F412461

General Info

Members Datasets Scaffolds Average Seq Length
335 216 670 276

Family's Representative Sequence

Representative Sequence 3300053156|Ga0500622_0004002|Ga0500622_0004002_4376_5353
Length 325
Sequence MDTVAGMPKVSKAPAASRRIAEPSLATPLAIPSAAPVDRALVGVDFTSAPTTRKPIRLAFGRRQGSVLKLERQVGMTSLDAFESWLAEPGPWLGGFDLPFGLPRELIETLGWPTEWAPLIAHYASLSRAEIRDTFAAFCDARPVGGKFAHRACDGPAGSSPSMKWVNPPVAYMLHAGVPRLLRAGVDLPGLHAGDRSRIALEAYPGLLARELIGTRSYKSDDRAKQTPDRLIARKDVIEALEQGRSRLGLRLKLSHAQRDELADDGSGDKLDAVLCLMQAAWADARPDYGLPADLDPLEGWILCAPRTAPAASTLPTSRTRRMTT

Samples

Sample ID Description Type Environment
1 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
44 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
52 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
61 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
66 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
92 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
112 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
113 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
114 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
115 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
116 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
117 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
118 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
119 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
120 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
121 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
137 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
140 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
161 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
162 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
163 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
166 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
170 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
171 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
172 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
173 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
174 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
175 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
176 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
177 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
178 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
179 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
180 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
181 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
182 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
183 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
184 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
185 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
186 2643221596 Acidovorax sp. Root70 Isolate Unclassified
187 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
188 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
189 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
190 2643221658 Variovorax sp. Root411 Isolate Unclassified
191 2643221660 Methylibium sp. Root1272 Isolate Unclassified
192 2643221672 Variovorax sp. Root434 Isolate Unclassified
193 2643221683 Variovorax sp. Root473 Isolate Unclassified
194 2738541277 Variovorax sp. GV051 Isolate Unclassified
195 2738541307 Variovorax sp. GV008 Isolate Unclassified
196 2738543019 Variovorax sp. GV040 Isolate Unclassified
197 2818991446 Variovorax sp. 1180 Isolate Unclassified
198 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
199 2831864461 Roseateles noduli HZ7 Isolate Nodule
200 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
201 2842733646 Variovorax sp. R-72446 Isolate Unclassified
202 2842747753 Variovorax sp. R-72060 Isolate Unclassified
203 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
204 2885198086 Variovorax sp. 679 Isolate Unclassified
205 2885211737 Variovorax sp. 553 Isolate Unclassified
206 2899924645 Variovorax sp. 369 Isolate Unclassified
207 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
208 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
209 2928037797 Variovorax sp. 1126 Isolate Unclassified
210 2928044640 Variovorax sp. 1128 Isolate Unclassified
211 2928051484 Variovorax sp. 1133 Isolate Unclassified
212 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
213 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
214 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
215 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
216 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.25
Metatranscriptomes 0.6
Isolates 10.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 39.7
Nodule 1.19
Rhizoplane 1.79
Rhizosphere 40.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500622_0004002 3300053156 Bacteria 9498
2 JGI25152J39213_1001945 3300002773 Bacteria 8224
3 JGI25152J39213_1002156 3300002773 Bacteria 7717
4 JGI25150J39212_1002677 3300002774 Bacteria 4345
5 JGI25159J45721_1001946 3300002987 Bacteria 8224
6 JGI25151J46595_10006122 3300003187 Bacteria 6105
7 JGI25151J46595_10018335 3300003187 Bacteria 3010
8 JGI25153J46596_10006229 3300003215 Bacteria 6105
9 rootH2_10019901 3300003320 Bacteria 2289
10 rootH1_10006141 3300003323 Bacteria 19182
11 rootH1_10013234 3300003323 Bacteria 4711
12 JGI25160J50197_1002666 3300003354 Bacteria 8224
13 JGI25160J50197_1006098 3300003354 Bacteria 4919
14 JGI25161J50226_1001766 3300003374 Bacteria 6101
15 JGI26138J51218_100586 3300003504 Bacteria 1402
16 Ga0006562J51391_1010057 3300003578 Bacteria 14357
17 Ga0006562J51391_1015350 3300003578 Bacteria 2480
18 Ga0055525_1000004 3300003759 Bacteria 888039
19 Ga0055527_1011649 3300003760 Bacteria 1004
20 Ga0055535_1000380 3300003761 Bacteria 42008
21 Ga0055542_1000062 3300003762 Bacteria 161494
22 Ga0055526_1002708 3300003771 Bacteria 11776
23 Ga0055526_1006802 3300003771 Bacteria 6105
24 Ga0055526_1006863 3300003771 Bacteria 6070
25 Ga0055537_1000550 3300003773 Bacteria 21428
26 Ga0055537_1002506 3300003773 Bacteria 6105
27 Ga0055537_1005807 3300003773 Bacteria 3238
28 Ga0055524_1000624 3300003775 Bacteria 25410
29 Ga0055524_1004870 3300003775 Bacteria 6105
30 Ga0055524_1004908 3300003775 Bacteria 6070
31 Ga0055524_1007033 3300003775 Bacteria 4832
32 Ga0055536_1004758 3300003781 Bacteria 6813
33 Ga0055536_1006164 3300003781 Bacteria 5666
34 Ga0055536_1014016 3300003781 Bacteria 2844
35 Ga0055534_1002628 3300003784 Bacteria 6105
36 Ga0055534_1002657 3300003784 Bacteria 6060
37 Ga0055528_1005215 3300003790 Bacteria 6105
38 Ga0055528_1012761 3300003790 Bacteria 3238
39 Ga0055530_10002499 3300003791 Bacteria 11772
40 Ga0055530_10002623 3300003791 Bacteria 11288
41 Ga0055530_10004408 3300003791 Bacteria 7255
42 Ga0055540_1003710 3300003792 Bacteria 7229
43 Ga0055540_1003828 3300003792 Bacteria 7076
44 Ga0055540_1004055 3300003792 Bacteria 6805
45 Ga0055540_1008094 3300003792 Bacteria 3839
46 Ga0055540_1024224 3300003792 Bacteria 1510
47 Ga0055531_10002552 3300003794 Bacteria 12116
48 Ga0055531_10002742 3300003794 Bacteria 11576
49 Ga0055531_10007057 3300003794 Bacteria 6215
50 Ga0055531_10007106 3300003794 Bacteria 6184
51 Ga0055543_1000989 3300004625 Bacteria 12816
52 Ga0055543_1001878 3300004625 Bacteria 7636
53 Ga0055543_1003616 3300004625 Bacteria 4471
54 Ga0065165_1000129 3300005262 Bacteria 129359
55 Ga0065165_1000344 3300005262 Bacteria 76165
56 Ga0065165_1004528 3300005262 Bacteria 8520
57 Ga0065165_1010737 3300005262 Bacteria 3913
58 Ga0070661_100011952 3300005344 Bacteria 6064
59 Ga0070661_100153249 3300005344 Bacteria 1743
60 Ga0070671_100012286 3300005355 Bacteria 6892
61 Ga0070659_100002665 3300005366 Bacteria 12692
62 Ga0070659_100047192 3300005366 Bacteria 3378
63 Ga0070663_100318151 3300005455 Bacteria 1251
64 Ga0070662_100004015 3300005457 Bacteria 9229
65 Ga0070662_100022288 3300005457 Bacteria 4334
66 Ga0070662_100117765 3300005457 Bacteria 2032
67 Ga0070662_100181353 3300005457 Bacteria 1660
68 Ga0068853_100190433 3300005539 Bacteria 1863
69 Ga0068855_100226216 3300005563 Bacteria 2096
70 Ga0070664_100042036 3300005564 Bacteria 3859
71 Ga0068864_100286979 3300005618 Bacteria 1537
72 Ga0068851_10030593 3300005834 Bacteria 2670
73 Ga0068860_100050041 3300005843 Bacteria 3979
74 Ga0075432_10002702 3300006058 Bacteria 5931
75 Ga0075369_10017183 3300006186 Bacteria 2929
76 Ga0075366_10032956 3300006195 Bacteria 3051
77 Ga0075366_10305800 3300006195 Bacteria 973
78 Ga0075370_10005920 3300006353 Bacteria 6117
79 Ga0075370_10016644 3300006353 Bacteria 3958
80 Ga0099823_1000038 3300006944 Bacteria 61505
81 Ga0105244_10003426 3300009036 Bacteria 11307
82 Ga0105240_10082717 3300009093 Bacteria 3942
83 Ga0105240_10581509 3300009093 Bacteria 1235
84 Ga0105245_10359532 3300009098 Bacteria 1445
85 Ga0105243_10004593 3300009148 Bacteria 10885
86 Ga0105243_10004693 3300009148 Bacteria 10757
87 Ga0105243_10028330 3300009148 Bacteria 4299
88 Ga0105248_10001747 3300009177 Bacteria 24182
89 Ga0105238_10092567 3300009551 Bacteria 3011
90 Ga0105239_10643745 3300010375 Bacteria 1210
91 Ga0157317_1000239 3300012475 Bacteria 2026
92 Ga0157319_1000003 3300012497 Bacteria 397199
93 Ga0157371_10008532 3300013102 Bacteria 8157
94 Ga0157371_10308459 3300013102 Bacteria 1146
95 Ga0157380_10415613 3300014326 Bacteria 1281
96 Ga0182008_10001756 3300014497 Bacteria 14210
97 Ga0182008_10136744 3300014497 Bacteria 1224
98 Ga0157379_10065073 3300014968 Bacteria 3259
99 Ga0182006_1000705 3300015261 Bacteria 23167
100 Ga0182006_1033676 3300015261 Bacteria 2053
101 Ga0182007_10000957 3300015262 Bacteria 15855
102 Ga0163161_10042530 3300017792 Bacteria 3268
103 Ga0213872_10001026 3300021361 Bacteria 19491
104 Ga0209436_110461 3300025208 Bacteria 1696
105 Ga0209672_101806 3300025228 Bacteria 6543
106 Ga0209563_100013 3300025230 Bacteria 941463
107 Ga0209258_100154 3300025242 Bacteria 158235
108 Ga0207425_1001372 3300025245 Bacteria 10313
109 Ga0207425_1011150 3300025245 Bacteria 2155
110 Ga0209148_1000145 3300025254 Bacteria 161352
111 Ga0209129_1000054 3300025258 Bacteria 261997
112 Ga0209129_1004503 3300025258 Bacteria 5405
113 Ga0209565_1000185 3300025263 Bacteria 76451
114 Ga0209565_1001534 3300025263 Bacteria 9949
115 Ga0209673_1000172 3300025273 Bacteria 133472
116 Ga0209673_1003839 3300025273 Bacteria 8491
117 Ga0209673_1004159 3300025273 Bacteria 7912
118 Ga0209673_1009381 3300025273 Bacteria 4246
119 Ga0209130_1001009 3300025284 Bacteria 21838
120 Ga0209130_1001241 3300025284 Bacteria 17909
121 Ga0209675_1001255 3300025291 Bacteria 15212
122 Ga0209675_1004900 3300025291 Bacteria 5779
123 Ga0209676_1000103 3300025292 Bacteria 226908
124 Ga0209676_1003243 3300025292 Bacteria 10256
125 Ga0209676_1004667 3300025292 Bacteria 7524
126 Ga0209676_1004823 3300025292 Bacteria 7323
127 Ga0209025_1000310 3300025294 Bacteria 108186
128 Ga0209025_1000474 3300025294 Bacteria 78060
129 Ga0209025_1010766 3300025294 Bacteria 6146
130 Ga0209564_1000003 3300025295 Bacteria 1585848
131 Ga0209564_1000241 3300025295 Bacteria 118237
132 Ga0209564_1001015 3300025295 Bacteria 34625
133 Ga0209758_1000034 3300025297 Bacteria 467637
134 Ga0209758_1009936 3300025297 Bacteria 5798
135 Ga0209050_1000012 3300025298 Bacteria 813717
136 Ga0209050_1000143 3300025298 Bacteria 171806
137 Ga0209050_1000294 3300025298 Bacteria 105705
138 Ga0209050_1002640 3300025298 Bacteria 14708
139 Ga0209256_1000103 3300025299 Bacteria 193900
140 Ga0209256_1000150 3300025299 Bacteria 146086
141 Ga0209256_1000165 3300025299 Bacteria 135104
142 Ga0209256_1000521 3300025299 Bacteria 56291
143 Ga0207426_1000058 3300025302 Bacteria 363857
144 Ga0207426_1000067 3300025302 Bacteria 342108
145 Ga0209051_1000019 3300025303 Bacteria 511268
146 Ga0209051_1000876 3300025303 Bacteria 30404
147 Ga0209051_1001048 3300025303 Bacteria 26073
148 Ga0209051_1003164 3300025303 Bacteria 11037
149 Ga0209051_1010246 3300025303 Bacteria 4756
150 Ga0209257_1000024 3300025304 Bacteria 726068
151 Ga0209257_1000057 3300025304 Bacteria 396985
152 Ga0209257_1000803 3300025304 Bacteria 45706
153 Ga0209257_1002264 3300025304 Bacteria 19650
154 Ga0209257_1003704 3300025304 Bacteria 12716
155 Ga0207656_10006718 3300025321 Bacteria 4156
156 Ga0207655_1005464 3300025728 Bacteria 8630
157 Ga0207649_10015753 3300025920 Bacteria 4249
158 Ga0207649_10215074 3300025920 Bacteria 1366
159 Ga0207694_10064045 3300025924 Bacteria 2865
160 Ga0207690_10006208 3300025932 Bacteria 7076
161 Ga0207690_10152027 3300025932 Bacteria 1717
162 Ga0207706_10001637 3300025933 Bacteria 22174
163 Ga0207706_10005566 3300025933 Bacteria 11745
164 Ga0207706_10151346 3300025933 Bacteria 2041
165 Ga0207706_10162136 3300025933 Bacteria 1965
166 Ga0207709_10000215 3300025935 Bacteria 73474
167 Ga0207709_10001162 3300025935 Bacteria 19142
168 Ga0207679_10005996 3300025945 Bacteria 7643
169 Ga0207679_10304672 3300025945 Bacteria 1374
170 Ga0207639_10237550 3300026041 Bacteria 1583
171 Ga0207648_10056883 3300026089 Bacteria 3413
172 Ga0209389_1008572 3300027296 Bacteria 9108
173 Ga0209968_1005144 3300027526 Bacteria 1962
174 Ga0209970_1000655 3300027614 Bacteria 6006
175 Ga0209971_1009480 3300027682 Bacteria 2306
176 Ga0209966_1000628 3300027695 Bacteria 8059
177 Ga0209974_10012638 3300027876 Bacteria 2821
178 Ga0316177_1118953 3300030731 Bacteria 1612
179 Ga0307513_10080341 3300031456 Bacteria 3364
180 Ga0307408_100042947 3300031548 Bacteria 3214
181 Ga0307514_10000762 3300031649 Bacteria 53648
182 Ga0307516_10004908 3300031730 Bacteria 16269
183 Ga0307516_10159272 3300031730 Bacteria 2009
184 Ga0307405_10004410 3300031731 Bacteria 6651
185 Ga0307416_100026022 3300032002 Bacteria 4304
186 Ga0307416_100308154 3300032002 Bacteria 1578
187 Ga0307411_10105026 3300032005 Bacteria 2007
188 Ga0307510_10267844 3300033180 Bacteria 1186
189 Ga0395899_0157334 3300037312 Bacteria 1607
190 Ga0395900_0000050 3300037418 Bacteria 224616
191 Ga0395898_0002499 3300037466 Bacteria 21625
192 Ga0395905_0006888 3300037471 Bacteria 11365
193 Ga0395905_0043157 3300037471 Bacteria 4231
194 Ga0395901_0134250 3300038443 Bacteria 2601
195 Ga0436361_0794259 3300039447 Bacteria 17377
196 Ga0439436_0000671 3300041404 Bacteria 9170
197 Ga0439465_0081579 3300041413 Bacteria 1097
198 Ga0451791_0466228 3300041451 Bacteria 1692
199 Ga0451791_1551273 3300041451 Bacteria 1123
200 Ga0439431_0008312 3300041997 Bacteria 2331
201 Ga0439449_0030165 3300042007 Bacteria 2021
202 Ga0439449_0045622 3300042007 Bacteria 1624
203 Ga0439455_0011227 3300042012 Bacteria 1985
204 Ga0439457_007441 3300042014 Bacteria 2627
205 Ga0439462_0054895 3300042015 Bacteria 1074
206 Ga0450898_008262 3300042134 Bacteria 1638
207 Ga0439459_0000312 3300042438 Bacteria 5886
208 Ga0451577_0000190 3300042876 Bacteria 130692
209 Ga0451577_0000895 3300042876 Bacteria 44166
210 Ga0451577_0205743 3300042876 Bacteria 1777
211 Ga0466969_0000093 3300044656 Bacteria 46242
212 Ga0466969_0059691 3300044656 Bacteria 1854
213 Ga0466972_0006276 3300044658 Bacteria 5970
214 Ga0466965_0062364 3300044683 Bacteria 1865
215 Ga0466965_0130661 3300044683 Bacteria 1302
216 Ga0466966_0115121 3300044684 Bacteria 1655
217 Ga0466961_0002099 3300044693 Bacteria 12406
218 Ga0466961_0105711 3300044693 Bacteria 1772
219 Ga0466963_0009172 3300044694 Bacteria 5950
220 Ga0466963_0084776 3300044694 Bacteria 2150
221 Ga0466964_0011526 3300044706 Bacteria 3341
222 Ga0466964_0104203 3300044706 Bacteria 1255
223 Ga0453684_0000618 3300044712 Bacteria 129995
224 Ga0453684_0271851 3300044712 Bacteria 1936
225 Ga0466970_0009375 3300044765 Bacteria 4947
226 Ga0466970_0028479 3300044765 Bacteria 2935
227 Ga0466957_0067060 3300044842 Bacteria 2213
228 Ga0466959_0000027 3300045049 Bacteria 114262
229 Ga0466959_0115169 3300045049 Bacteria 1915
230 Ga0451576_0001628 3300045051 Bacteria 37621
231 Ga0451576_0006575 3300045051 Bacteria 14219
232 Ga0466967_0006228 3300045976 Bacteria 8412
233 Ga0495627_005576 3300046453 Bacteria 5043
234 Ga0495590_0030475 3300046457 Bacteria 1890
235 Ga0495638_0036626 3300046460 Bacteria 3124
236 Ga0495650_0030577 3300046471 Bacteria 2437
237 Ga0495605_0041655 3300046474 Bacteria 2287
238 Ga0495610_0101098 3300046512 Bacteria 1291
239 Ga0495616_0002528 3300046513 Bacteria 12090
240 Ga0495620_0020644 3300046515 Bacteria 3215
241 Ga0495631_0000553 3300046518 Bacteria 25076
242 Ga0495654_0008030 3300046530 Bacteria 5857
243 Ga0495625_0121423 3300046660 Bacteria 1777
244 Ga0495635_0287633 3300046663 Bacteria 1103
245 Ga0495658_0048933 3300046683 Bacteria 2386
246 Ga0495670_0022068 3300046691 Bacteria 3143
247 Ga0495687_013635 3300047443 Bacteria 4226
248 Ga0495593_0059313 3300047673 Bacteria 2005
249 Ga0496105_0419655 3300048908 Bacteria 1059
250 Ga0496111_0190672 3300048914 Bacteria 1524
251 Ga0496112_0007636 3300048915 Bacteria 9615
252 Ga0496113_0003190 3300048916 Bacteria 9771
253 Ga0496116_0015944 3300048919 Bacteria 5909
254 Ga0496117_0021939 3300048920 Bacteria 5140
255 Ga0496117_0023639 3300048920 Bacteria 4889
256 Ga0496118_0005839 3300048921 Bacteria 13800
257 Ga0496118_0096684 3300048921 Bacteria 2012
258 Ga0496118_0098633 3300048921 Bacteria 1983
259 Ga0496121_0016431 3300048924 Bacteria 7645
260 Ga0496121_0066885 3300048924 Bacteria 2915
261 Ga0496122_0000204 3300048925 Bacteria 132123
262 Ga0496122_0073005 3300048925 Bacteria 2436
263 Ga0496122_0170585 3300048925 Bacteria 1312
264 Ga0496123_0001226 3300048926 Bacteria 37377
265 Ga0496123_0048326 3300048926 Bacteria 2863
266 Ga0496123_0059852 3300048926 Bacteria 2459
267 Ga0496123_0174333 3300048926 Bacteria 1131
268 Ga0496124_0000138 3300048927 Bacteria 150311
269 Ga0496124_0008218 3300048927 Bacteria 10946
270 Ga0496124_0011865 3300048927 Bacteria 8676
271 Ga0496124_0031874 3300048927 Bacteria 4661
272 Ga0496125_0005833 3300048928 Bacteria 13526
273 Ga0496125_0052465 3300048928 Bacteria 3353
274 Ga0496126_0233182 3300048929 Bacteria 1541
275 Ga0496126_0278187 3300048929 Bacteria 1387
276 nmdc:mga03n38_219443_c1 3300050490 Bacteria 992
277 nmdc:mga0yw44_657_c1 3300050492 Bacteria 12590
278 nmdc:mga0k408_129179_c1 3300050493 Bacteria 1500
279 nmdc:mga07m45_14640_c1 3300050496 Bacteria 4183
280 nmdc:mga07m45_193614_c1 3300050496 Bacteria 1183
281 nmdc:mga07m45_26917_c1 3300050496 Bacteria 3163
282 Ga0500651_0000137 3300053093 Bacteria 45846
283 Ga0500651_0040578 3300053093 Bacteria 2932
284 Ga0500560_048912 3300053107 Bacteria 1352
285 Ga0500571_000067 3300053110 Bacteria 32699
286 Ga0500593_000318 3300053117 Bacteria 19357
287 Ga0500594_0001202 3300053118 Bacteria 5591
288 Ga0500594_0052207 3300053118 Bacteria 1155
289 Ga0500607_052565 3300053121 Bacteria 2162
290 Ga0500608_059903 3300053122 Bacteria 1821
291 Ga0500618_024559 3300053125 Bacteria 1451
292 Ga0500655_002350 3300053133 Bacteria 3467
293 Ga0500658_0000836 3300053134 Bacteria 12678
294 Ga0500658_0001025 3300053134 Bacteria 11402
295 Ga0500559_0001487 3300053136 Bacteria 13220
296 Ga0500559_0001525 3300053136 Bacteria 12983
297 Ga0500559_0002957 3300053136 Bacteria 8540
298 Ga0500568_0004221 3300053139 Bacteria 7737
299 Ga0500568_0008403 3300053139 Bacteria 4975
300 Ga0500616_0038378 3300053153 Bacteria 2587
301 Ga0500634_0002032 3300053161 Bacteria 8314
302 2513231059 2513020051 Bacteria 6053213
303 2588290955 2588253510 Bacteria 6901809
304 2643972106 2643221592 Bacteria 6608788
305 2643991665 2643221596 Bacteria 5006805
306 2644142306 2643221625 Bacteria 6512927
307 2644275999 2643221648 Bacteria 6521465
308 2644301454 2643221654 Bacteria 5273570
309 2644325527 2643221658 Bacteria 6064537
310 2644340453 2643221660 Bacteria 4208257
311 2644399251 2643221672 Bacteria 6322190
312 2644467067 2643221683 Bacteria 5749203
313 2738718224 2738541277 Bacteria 7458140
314 2738880386 2738541307 Bacteria 8606193
315 2739281411 2738543019 Bacteria 7459457
316 2819600542 2818991446 Bacteria 7757362
317 2831267732 2831265667 Bacteria 7184833
318 2831865937 2831864461 Bacteria 6502356
319 2838061540 2838054893 Bacteria 7451788
320 2842736334 2842733646 Bacteria 5716726
321 2842748843 2842747753 Bacteria 5578255
322 2885196908 2885192300 Bacteria 5882526
323 2885198798 2885198086 Bacteria 7212419
324 2885211822 2885211737 Bacteria 7212420
325 2899928311 2899924645 Bacteria 7487985
326 2904545097 2904541872 Bacteria 8915136
327 2919707164 2919704043 Bacteria 5560311
328 2928041263 2928037797 Bacteria 7273642
329 2928048105 2928044640 Bacteria 7271509
330 2928055946 2928051484 Bacteria 7773759
331 2928066573 2928064002 Bacteria 7419480
332 2928087574 2928084124 Bacteria 7159212
333 2928120694 2928115317 Bacteria 6477646
334 2929165275 2929160207 Bacteria 9075316
335 2954768800 2954767861 Bacteria 5535784
336 Ga0500622_0004002
337 JGI25152J39213_1001945
338 JGI25152J39213_1002156
339 JGI25150J39212_1002677
340 JGI25159J45721_1001946
341 JGI25151J46595_10006122
342 JGI25151J46595_10018335
343 JGI25153J46596_10006229
344 rootH2_10019901
345 rootH1_10006141
346 rootH1_10013234
347 JGI25160J50197_1002666
348 JGI25160J50197_1006098
349 JGI25161J50226_1001766
350 JGI26138J51218_100586
351 Ga0006562J51391_1010057
352 Ga0006562J51391_1015350
353 Ga0055525_1000004
354 Ga0055527_1011649
355 Ga0055535_1000380
356 Ga0055542_1000062
357 Ga0055526_1002708
358 Ga0055526_1006802
359 Ga0055526_1006863
360 Ga0055537_1000550
361 Ga0055537_1002506
362 Ga0055537_1005807
363 Ga0055524_1000624
364 Ga0055524_1004870
365 Ga0055524_1004908
366 Ga0055524_1007033
367 Ga0055536_1004758
368 Ga0055536_1006164
369 Ga0055536_1014016
370 Ga0055534_1002628
371 Ga0055534_1002657
372 Ga0055528_1005215
373 Ga0055528_1012761
374 Ga0055530_10002499
375 Ga0055530_10002623
376 Ga0055530_10004408
377 Ga0055540_1003710
378 Ga0055540_1003828
379 Ga0055540_1004055
380 Ga0055540_1008094
381 Ga0055540_1024224
382 Ga0055531_10002552
383 Ga0055531_10002742
384 Ga0055531_10007057
385 Ga0055531_10007106
386 Ga0055543_1000989
387 Ga0055543_1001878
388 Ga0055543_1003616
389 Ga0065165_1000129
390 Ga0065165_1000344
391 Ga0065165_1004528
392 Ga0065165_1010737
393 Ga0070661_100011952
394 Ga0070661_100153249
395 Ga0070671_100012286
396 Ga0070659_100002665
397 Ga0070659_100047192
398 Ga0070663_100318151
399 Ga0070662_100004015
400 Ga0070662_100022288
401 Ga0070662_100117765
402 Ga0070662_100181353
403 Ga0068853_100190433
404 Ga0068855_100226216
405 Ga0070664_100042036
406 Ga0068864_100286979
407 Ga0068851_10030593
408 Ga0068860_100050041
409 Ga0075432_10002702
410 Ga0075369_10017183
411 Ga0075366_10032956
412 Ga0075366_10305800
413 Ga0075370_10005920
414 Ga0075370_10016644
415 Ga0099823_1000038
416 Ga0105244_10003426
417 Ga0105240_10082717
418 Ga0105240_10581509
419 Ga0105245_10359532
420 Ga0105243_10004593
421 Ga0105243_10004693
422 Ga0105243_10028330
423 Ga0105248_10001747
424 Ga0105238_10092567
425 Ga0105239_10643745
426 Ga0157317_1000239
427 Ga0157319_1000003
428 Ga0157371_10008532
429 Ga0157371_10308459
430 Ga0157380_10415613
431 Ga0182008_10001756
432 Ga0182008_10136744
433 Ga0157379_10065073
434 Ga0182006_1000705
435 Ga0182006_1033676
436 Ga0182007_10000957
437 Ga0163161_10042530
438 Ga0213872_10001026
439 Ga0209436_110461
440 Ga0209672_101806
441 Ga0209563_100013
442 Ga0209258_100154
443 Ga0207425_1001372
444 Ga0207425_1011150
445 Ga0209148_1000145
446 Ga0209129_1000054
447 Ga0209129_1004503
448 Ga0209565_1000185
449 Ga0209565_1001534
450 Ga0209673_1000172
451 Ga0209673_1003839
452 Ga0209673_1004159
453 Ga0209673_1009381
454 Ga0209130_1001009
455 Ga0209130_1001241
456 Ga0209675_1001255
457 Ga0209675_1004900
458 Ga0209676_1000103
459 Ga0209676_1003243
460 Ga0209676_1004667
461 Ga0209676_1004823
462 Ga0209025_1000310
463 Ga0209025_1000474
464 Ga0209025_1010766
465 Ga0209564_1000003
466 Ga0209564_1000241
467 Ga0209564_1001015
468 Ga0209758_1000034
469 Ga0209758_1009936
470 Ga0209050_1000012
471 Ga0209050_1000143
472 Ga0209050_1000294
473 Ga0209050_1002640
474 Ga0209256_1000103
475 Ga0209256_1000150
476 Ga0209256_1000165
477 Ga0209256_1000521
478 Ga0207426_1000058
479 Ga0207426_1000067
480 Ga0209051_1000019
481 Ga0209051_1000876
482 Ga0209051_1001048
483 Ga0209051_1003164
484 Ga0209051_1010246
485 Ga0209257_1000024
486 Ga0209257_1000057
487 Ga0209257_1000803
488 Ga0209257_1002264
489 Ga0209257_1003704
490 Ga0207656_10006718
491 Ga0207655_1005464
492 Ga0207649_10015753
493 Ga0207649_10215074
494 Ga0207694_10064045
495 Ga0207690_10006208
496 Ga0207690_10152027
497 Ga0207706_10001637
498 Ga0207706_10005566
499 Ga0207706_10151346
500 Ga0207706_10162136
501 Ga0207709_10000215
502 Ga0207709_10001162
503 Ga0207679_10005996
504 Ga0207679_10304672
505 Ga0207639_10237550
506 Ga0207648_10056883
507 Ga0209389_1008572
508 Ga0209968_1005144
509 Ga0209970_1000655
510 Ga0209971_1009480
511 Ga0209966_1000628
512 Ga0209974_10012638
513 Ga0316177_1118953
514 Ga0307513_10080341
515 Ga0307408_100042947
516 Ga0307514_10000762
517 Ga0307516_10004908
518 Ga0307516_10159272
519 Ga0307405_10004410
520 Ga0307416_100026022
521 Ga0307416_100308154
522 Ga0307411_10105026
523 Ga0307510_10267844
524 Ga0395899_0157334
525 Ga0395900_0000050
526 Ga0395898_0002499
527 Ga0395905_0006888
528 Ga0395905_0043157
529 Ga0395901_0134250
530 Ga0436361_0794259
531 Ga0439436_0000671
532 Ga0439465_0081579
533 Ga0451791_0466228
534 Ga0451791_1551273
535 Ga0439431_0008312
536 Ga0439449_0030165
537 Ga0439449_0045622
538 Ga0439455_0011227
539 Ga0439457_007441
540 Ga0439462_0054895
541 Ga0450898_008262
542 Ga0439459_0000312
543 Ga0451577_0000190
544 Ga0451577_0000895
545 Ga0451577_0205743
546 Ga0466969_0000093
547 Ga0466969_0059691
548 Ga0466972_0006276
549 Ga0466965_0062364
550 Ga0466965_0130661
551 Ga0466966_0115121
552 Ga0466961_0002099
553 Ga0466961_0105711
554 Ga0466963_0009172
555 Ga0466963_0084776
556 Ga0466964_0011526
557 Ga0466964_0104203
558 Ga0453684_0000618
559 Ga0453684_0271851
560 Ga0466970_0009375
561 Ga0466970_0028479
562 Ga0466957_0067060
563 Ga0466959_0000027
564 Ga0466959_0115169
565 Ga0451576_0001628
566 Ga0451576_0006575
567 Ga0466967_0006228
568 Ga0495627_005576
569 Ga0495590_0030475
570 Ga0495638_0036626
571 Ga0495650_0030577
572 Ga0495605_0041655
573 Ga0495610_0101098
574 Ga0495616_0002528
575 Ga0495620_0020644
576 Ga0495631_0000553
577 Ga0495654_0008030
578 Ga0495625_0121423
579 Ga0495635_0287633
580 Ga0495658_0048933
581 Ga0495670_0022068
582 Ga0495687_013635
583 Ga0495593_0059313
584 Ga0496105_0419655
585 Ga0496111_0190672
586 Ga0496112_0007636
587 Ga0496113_0003190
588 Ga0496116_0015944
589 Ga0496117_0021939
590 Ga0496117_0023639
591 Ga0496118_0005839
592 Ga0496118_0096684
593 Ga0496118_0098633
594 Ga0496121_0016431
595 Ga0496121_0066885
596 Ga0496122_0000204
597 Ga0496122_0073005
598 Ga0496122_0170585
599 Ga0496123_0001226
600 Ga0496123_0048326
601 Ga0496123_0059852
602 Ga0496123_0174333
603 Ga0496124_0000138
604 Ga0496124_0008218
605 Ga0496124_0011865
606 Ga0496124_0031874
607 Ga0496125_0005833
608 Ga0496125_0052465
609 Ga0496126_0233182
610 Ga0496126_0278187
611 nmdc:mga03n38_219443_c1
612 nmdc:mga0yw44_657_c1
613 nmdc:mga0k408_129179_c1
614 nmdc:mga07m45_14640_c1
615 nmdc:mga07m45_193614_c1
616 nmdc:mga07m45_26917_c1
617 Ga0500651_0000137
618 Ga0500651_0040578
619 Ga0500560_048912
620 Ga0500571_000067
621 Ga0500593_000318
622 Ga0500594_0001202
623 Ga0500594_0052207
624 Ga0500607_052565
625 Ga0500608_059903
626 Ga0500618_024559
627 Ga0500655_002350
628 Ga0500658_0000836
629 Ga0500658_0001025
630 Ga0500559_0001487
631 Ga0500559_0001525
632 Ga0500559_0002957
633 Ga0500568_0004221
634 Ga0500568_0008403
635 Ga0500616_0038378
636 Ga0500634_0002032
637 2513231059
638 2588290955
639 2643972106
640 2643991665
641 2644142306
642 2644275999
643 2644301454
644 2644325527
645 2644340453
646 2644399251
647 2644467067
648 2738718224
649 2738880386
650 2739281411
651 2819600542
652 2831267732
653 2831865937
654 2838061540
655 2842736334
656 2842748843
657 2885196908
658 2885198798
659 2885211822
660 2899928311
661 2904545097
662 2919707164
663 2928041263
664 2928048105
665 2928055946
666 2928066573
667 2928087574
668 2928120694
669 2929165275
670 2954768800

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ewp-assembly1.cif.gz_A mus musculus cep120 third c2 domain (c2c) 0.7186 15 40
6wts-assembly1.cif.gz_C cryoem structure of the c. sordellii lethal toxin tcsl in complex with sema6a 0.6171 2 36
6kxt-assembly1.cif.gz_A bon1-c2b 0.603 16 44
4y1s-assembly1.cif.gz_A structural basis for ca2+-mediated interaction of the perforin c2 domain with lipid membranes 0.5647 13 40
6l0w-assembly2.cif.gz_C structure of rld2 brx domain bound to lzy3 ccl motif 0.5629 19 48
ID Description Score Start End Superfamily
af_A1ZBD6_215_358_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.6749 16 40 2.60.40.150
af_M9PE32_646_779_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.6384 17 47 2.60.40.150
af_Q12466_382_517_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.6279 16 40 2.60.40.150
af_C0HDP4_212_345_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.6239 15 40 2.60.40.150
af_A0A0R0FP05_243_329_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6168 1 49 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A1H7ES98-F1-model_v4 DUF429 domain-containing protein 0.9674 29 274
AF-A0A1H7ES98-F1-model_v4 DUF429 domain-containing protein 0.9598 29 274
AF-A0A1G6NZB0-F1-model_v4 DUF429 domain-containing protein 0.9578 2 274
AF-A0A1H0LBU2-F1-model_v4 DUF429 domain-containing protein 0.9566 2 274
AF-A0A2Z2LIF8-F1-model_v4 deleted 0.9556 1 274

Map