425 3300025926 Bacteria 6399
175 Ga0207687_10114803 3300025927 Bacteria 2005
176 Ga0207687_10213353 3300025927 Bacteria 1516
177 Ga0207687_10217322 3300025927 Bacteria 1503
178 Ga0207687_10291207 3300025927 Bacteria 1312
179 Ga0207687_10403780 3300025927 Bacteria 1124
180 Ga0207690_10000001 3300025932 Bacteria 807539
181 Ga0207690_10000002 3300025932 Bacteria 807473
182 Ga0207690_10000003 3300025932 Bacteria 783011
183 Ga0207690_10000004 3300025932 Bacteria 746138
184 Ga0207690_10004468 3300025932 Bacteria 8258
185 Ga0207706_10024963 3300025933 Bacteria 5358
186 Ga0207686_10001385 3300025934 Bacteria 13769
187 Ga0207709_10000447 3300025935 Bacteria 38701
188 Ga0207704_10000008 3300025938 Bacteria 204682
189 Ga0207691_10070922 3300025940 Bacteria 3146
190 Ga0207691_10784776 3300025940 Bacteria 801
191 Ga0207711_10038379 3300025941 Bacteria 4073
192 Ga0207667_10000029 3300025949 Bacteria 329192
193 Ga0207667_10034843 3300025949 Bacteria 5403
194 Ga0207667_10233946 3300025949 Bacteria 1881
195 Ga0207667_10536301 3300025949 Bacteria 1184
196 Ga0207667_10618220 3300025949 Bacteria 1091
197 Ga0207667_10702175 3300025949 Bacteria 1014
198 Ga0207651_10000008 3300025960 Bacteria 204538
199 Ga0207651_10353460 3300025960 Bacteria 1238
200 Ga0207712_10033435 3300025961 Bacteria 3476
201 Ga0207640_10000357 3300025981 Bacteria 29919
202 Ga0207640_10023046 3300025981 Bacteria 3738
203 Ga0207677_10000014 3300026023 Bacteria 181712
204 Ga0207677_10000091 3300026023 Bacteria 74163
205 Ga0207639_10007455 3300026041 Bacteria 7463
206 Ga0207639_10508655 3300026041 Bacteria 1101
207 Ga0207678_10002781 3300026067 Bacteria 15861
208 Ga0207708_11051023 3300026075 Bacteria 709
209 Ga0207702_10013616 3300026078 Bacteria 6755
210 Ga0207702_10030512 3300026078 Bacteria 4493
211 Ga0207702_10145466 3300026078 Bacteria 2150
212 Ga0207641_10003047 3300026088 Bacteria 15101
213 Ga0207641_10013366 3300026088 Bacteria 6732
214 Ga0207641_10745482 3300026088 Bacteria 967
215 Ga0207648_10000009 3300026089 Bacteria 204229
216 Ga0207674_10155072 3300026116 Bacteria 2245
217 Ga0207683_10019752 3300026121 Bacteria 5755
218 Ga0207698_10001899 3300026142 Bacteria 12241
219 Ga0207698_10227208 3300026142 Bacteria 1691
220 Ga0207698_10526381 3300026142 Bacteria 1155
221 Ga0268266_10000414 3300028379 Bacteria 65028
222 Ga0268266_10082572 3300028379 Bacteria 2804
223 Ga0268266_10486337 3300028379 Bacteria 1177
224 Ga0268266_11308947 3300028379 Bacteria 700
225 Ga0268264_10000974 3300028381 Bacteria 29321
226 Ga0268264_10014027 3300028381 Bacteria 6588
227 Ga0307513_10048836 3300031456 Bacteria 4589
228 Ga0307408_100275844 3300031548 Bacteria 1398
229 Ga0307416_101958002 3300032002 Bacteria 689
230 Ga0307414_11783467 3300032004 Unclassified 574
231 Ga0307510_10139957 3300033180 Bacteria 2066
232 Ga0395899_0000406 3300037312 Bacteria 50248
233 Ga0395900_0193125 3300037418 Bacteria 2064
234 Ga0395900_0287725 3300037418 Bacteria 1633
235 Ga0395900_0502243 3300037418 Bacteria 1163
236 Ga0395898_0583135 3300037466 Bacteria 1061
237 Ga0395898_1856408 3300037466 Bacteria 523
238 Ga0395905_0020721 3300037471 Bacteria 6225
239 Ga0395905_0125058 3300037471 Bacteria 2418
240 Ga0395905_0144034 3300037471 Bacteria 2242
241 Ga0395905_0221539 3300037471 Bacteria 1770
242 Ga0395905_0557232 3300037471 Bacteria 1047
243 Ga0395901_0044040 3300038443 Bacteria 4629
244 Ga0395901_0466651 3300038443 Bacteria 1289
245 Ga0395901_0740739 3300038443 Bacteria 977
246 Ga0436365_0102423 3300039437 Bacteria 73123
247 Ga0436365_0487522 3300039437 Bacteria 55925
248 Ga0436365_1487768 3300039437 Bacteria 7074
249 Ga0436365_1792312 3300039437 Bacteria 3586
250 Ga0436363_1063151 3300039450 Bacteria 780
251 Ga0436362_0740394 3300039453 Bacteria 73123
252 Ga0451793_0460554 3300041452 Bacteria 778
253 Ga0451577_0538260 3300042876 Bacteria 1061
254 Ga0451577_1258480 3300042876 Unclassified 659
255 Ga0466972_0008358 3300044658 Bacteria 5188
256 Ga0466965_0105853 3300044683 Bacteria 1442
257 Ga0466966_0058153 3300044684 Bacteria 2444
258 Ga0466961_0009726 3300044693 Bacteria 6120
259 Ga0466963_0028893 3300044694 Bacteria 3564
260 Ga0466964_0044688 3300044706 Bacteria 1800
261 Ga0466964_0057123 3300044706 Bacteria 1615
262 Ga0466971_0020171 3300044719 Bacteria 2963
263 Ga0466971_0531365 3300044719 Unclassified 582
264 Ga0466968_0006722 3300044735 Bacteria 4346
265 Ga0466968_0079968 3300044735 Bacteria 1434
266 Ga0466968_0249347 3300044735 Bacteria 843
267 Ga0466968_0279620 3300044735 Unclassified 798
268 Ga0466957_0064047 3300044842 Bacteria 2261
269 Ga0466957_0071019 3300044842 Bacteria 2152
270 Ga0466960_0001025 3300044901 Bacteria 9987
271 Ga0466959_0038923 3300045049 Bacteria 3513
272 Ga0451576_0643722 3300045051 Bacteria 1114
273 Ga0466958_0011710 3300045836 Bacteria 4948
274 Ga0466958_0163972 3300045836 Bacteria 1405
275 Ga0466967_0066889 3300045976 Bacteria 3203
276 Ga0495638_0029330 3300046460 Bacteria 3547
277 Ga0495583_0000286 3300046506 Bacteria 80417
278 Ga0495606_0001833 3300046507 Bacteria 26898
279 Ga0495642_0067472 3300046528 Bacteria 1492
280 Ga0495654_0021389 3300046530 Bacteria 3365
281 Ga0495661_0017039 3300046665 Bacteria 4800
282 Ga0495670_0198804 3300046691 Bacteria 1061
283 Ga0495673_0009463 3300047469 Bacteria 5394
284 Ga0495673_0176781 3300047469 Bacteria 810
285 Ga0495686_0000147 3300047472 Bacteria 139008
286 Ga0495686_0229089 3300047472 Bacteria 1053
287 Ga0496102_0256501 3300048905 Bacteria 1649
288 Ga0496102_1109822 3300048905 Bacteria 711
289 Ga0496109_1067034 3300048912 Bacteria 745
290 Ga0496115_0216090 3300048918 Bacteria 1583
291 Ga0496115_0556642 3300048918 Bacteria 916
292 Ga0496117_0041777 3300048920 Bacteria 3354
293 Ga0496117_0057975 3300048920 Bacteria 2685
294 Ga0496117_0068570 3300048920 Bacteria 2393
295 Ga0496118_0086805 3300048921 Bacteria 2173
296 Ga0496118_0089979 3300048921 Bacteria 2117
297 Ga0496118_0134093 3300048921 Bacteria 1583
298 Ga0496118_0170172 3300048921 Bacteria 1332
299 Ga0496119_0153595 3300048922 Bacteria 1231
300 Ga0496119_0166534 3300048922 Bacteria 1167
301 Ga0496120_0038278 3300048923 Bacteria 2839
302 Ga0496121_0008708 3300048924 Bacteria 11847
303 Ga0496121_0017421 3300048924 Bacteria 7342
304 Ga0496121_0019788 3300048924 Bacteria 6708
305 Ga0496121_0033641 3300048924 Bacteria 4634
306 Ga0496122_0009442 3300048925 Bacteria 10277
307 Ga0496123_0016119 3300048926 Bacteria 6088
308 Ga0496123_0030231 3300048926 Bacteria 3968
309 Ga0496124_0164781 3300048927 Bacteria 1724
310 Ga0496125_0029710 3300048928 Bacteria 4906
311 Ga0496126_0012159 3300048929 Bacteria 8836
312 Ga0496126_0639519 3300048929 Unclassified 834
313 Ga0501033_0098051 3300049570 Bacteria 2141
314 Ga0501034_1099370 3300049571 Bacteria 676
315 Ga0501036_0529422 3300049572 Bacteria 980
316 Ga0501047_1098399 3300049581 Bacteria 609
317 Ga0501069_0003685 3300049585 Bacteria 7884
318 Ga0501070_0096165 3300049586 Bacteria 2450
319 Ga0501035_0199127 3300049822 Bacteria 1719
320 Ga0501044_0144009 3300049823 Bacteria 2370
321 nmdc:mga0sz30_27297_c1 3300050516 Bacteria 2344
322 Ga0500643_000590 3300053087 Bacteria 25096
323 Ga0500643_056755 3300053087 Bacteria 1106
324 Ga0500555_000197 3300053103 Bacteria 27950
325 Ga0500556_0148207 3300053104 Unclassified 924
326 Ga0500592_001082 3300053116 Bacteria 4437
327 Ga0500559_0398632 3300053136 Bacteria 640
328 Ga0500616_0007276 3300053153 Bacteria 7064
329 Ga0500616_0029597 3300053153 Bacteria 3012
330 Ga0500627_0006961 3300053158 Bacteria 3897
331 Ga0466962_0004869 3300061719 Bacteria 6457
332 Ga0466962_0062570 3300061719 Bacteria 1777
333 Ga0466962_0103801 3300061719 Bacteria 1366
334 2739649189 2739367664 Bacteria 4114334
335 2740027662 2739367865 Bacteria 4114482
336 Ga0501034_0170545
337 LJQas_1006858
338 JGI24739J22299_10011761
339 JGI24739J22299_10019562
340 JGI24739J22299_10027687
341 JGI24737J22298_10002759
342 JGI24737J22298_10016968
343 JGI24737J22298_10146657
344 JGI24735J21928_10012987
345 JGI24735J21928_10016142
346 JGI24735J21928_10019954
347 JGI24738J21930_10000648
348 JGI24744J21845_10001869
349 JGI25164J39214_1010745
350 JGI25165J46597_1000023
351 rootH1_10107509
352 rootH2_10068880
353 rootH2_10194905
354 rootL2_10273647
355 rootH1_10040023
356 rootH1_10295821
357 Ga0055542_1008441
358 Ga0065707_10554733
359 Ga0070658_10000029
360 Ga0070658_10000536
361 Ga0070658_10000851
362 Ga0070658_10011762
363 Ga0070658_10145909
364 Ga0070658_10404738
365 Ga0070658_10781842
366 Ga0070676_10000031
367 Ga0070677_10000460
368 Ga0070666_10166751
369 Ga0070680_100006474
370 Ga0068868_100000007
371 Ga0070660_100000700
372 Ga0070660_100000715
373 Ga0070660_100005309
374 Ga0070660_100006043
375 Ga0070660_100015926
376 Ga0070660_100376421
377 Ga0070661_100000055
378 Ga0070661_100528276
379 Ga0070692_10015367
380 Ga0070675_100014811
381 Ga0070675_100034822
382 Ga0070673_100000022
383 Ga0070673_100589708
384 Ga0070659_100000004
385 Ga0070659_100006080
386 Ga0070659_101151587
387 Ga0070663_100001359
388 Ga0070678_100044311
389 Ga0070662_100014545
390 Ga0070681_10122957
391 Ga0068867_100000023
392 Ga0070679_100000017
393 Ga0070679_100727806
394 Ga0068853_100146360
395 Ga0068853_100936439
396 Ga0070672_100077795
397 Ga0070686_100000218
398 Ga0070696_100171724
399 Ga0070693_100044595
400 Ga0070665_100000054
401 Ga0070665_100914005
402 Ga0070665_101376850
403 Ga0068855_100000031
404 Ga0068855_100073516
405 Ga0070664_100450047
406 Ga0068857_100129981
407 Ga0068854_100043461
408 Ga0068854_100056189
409 Ga0068854_100126342
410 Ga0068856_100024524
411 Ga0068856_100139144
412 Ga0068852_100000627
413 Ga0068852_100859444
414 Ga0068866_10133491
415 Ga0068863_100011069
416 Ga0068860_100001425
417 Ga0097621_100010552
418 Ga0075370_10478931
419 Ga0068871_100010769
420 Ga0068865_100000031
421 Ga0105240_10003725
422 Ga0105240_10094922
423 Ga0105240_10318037
424 Ga0105240_11314132
425 Ga0105245_10013418
426 Ga0105245_10346468
427 Ga0105247_10003119
428 Ga0105243_10000156
429 Ga0105243_11275822
430 Ga0105243_12312116
431 Ga0105241_10426340
432 Ga0105242_10004742
433 Ga0105248_10017071
434 Ga0105237_10028430
435 Ga0105237_10314783
436 Ga0105238_10273674
437 Ga0105238_12062408
438 Ga0105249_10031092
439 Ga0105239_10001121
440 Ga0105239_10076889
441 Ga0105239_10752168
442 Ga0105239_11073479
443 Ga0105239_13100509
444 Ga0105246_10055066
445 Ga0105246_11524679
446 Ga0157373_10110090
447 Ga0157373_10582932
448 Ga0157371_10123433
449 Ga0157370_10000017
450 Ga0157369_10010900
451 Ga0157369_10014895
452 Ga0157374_10000656
453 Ga0157378_10000504
454 Ga0157378_10659032
455 Ga0163162_10047022
456 Ga0157372_10185041
457 Ga0157372_10204927
458 Ga0157372_10280767
459 Ga0157380_10672288
460 Ga0157380_11655808
461 Ga0157376_10000124
462 Ga0163161_10331454
463 Ga0213873_10000027
464 Ga0213874_10142843
465 Ga0213876_10000004
466 Ga0213876_10000395
467 Ga0213876_10002246
468 Ga0213876_10027171
469 Ga0207427_100774
470 Ga0209026_1002932
471 Ga0209148_1000059
472 Ga0209148_1001344
473 Ga0209233_1000003
474 Ga0209455_1001597
475 Ga0209455_1032626
476 Ga0207642_10107273
477 Ga0207710_10003845
478 Ga0207688_10200726
479 Ga0207680_10283324
480 Ga0207647_10000710
481 Ga0207647_10218224
482 Ga0207647_10248178
483 Ga0207647_10394452
484 Ga0207645_10016352
485 Ga0207645_10198261
486 Ga0207705_10000002
487 Ga0207705_10000178
488 Ga0207705_10000243
489 Ga0207705_10023638
490 Ga0207705_10114196
491 Ga0207705_10596530
492 Ga0207707_10012541
493 Ga0207695_10024973
494 Ga0207695_10063772
495 Ga0207695_10262964
496 Ga0207695_11068708
497 Ga0207671_10001063
498 Ga0207660_10030106
499 Ga0207657_10000519
500 Ga0207657_10001372
501 Ga0207657_10019103
502 Ga0207657_10019782
503 Ga0207657_10030954
504 Ga0207657_10401041
505 Ga0207657_10581269
506 Ga0207649_10000018
507 Ga0207649_10356520
508 Ga0207652_10000001
509 Ga0207659_10008425
510 Ga0207687_10114803
511 Ga0207687_10213353
512 Ga0207687_10217322
513 Ga0207687_10291207
514 Ga0207687_10403780
515 Ga0207690_10000001
516 Ga0207690_10000002
517 Ga0207690_10000003
518 Ga0207690_10000004
519 Ga0207690_10004468
520 Ga0207706_10024963
521 Ga0207686_10001385
522 Ga0207709_10000447
523 Ga0207704_10000008
524 Ga0207691_10070922
525 Ga0207691_10784776
526 Ga0207711_10038379
527 Ga0207667_10000029
528 Ga0207667_10034843
529 Ga0207667_10233946
530 Ga0207667_10536301
531 Ga0207667_10618220
532 Ga0207667_10702175
533 Ga0207651_10000008
534 Ga0207651_10353460
535 Ga0207712_10033435
536 Ga0207640_10000357
537 Ga0207640_10023046
538 Ga0207677_10000014
539 Ga0207677_10000091
540 Ga0207639_10007455
541 Ga0207639_10508655
542 Ga0207678_10002781
543 Ga0207708_11051023
544 Ga0207702_10013616
545 Ga0207702_10030512
546 Ga0207702_10145466
547 Ga0207641_10003047
548 Ga0207641_10013366
549 Ga0207641_10745482
550 Ga0207648_10000009
551 Ga0207674_10155072
552 Ga0207683_10019752
553 Ga0207698_10001899
554 Ga0207698_10227208
555 Ga0207698_10526381
556 Ga0268266_10000414
557 Ga0268266_10082572
558 Ga0268266_10486337
559 Ga0268266_11308947
560 Ga0268264_10000974
561 Ga0268264_10014027
562 Ga0307513_10048836
563 Ga0307408_100275844
564 Ga0307416_101958002
565 Ga0307414_11783467
566 Ga0307510_10139957
567 Ga0395899_0000406
568 Ga0395900_0193125
569 Ga0395900_0287725
570 Ga0395900_0502243
571 Ga0395898_0583135
572 Ga0395898_1856408
573 Ga0395905_0020721
574 Ga0395905_0125058
575 Ga0395905_0144034
576 Ga0395905_0221539
577 Ga0395905_0557232
578 Ga0395901_0044040
579 Ga0395901_0466651
580 Ga0395901_0740739
581 Ga0436365_0102423
582 Ga0436365_0487522
583 Ga0436365_1487768
584 Ga0436365_1792312
585 Ga0436363_1063151
586 Ga0436362_0740394
587 Ga0451793_0460554
588 Ga0451577_0538260
589 Ga0451577_1258480
590 Ga0466972_0008358
591 Ga0466965_0105853
592 Ga0466966_0058153
593 Ga0466961_0009726
594 Ga0466963_0028893
595 Ga0466964_0044688
596 Ga0466964_0057123
597 Ga0466971_0020171
598 Ga0466971_0531365
599 Ga0466968_0006722
600 Ga0466968_0079968
601 Ga0466968_0249347
602 Ga0466968_0279620
603 Ga0466957_0064047
604 Ga0466957_0071019
605 Ga0466960_0001025
606 Ga0466959_0038923
607 Ga0451576_0643722
608 Ga0466958_0011710
609 Ga0466958_0163972
610 Ga0466967_0066889
611 Ga0495638_0029330
612 Ga0495583_0000286
613 Ga0495606_0001833
614 Ga0495642_0067472
615 Ga0495654_0021389
616 Ga0495661_0017039
617 Ga0495670_0198804
618 Ga0495673_0009463
619 Ga0495673_0176781
620 Ga0495686_0000147
621 Ga0495686_0229089
622 Ga0496102_0256501
623 Ga0496102_1109822
624 Ga0496109_1067034
625 Ga0496115_0216090
626 Ga0496115_0556642
627 Ga0496117_0041777
628 Ga0496117_0057975
629 Ga0496117_0068570
630 Ga0496118_0086805
631 Ga0496118_0089979
632 Ga0496118_0134093
633 Ga0496118_0170172
634 Ga0496119_0153595
635 Ga0496119_0166534
636 Ga0496120_0038278
637 Ga0496121_0008708
638 Ga0496121_0017421
639 Ga0496121_0019788
640 Ga0496121_0033641
641 Ga0496122_0009442
642 Ga0496123_0016119
643 Ga0496123_0030231
644 Ga0496124_0164781
645 Ga0496125_0029710
646 Ga0496126_0012159
647 Ga0496126_0639519
648 Ga0501033_0098051
649 Ga0501034_1099370
650 Ga0501036_0529422
651 Ga0501047_1098399
652 Ga0501069_0003685
653 Ga0501070_0096165
654 Ga0501035_0199127
655 Ga0501044_0144009
656 nmdc:mga0sz30_27297_c1
657 Ga0500643_000590
658 Ga0500643_056755
659 Ga0500555_000197
660 Ga0500556_0148207
661 Ga0500592_001082
662 Ga0500559_0398632
663 Ga0500616_0007276
664 Ga0500616_0029597
665 Ga0500627_0006961
666 Ga0466962_0004869
667 Ga0466962_0062570
668 Ga0466962_0103801
669 2739649189
670 2740027662

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

58

136

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dsl-assembly1.cif.gz_A mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 0.909 26 145
3dkz-assembly1.cif.gz_A crystal structure of the q7w9w5_borpa protein from bordetella parapertussis. northeast structural genomics consortium target bpr208c. 0.9062 23 146
1ixl-assembly1.cif.gz_A crystal structure of uncharacterized protein ph1136 from pyrococcus horikoshii 0.9061 32 146
1wlu-assembly1.cif.gz_A crystal structure of tt0310 protein from thermus thermophilus hb8 0.9049 26 145
3lbe-assembly1.cif.gz_B the crystal structure of smu.793 from streptococcus mutans ua159 bound to acetyl coa 0.9046 31 145
ID Description Score Start End Superfamily
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9049 26 145 3.10.129.10
1zkiB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9012 20 145 3.10.129.10
af_Q54GL4_70_197_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8905 19 144 3.10.129.10
af_A0A1D6F200_19_155_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8897 30 146 3.10.129.10
3s4kB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8886 23 146 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A0Q8XKJ1-F1-model_v4 Phenylacetic acid degradation protein 0.9909 24 145 GO:0005829
GO:0061522
AF-A0A7Y0BLM3-F1-model_v4 PaaI family thioesterase 0.9889 10 146 GO:0016289
AF-A0A4U1L686-F1-model_v4 PaaI family thioesterase 0.9887 29 146 GO:0005829
GO:0061522
AF-A0A259HG76-F1-model_v4 Phenylacetic acid degradation protein 0.9886 22 129 GO:0016289
AF-A0A245ZJ21-F1-model_v4 Thioesterase domain-containing protein 0.9878 23 146 GO:0016289

Map