F412472

General Info

Members Datasets Scaffolds Average Seq Length
335 243 670 245

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2791355406|2793984143
Length 290
Sequence PSPTRVLVVDDDPTVAEVVAGYLGRAGFAVDRAADGPGALARAAARRPDLVVLDLMLPGMDGLEVCRALRDKGPVPVIMLTARGDEEDRILGLEIGADDYVTKPFSPRELVLRVESVLRRGRTGPRVPGPSGPGSGLGSDEVTHRAGITLDPLARRAARDGRELALTVREFDLLAFLLRHPGVAFTREELMREVWGWDFGDLSTVTVHVRRLRGKVEDDPAAPRLIQTVWGIGYRFDAPPETDDRAHGEERRDEGRGDDGRRDEARAGQGRDEGRAGQEWDEGRGPGSDA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
16 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
17 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
18 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
22 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
23 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
28 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
29 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
30 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
45 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
46 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
47 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
48 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
49 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
50 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
51 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
52 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
53 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
56 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
61 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
62 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
63 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
64 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
65 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
66 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
67 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
68 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
69 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
70 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
71 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
72 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
73 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
74 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
75 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
76 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
77 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
78 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
79 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
80 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
81 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
82 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
83 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
84 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
85 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
86 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
103 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
106 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
109 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
110 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
111 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
112 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
123 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
127 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
131 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
132 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
133 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
136 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
137 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
140 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
141 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
177 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
178 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
181 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
182 2501939600 Micromonospora sp. L5 Isolate Unclassified
183 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
184 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
185 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
186 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
187 2643221647 Streptomyces sp. Root369 Isolate Unclassified
188 2643221670 Streptomyces sp. Root431 Isolate Unclassified
189 2643221714 Streptomyces sp. Root264 Isolate Unclassified
190 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
191 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
192 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
193 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
194 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
195 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
196 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
197 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
198 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
199 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
200 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
201 2862574272 Streptomyces sp. AcE210 Isolate Nodule
202 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
203 2867428634 Streptomyces sp. RP5T Isolate Unclassified
204 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
205 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
206 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
207 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
208 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
209 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
210 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
211 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
212 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
213 2922554459 Rhodococcus sp. 66b Isolate Unclassified
214 2928153084 Leifsonia sp. 563 Isolate Unclassified
215 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
216 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
217 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
218 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
219 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
220 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
221 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
222 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
223 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
224 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
225 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
226 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
227 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
228 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
229 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
230 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
231 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
232 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
233 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
234 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
235 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
236 649633069 Micromonospora sp. L5 Isolate Unclassified
237 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
238 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
239 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
240 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
241 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
242 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
243 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.6
Metatranscriptomes 0.6
Isolates 18.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.48
Nodule 0.6
Rhizoplane 9.25
Rhizosphere 74.33
Stem 0
Stem Tuber 0.3
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10045371 3300001979 Bacteria 1298
2 JGI24739J22299_10037178 3300001989 Bacteria 1641
3 JGI24739J22299_10059099 3300001989 Bacteria 1215
4 JGI24735J21928_10010302 3300002067 Bacteria 2984
5 JGI25164J39214_1001371 3300002772 Bacteria 5864
6 JGI25165J46597_1000005 3300003214 Bacteria 623702
7 Ga0006562J51391_1099579 3300003578 Bacteria 19170
8 Ga0006562J51391_1099580 3300003578 Bacteria 19303
9 Ga0065714_10080688 3300005288 Bacteria 2423
10 Ga0070675_100046770 3300005354 Bacteria 3545
11 Ga0070675_100343600 3300005354 Bacteria 1322
12 Ga0070674_100049682 3300005356 Bacteria 2885
13 Ga0070667_100120518 3300005367 Bacteria 2281
14 Ga0070663_100044229 3300005455 Bacteria 3138
15 Ga0070662_100490151 3300005457 Bacteria 1024
16 Ga0070672_100024157 3300005543 Bacteria 4487
17 Ga0075363_100012632 3300006048 Bacteria 4073
18 Ga0075370_10032662 3300006353 Bacteria 2911
19 Ga0075370_10046586 3300006353 Bacteria 2454
20 Ga0099826_10116111 3300006948 Bacteria 1585
21 Ga0105251_10124784 3300009011 Bacteria 1169
22 Ga0105244_10004039 3300009036 Bacteria 10247
23 Ga0105244_10047598 3300009036 Bacteria 2199
24 Ga0105245_10070293 3300009098 Bacteria 3176
25 Ga0105243_10001014 3300009148 Bacteria 25960
26 Ga0105248_10127188 3300009177 Bacteria 2874
27 Ga0105246_10006151 3300011119 Bacteria 7324
28 Ga0105246_10075653 3300011119 Bacteria 2384
29 Ga0105246_10202884 3300011119 Bacteria 1543
30 Ga0105246_10326843 3300011119 Bacteria 1248
31 Ga0157371_10107684 3300013102 Bacteria 1978
32 Ga0157369_10105336 3300013105 Bacteria 3003
33 Ga0157369_10298614 3300013105 Bacteria 1676
34 Ga0163162_10535069 3300013306 Bacteria 1301
35 Ga0157372_10432316 3300013307 Bacteria 1534
36 Ga0207427_100024 3300025231 Bacteria 438403
37 Ga0209437_100337 3300025233 Bacteria 57371
38 Ga0209233_1000001 3300025261 Bacteria 2992747
39 Ga0209051_1054436 3300025303 Bacteria 1306
40 Ga0209051_1065052 3300025303 Bacteria 1127
41 Ga0207697_10008046 3300025315 Bacteria 4651
42 Ga0207697_10024714 3300025315 Bacteria 2459
43 Ga0207655_1036208 3300025728 Bacteria 2191
44 Ga0207655_1060280 3300025728 Bacteria 1472
45 Ga0207647_10182603 3300025904 Bacteria 1218
46 Ga0207645_10012935 3300025907 Bacteria 5645
47 Ga0207681_10040590 3300025923 Bacteria 3098
48 Ga0207650_10210484 3300025925 Bacteria 1561
49 Ga0207687_10083130 3300025927 Bacteria 2317
50 Ga0207706_10054198 3300025933 Bacteria 3539
51 Ga0207709_10001803 3300025935 Bacteria 14335
52 Ga0207669_10075487 3300025937 Bacteria 2136
53 Ga0207691_10004181 3300025940 Bacteria 14020
54 Ga0207658_10097342 3300025986 Bacteria 2297
55 Ga0207683_10002349 3300026121 Bacteria 16575
56 Ga0307515_10204415 3300028794 Bacteria 1840
57 Ga0307512_10068451 3300030522 Bacteria 2663
58 Ga0265340_10020430 3300031247 Bacteria 3403
59 Ga0307513_10341998 3300031456 Bacteria 1246
60 Ga0307408_100019652 3300031548 Bacteria 4550
61 Ga0307508_10130356 3300031616 Bacteria 2117
62 Ga0307514_10048390 3300031649 Bacteria 3312
63 Ga0307514_10179237 3300031649 Bacteria 1369
64 Ga0307405_10053627 3300031731 Bacteria 2513
65 Ga0307518_10014721 3300031838 Bacteria 5594
66 Ga0307412_10267033 3300031911 Bacteria 1337
67 Ga0307416_100051571 3300032002 Bacteria 3287
68 Ga0307415_100025474 3300032126 Bacteria 3713
69 Ga0395899_0039610 3300037312 Bacteria 3527
70 Ga0395900_0013120 3300037418 Bacteria 8467
71 Ga0395900_0031354 3300037418 Bacteria 5461
72 Ga0395905_0118184 3300037471 Bacteria 2492
73 Ga0395901_0047597 3300038443 Bacteria 4452
74 Ga0395901_0050562 3300038443 Bacteria 4318
75 Ga0439436_0051356 3300041404 Bacteria 1164
76 Ga0439438_023258 3300041405 Bacteria 1710
77 Ga0439438_026939 3300041405 Bacteria 1555
78 Ga0439439_0043804 3300041406 Bacteria 1164
79 Ga0439466_0001982 3300041411 Bacteria 8026
80 Ga0439466_0007329 3300041411 Bacteria 4179
81 Ga0451791_0954000 3300041451 Bacteria 1126
82 Ga0451853_0522993 3300041512 Bacteria 10018
83 Ga0451853_3331785 3300041512 Bacteria 1821
84 Ga0451853_3912389 3300041512 Bacteria 826
85 Ga0439431_0040022 3300041997 Bacteria 1191
86 Ga0439433_0001247 3300041999 Bacteria 5245
87 Ga0439433_0001916 3300041999 Bacteria 4355
88 Ga0439442_000305 3300042002 Bacteria 11877
89 Ga0439442_001525 3300042002 Bacteria 4542
90 Ga0439442_009009 3300042002 Bacteria 2017
91 Ga0439442_019952 3300042002 Bacteria 1388
92 Ga0439432_002792 3300042006 Bacteria 6511
93 Ga0439449_0000825 3300042007 Bacteria 11992
94 Ga0439449_0028339 3300042007 Bacteria 2087
95 Ga0439452_021094 3300042010 Bacteria 1701
96 Ga0439455_0023573 3300042012 Bacteria 1482
97 Ga0439462_0067185 3300042015 Bacteria 972
98 Ga0450919_004752 3300042121 Bacteria 1650
99 Ga0450923_027502 3300042125 Bacteria 1144
100 Ga0450898_008428 3300042134 Bacteria 1627
101 Ga0450900_008137 3300042136 Bacteria 1305
102 Ga0450903_000185 3300042138 Bacteria 13851
103 Ga0450907_016877 3300042146 Bacteria 1217
104 Ga0439458_0000421 3300042157 Bacteria 10668
105 Ga0450908_000474 3300042184 Bacteria 7741
106 Ga0450909_001967 3300042185 Bacteria 2898
107 Ga0439434_0025642 3300042435 Bacteria 1779
108 Ga0466969_0035968 3300044656 Bacteria 2504
109 Ga0466972_0001634 3300044658 Bacteria 10969
110 Ga0466965_0002419 3300044683 Bacteria 7927
111 Ga0466965_0036659 3300044683 Bacteria 2406
112 Ga0466966_0013187 3300044684 Bacteria 5473
113 Ga0466961_0002255 3300044693 Bacteria 11980
114 Ga0466961_0077788 3300044693 Bacteria 2101
115 Ga0466963_0006051 3300044694 Bacteria 7129
116 Ga0466964_0003471 3300044706 Bacteria 5753
117 Ga0466970_0009424 3300044765 Bacteria 4935
118 Ga0466957_0003068 3300044842 Bacteria 9085
119 Ga0466957_0048116 3300044842 Bacteria 2592
120 Ga0466960_0053381 3300044901 Bacteria 1958
121 Ga0466959_0002168 3300045049 Bacteria 12475
122 Ga0466958_0007080 3300045836 Bacteria 6140
123 Ga0466967_0001960 3300045976 Bacteria 12458
124 Ga0466967_0136970 3300045976 Bacteria 2277
125 Ga0495603_0007964 3300046455 Bacteria 6394
126 Ga0495603_0014183 3300046455 Bacteria 4821
127 Ga0495603_0025024 3300046455 Bacteria 3610
128 Ga0495629_0000574 3300046459 Bacteria 29816
129 Ga0495653_0004126 3300046463 Bacteria 11751
130 Ga0495580_0004189 3300046472 Bacteria 12137
131 Ga0495580_0017699 3300046472 Bacteria 5320
132 Ga0495582_0006999 3300046473 Bacteria 6272
133 Ga0495639_0001548 3300046475 Bacteria 10263
134 Ga0495662_0010982 3300046476 Bacteria 4428
135 Ga0495662_0015602 3300046476 Bacteria 3687
136 Ga0495664_0016364 3300046477 Bacteria 4223
137 Ga0495585_0067129 3300046492 Bacteria 1963
138 Ga0495594_0009729 3300046499 Bacteria 4974
139 Ga0495594_0012865 3300046499 Bacteria 4364
140 Ga0495594_0046256 3300046499 Bacteria 2390
141 Ga0495594_0175239 3300046499 Bacteria 1220
142 Ga0495606_0002570 3300046507 Bacteria 20794
143 Ga0495631_0266027 3300046518 Bacteria 730
144 Ga0495663_0068387 3300046525 Bacteria 1128
145 Ga0495642_0004830 3300046528 Bacteria 5207
146 Ga0495642_0023023 3300046528 Bacteria 2458
147 Ga0495665_0002576 3300046531 Bacteria 9789
148 Ga0495665_0009676 3300046531 Bacteria 5219
149 Ga0495586_0001722 3300046535 Bacteria 11943
150 Ga0495586_0005938 3300046535 Bacteria 6535
151 Ga0495586_0062532 3300046535 Bacteria 2027
152 Ga0495586_0102052 3300046535 Bacteria 1592
153 Ga0495587_0006004 3300046536 Bacteria 7915
154 Ga0495609_0115111 3300046538 Bacteria 1159
155 Ga0495645_0020246 3300046543 Bacteria 4797
156 Ga0495645_0139627 3300046543 Bacteria 1692
157 Ga0495633_0063875 3300046558 Bacteria 1722
158 Ga0495667_0132961 3300046559 Bacteria 1604
159 Ga0495656_0009699 3300046615 Bacteria 3472
160 Ga0495656_0017685 3300046615 Bacteria 2724
161 Ga0495656_0022608 3300046615 Bacteria 2465
162 Ga0495668_0000627 3300046616 Bacteria 42535
163 Ga0495668_0015070 3300046616 Bacteria 4522
164 Ga0495668_0060424 3300046616 Bacteria 2091
165 Ga0495668_0068493 3300046616 Bacteria 1952
166 Ga0495625_0000161 3300046660 Bacteria 103972
167 Ga0495635_0351075 3300046663 Bacteria 984
168 Ga0495588_0008257 3300046674 Bacteria 4769
169 Ga0495588_0008681 3300046674 Bacteria 4669
170 Ga0495588_0018827 3300046674 Bacteria 3373
171 Ga0495588_0040622 3300046674 Bacteria 2373
172 Ga0495657_0007714 3300046675 Bacteria 8282
173 Ga0495657_0015836 3300046675 Bacteria 5507
174 Ga0495623_0011111 3300046679 Bacteria 5828
175 Ga0495613_0000486 3300046689 Bacteria 33719
176 Ga0495613_0018726 3300046689 Bacteria 5163
177 Ga0495613_0438896 3300046689 Bacteria 886
178 Ga0495670_0005585 3300046691 Bacteria 6170
179 Ga0495670_0025529 3300046691 Bacteria 2923
180 Ga0495670_0126671 3300046691 Bacteria 1329
181 Ga0495589_0177279 3300046794 Bacteria 1012
182 Ga0495600_0000445 3300046809 Bacteria 21337
183 Ga0495581_0001412 3300047315 Bacteria 13313
184 Ga0495581_0003897 3300047315 Bacteria 8583
185 Ga0495581_0265712 3300047315 Bacteria 1003
186 Ga0495636_0008512 3300047318 Bacteria 4049
187 Ga0495636_0054981 3300047318 Bacteria 1673
188 Ga0495676_0001903 3300047321 Bacteria 18327
189 Ga0495676_0012167 3300047321 Bacteria 7761
190 Ga0495676_0303895 3300047321 Bacteria 1075
191 Ga0495676_0398833 3300047321 Bacteria 913
192 Ga0495680_0013588 3300047322 Bacteria 7094
193 Ga0495680_0242972 3300047322 Bacteria 1278
194 Ga0495683_0051583 3300047323 Bacteria 2056
195 Ga0495675_0009083 3300047444 Bacteria 6177
196 Ga0495677_0031896 3300047445 Bacteria 1918
197 Ga0495677_0076851 3300047445 Bacteria 1249
198 Ga0495685_016273 3300047447 Bacteria 2540
199 Ga0495685_017920 3300047447 Bacteria 2427
200 Ga0495685_041344 3300047447 Bacteria 1576
201 Ga0495681_0041228 3300047470 Bacteria 2242
202 Ga0495681_0108373 3300047470 Bacteria 1206
203 Ga0495593_0049485 3300047673 Bacteria 2230
204 Ga0495593_0118097 3300047673 Bacteria 1351
205 Ga0495614_0000254 3300048089 Bacteria 20846
206 Ga0495615_0010437 3300048090 Bacteria 1857
207 Ga0495626_0000051 3300048091 Bacteria 156449
208 Ga0496100_0046779 3300048903 Bacteria 2784
209 Ga0496100_0185082 3300048903 Bacteria 1508
210 Ga0496101_0027393 3300048904 Bacteria 3970
211 Ga0496101_0236923 3300048904 Bacteria 1419
212 Ga0496102_0088316 3300048905 Bacteria 2865
213 Ga0496102_0159920 3300048905 Bacteria 2118
214 Ga0496102_0237482 3300048905 Bacteria 1719
215 Ga0496102_0374177 3300048905 Bacteria 1340
216 Ga0496103_0035736 3300048906 Bacteria 3042
217 Ga0496103_0055142 3300048906 Bacteria 2464
218 Ga0496103_0255139 3300048906 Bacteria 1128
219 Ga0496104_0462899 3300048907 Bacteria 1179
220 Ga0496105_0257399 3300048908 Bacteria 1412
221 Ga0496106_0079500 3300048909 Bacteria 2517
222 Ga0496106_0677894 3300048909 Bacteria 822
223 Ga0496107_0036954 3300048910 Bacteria 3504
224 Ga0496107_0061033 3300048910 Bacteria 2729
225 Ga0496107_0501315 3300048910 Bacteria 900
226 Ga0496109_0007197 3300048912 Bacteria 9403
227 Ga0496109_0062861 3300048912 Bacteria 3395
228 Ga0496109_0105479 3300048912 Bacteria 2617
229 Ga0496110_0157088 3300048913 Bacteria 2060
230 Ga0496110_0208922 3300048913 Bacteria 1774
231 Ga0496111_0048247 3300048914 Bacteria 3067
232 Ga0496112_0021441 3300048915 Bacteria 6145
233 Ga0496114_0029868 3300048917 Bacteria 4481
234 Ga0496114_0270727 3300048917 Bacteria 1496
235 Ga0496114_0306514 3300048917 Bacteria 1402
236 Ga0496115_0181489 3300048918 Bacteria 1740
237 Ga0496117_0021993 3300048920 Bacteria 5131
238 Ga0496119_0088463 3300048922 Bacteria 1766
239 Ga0496125_0039304 3300048928 Bacteria 4076
240 Ga0496125_0211557 3300048928 Bacteria 1259
241 Ga0501031_0032342 3300049568 Bacteria 3410
242 Ga0501032_0000360 3300049569 Bacteria 37966
243 Ga0501032_0045964 3300049569 Bacteria 2951
244 Ga0501033_0028365 3300049570 Bacteria 4205
245 Ga0501034_0000015 3300049571 Bacteria 296163
246 Ga0501034_0025866 3300049571 Bacteria 5977
247 Ga0501036_0032771 3300049572 Bacteria 4392
248 Ga0501037_0006559 3300049573 Bacteria 8518
249 Ga0501037_0057812 3300049573 Bacteria 2831
250 Ga0501038_0016680 3300049574 Bacteria 6655
251 Ga0501039_0029591 3300049575 Bacteria 4218
252 Ga0501042_0088562 3300049578 Bacteria 2221
253 Ga0501043_0002592 3300049579 Bacteria 15270
254 Ga0501043_0016343 3300049579 Bacteria 5821
255 Ga0501046_0032759 3300049580 Bacteria 4205
256 Ga0501047_0008481 3300049581 Bacteria 9697
257 Ga0501047_0026165 3300049581 Bacteria 5612
258 Ga0501070_0030144 3300049586 Bacteria 4546
259 Ga0501072_0341023 3300049588 Bacteria 1190
260 Ga0501035_0019341 3300049822 Bacteria 6264
261 Ga0501035_0037129 3300049822 Bacteria 4413
262 Ga0501044_0014177 3300049823 Bacteria 8607
263 Ga0501045_0026975 3300049824 Bacteria 4135
264 Ga0501045_0201762 3300049824 Bacteria 1482
265 nmdc:mga03n38_156367_c1 3300050490 Bacteria 1151
266 nmdc:mga03n38_9254_c1 3300050490 Bacteria 3573
267 nmdc:mga03n38_95978_c1 3300050490 Bacteria 1421
268 nmdc:mga0sz30_137228_c1 3300050516 Bacteria 1079
269 Ga0500559_0001148 3300053136 Bacteria 15973
270 Ga0501084_0282769 3300054114 Bacteria 1401
271 Ga0501084_0876411 3300054114 Bacteria 755
272 Ga0466962_0001226 3300061719 Bacteria 11802
273 2793984143 2791355406 Bacteria 11364898
274 2501940480 2501939600 Bacteria 6907073
275 2547409946 2547132111 Bacteria 8013147
276 2566992120 2565956761 Bacteria 6601618
277 2585300506 2582581312 Bacteria 7308206
278 2585307286 2582581313 Bacteria 10042643
279 2644264822 2643221647 Bacteria 10741251
280 2644386221 2643221670 Bacteria 6497041
281 2644627238 2643221714 Bacteria 9015452
282 2738887377 2738541308 Bacteria 7020677
283 2739236003 2738543011 Bacteria 5731169
284 2784589188 2784132148 Bacteria 8627943
285 2786673358 2786546132 Bacteria 10419719
286 2819699936 2818991463 Bacteria 7948711
287 2819744225 2818991472 Bacteria 10089953
288 2844843900 2844841374 Bacteria 3917147
289 2844852244 2844849076 Bacteria 4091819
290 2856862324 2856858025 Bacteria 7255264
291 2857743739 2857740372 Bacteria 4782044
292 2862508252 2862507626 Bacteria 9425308
293 2862580566 2862574272 Bacteria 10567477
294 2863411110 2863404153 Bacteria 9672205
295 2867431019 2867428634 Bacteria 9590268
296 2884767252 2884763398 Bacteria 4091164
297 2889304372 2889300758 Bacteria 5690814
298 2904499641 2904497146 Bacteria 4731781
299 2904538473 2904535858 Bacteria 6308016
300 2904780297 2904776348 Bacteria 4658726
301 2910811688 2910809715 Bacteria 4982797
302 2919036091 2919034639 Bacteria 4763403
303 2919060808 2919059106 Bacteria 4991624
304 2919538695 2919538618 Bacteria 4677069
305 2922559204 2922554459 Bacteria 6683962
306 2928154094 2928153084 Bacteria 4020257
307 2932431039 2932426870 Bacteria 4547726
308 2933419121 2933418574 Bacteria 4476724
309 2935393045 2935390628 Bacteria 7043367
310 2939647932 2939647034 Bacteria 4681660
311 2939678485 2939674588 Bacteria 4844420
312 2939745269 2939743619 Bacteria 5762299
313 2945943801 2945941187 Bacteria 4682474
314 2946079766 2946072368 Bacteria 8999607
315 2954383320 2954380949 Bacteria 10050426
316 2954679660 2954673503 Bacteria 9685905
317 2954684495 2954682443 Bacteria 9862841
318 2954694025 2954691527 Bacteria 10720516
319 2954709130 2954701450 Bacteria 10834262
320 2954713636 2954711539 Bacteria 10867210
321 2954723602 2954721474 Bacteria 10456478
322 2954738231 2954731030 Bacteria 10243860
323 2954742505 2954740390 Bacteria 10229294
324 2954757092 2954749733 Bacteria 10366972
325 2954761469 2954759201 Bacteria 9358192
326 2997602096 2997600082 Bacteria 9896405
327 3006495008 3006493962 Bacteria 8825450
328 649815883 649633069 Bacteria 6962533
329 8008575644 8008574985 Bacteria 7815457
330 8046353545 8046352972 Bacteria 3613806
331 8047895517 8047893842 Bacteria 11723082
332 8048128455 8048127548 Bacteria 11053136
333 8048363437 8048356638 Bacteria 11044339
334 8048372542 8048369669 Bacteria 11666822
335 8048381476 8048379754 Bacteria 11877923
336 JGI24740J21852_10045371
337 JGI24739J22299_10037178
338 JGI24739J22299_10059099
339 JGI24735J21928_10010302
340 JGI25164J39214_1001371
341 JGI25165J46597_1000005
342 Ga0006562J51391_1099579
343 Ga0006562J51391_1099580
344 Ga0065714_10080688
345 Ga0070675_100046770
346 Ga0070675_100343600
347 Ga0070674_100049682
348 Ga0070667_100120518
349 Ga0070663_100044229
350 Ga0070662_100490151
351 Ga0070672_100024157
352 Ga0075363_100012632
353 Ga0075370_10032662
354 Ga0075370_10046586
355 Ga0099826_10116111
356 Ga0105251_10124784
357 Ga0105244_10004039
358 Ga0105244_10047598
359 Ga0105245_10070293
360 Ga0105243_10001014
361 Ga0105248_10127188
362 Ga0105246_10006151
363 Ga0105246_10075653
364 Ga0105246_10202884
365 Ga0105246_10326843
366 Ga0157371_10107684
367 Ga0157369_10105336
368 Ga0157369_10298614
369 Ga0163162_10535069
370 Ga0157372_10432316
371 Ga0207427_100024
372 Ga0209437_100337
373 Ga0209233_1000001
374 Ga0209051_1054436
375 Ga0209051_1065052
376 Ga0207697_10008046
377 Ga0207697_10024714
378 Ga0207655_1036208
379 Ga0207655_1060280
380 Ga0207647_10182603
381 Ga0207645_10012935
382 Ga0207681_10040590
383 Ga0207650_10210484
384 Ga0207687_10083130
385 Ga0207706_10054198
386 Ga0207709_10001803
387 Ga0207669_10075487
388 Ga0207691_10004181
389 Ga0207658_10097342
390 Ga0207683_10002349
391 Ga0307515_10204415
392 Ga0307512_10068451
393 Ga0265340_10020430
394 Ga0307513_10341998
395 Ga0307408_100019652
396 Ga0307508_10130356
397 Ga0307514_10048390
398 Ga0307514_10179237
399 Ga0307405_10053627
400 Ga0307518_10014721
401 Ga0307412_10267033
402 Ga0307416_100051571
403 Ga0307415_100025474
404 Ga0395899_0039610
405 Ga0395900_0013120
406 Ga0395900_0031354
407 Ga0395905_0118184
408 Ga0395901_0047597
409 Ga0395901_0050562
410 Ga0439436_0051356
411 Ga0439438_023258
412 Ga0439438_026939
413 Ga0439439_0043804
414 Ga0439466_0001982
415 Ga0439466_0007329
416 Ga0451791_0954000
417 Ga0451853_0522993
418 Ga0451853_3331785
419 Ga0451853_3912389
420 Ga0439431_0040022
421 Ga0439433_0001247
422 Ga0439433_0001916
423 Ga0439442_000305
424 Ga0439442_001525
425 Ga0439442_009009
426 Ga0439442_019952
427 Ga0439432_002792
428 Ga0439449_0000825
429 Ga0439449_0028339
430 Ga0439452_021094
431 Ga0439455_0023573
432 Ga0439462_0067185
433 Ga0450919_004752
434 Ga0450923_027502
435 Ga0450898_008428
436 Ga0450900_008137
437 Ga0450903_000185
438 Ga0450907_016877
439 Ga0439458_0000421
440 Ga0450908_000474
441 Ga0450909_001967
442 Ga0439434_0025642
443 Ga0466969_0035968
444 Ga0466972_0001634
445 Ga0466965_0002419
446 Ga0466965_0036659
447 Ga0466966_0013187
448 Ga0466961_0002255
449 Ga0466961_0077788
450 Ga0466963_0006051
451 Ga0466964_0003471
452 Ga0466970_0009424
453 Ga0466957_0003068
454 Ga0466957_0048116
455 Ga0466960_0053381
456 Ga0466959_0002168
457 Ga0466958_0007080
458 Ga0466967_0001960
459 Ga0466967_0136970
460 Ga0495603_0007964
461 Ga0495603_0014183
462 Ga0495603_0025024
463 Ga0495629_0000574
464 Ga0495653_0004126
465 Ga0495580_0004189
466 Ga0495580_0017699
467 Ga0495582_0006999
468 Ga0495639_0001548
469 Ga0495662_0010982
470 Ga0495662_0015602
471 Ga0495664_0016364
472 Ga0495585_0067129
473 Ga0495594_0009729
474 Ga0495594_0012865
475 Ga0495594_0046256
476 Ga0495594_0175239
477 Ga0495606_0002570
478 Ga0495631_0266027
479 Ga0495663_0068387
480 Ga0495642_0004830
481 Ga0495642_0023023
482 Ga0495665_0002576
483 Ga0495665_0009676
484 Ga0495586_0001722
485 Ga0495586_0005938
486 Ga0495586_0062532
487 Ga0495586_0102052
488 Ga0495587_0006004
489 Ga0495609_0115111
490 Ga0495645_0020246
491 Ga0495645_0139627
492 Ga0495633_0063875
493 Ga0495667_0132961
494 Ga0495656_0009699
495 Ga0495656_0017685
496 Ga0495656_0022608
497 Ga0495668_0000627
498 Ga0495668_0015070
499 Ga0495668_0060424
500 Ga0495668_0068493
501 Ga0495625_0000161
502 Ga0495635_0351075
503 Ga0495588_0008257
504 Ga0495588_0008681
505 Ga0495588_0018827
506 Ga0495588_0040622
507 Ga0495657_0007714
508 Ga0495657_0015836
509 Ga0495623_0011111
510 Ga0495613_0000486
511 Ga0495613_0018726
512 Ga0495613_0438896
513 Ga0495670_0005585
514 Ga0495670_0025529
515 Ga0495670_0126671
516 Ga0495589_0177279
517 Ga0495600_0000445
518 Ga0495581_0001412
519 Ga0495581_0003897
520 Ga0495581_0265712
521 Ga0495636_0008512
522 Ga0495636_0054981
523 Ga0495676_0001903
524 Ga0495676_0012167
525 Ga0495676_0303895
526 Ga0495676_0398833
527 Ga0495680_0013588
528 Ga0495680_0242972
529 Ga0495683_0051583
530 Ga0495675_0009083
531 Ga0495677_0031896
532 Ga0495677_0076851
533 Ga0495685_016273
534 Ga0495685_017920
535 Ga0495685_041344
536 Ga0495681_0041228
537 Ga0495681_0108373
538 Ga0495593_0049485
539 Ga0495593_0118097
540 Ga0495614_0000254
541 Ga0495615_0010437
542 Ga0495626_0000051
543 Ga0496100_0046779
544 Ga0496100_0185082
545 Ga0496101_0027393
546 Ga0496101_0236923
547 Ga0496102_0088316
548 Ga0496102_0159920
549 Ga0496102_0237482
550 Ga0496102_0374177
551 Ga0496103_0035736
552 Ga0496103_0055142
553 Ga0496103_0255139
554 Ga0496104_0462899
555 Ga0496105_0257399
556 Ga0496106_0079500
557 Ga0496106_0677894
558 Ga0496107_0036954
559 Ga0496107_0061033
560 Ga0496107_0501315
561 Ga0496109_0007197
562 Ga0496109_0062861
563 Ga0496109_0105479
564 Ga0496110_0157088
565 Ga0496110_0208922
566 Ga0496111_0048247
567 Ga0496112_0021441
568 Ga0496114_0029868
569 Ga0496114_0270727
570 Ga0496114_0306514
571 Ga0496115_0181489
572 Ga0496117_0021993
573 Ga0496119_0088463
574 Ga0496125_0039304
575 Ga0496125_0211557
576 Ga0501031_0032342
577 Ga0501032_0000360
578 Ga0501032_0045964
579 Ga0501033_0028365
580 Ga0501034_0000015
581 Ga0501034_0025866
582 Ga0501036_0032771
583 Ga0501037_0006559
584 Ga0501037_0057812
585 Ga0501038_0016680
586 Ga0501039_0029591
587 Ga0501042_0088562
588 Ga0501043_0002592
589 Ga0501043_0016343
590 Ga0501046_0032759
591 Ga0501047_0008481
592 Ga0501047_0026165
593 Ga0501070_0030144
594 Ga0501072_0341023
595 Ga0501035_0019341
596 Ga0501035_0037129
597 Ga0501044_0014177
598 Ga0501045_0026975
599 Ga0501045_0201762
600 nmdc:mga03n38_156367_c1
601 nmdc:mga03n38_9254_c1
602 nmdc:mga03n38_95978_c1
603 nmdc:mga0sz30_137228_c1
604 Ga0500559_0001148
605 Ga0501084_0282769
606 Ga0501084_0876411
607 Ga0466962_0001226
608 2793984143
609 2501940480
610 2547409946
611 2566992120
612 2585300506
613 2585307286
614 2644264822
615 2644386221
616 2644627238
617 2738887377
618 2739236003
619 2784589188
620 2786673358
621 2819699936
622 2819744225
623 2844843900
624 2844852244
625 2856862324
626 2857743739
627 2862508252
628 2862580566
629 2863411110
630 2867431019
631 2884767252
632 2889304372
633 2904499641
634 2904538473
635 2904780297
636 2910811688
637 2919036091
638 2919060808
639 2919538695
640 2922559204
641 2928154094
642 2932431039
643 2933419121
644 2935393045
645 2939647932
646 2939678485
647 2939745269
648 2945943801
649 2946079766
650 2954383320
651 2954679660
652 2954684495
653 2954694025
654 2954709130
655 2954713636
656 2954723602
657 2954738231
658 2954742505
659 2954757092
660 2954761469
661 2997602096
662 3006495008
663 649815883
664 8008575644
665 8046353545
666 8047895517
667 8048128455
668 8048363437
669 8048372542
670 8048381476

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

6

115

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

161

236

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9778 16 132
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.975 16 133
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9745 16 133
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9678 16 133
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9669 16 133
ID Description Score Start End Superfamily
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9913 16 94 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9815 17 94 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9768 16 94 3.40.50.2300
af_Q2G2U6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9731 16 98 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9682 16 94 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A6I5GLZ3-F1-model_v4 DNA-binding response regulator 0.9928 150 238 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7Y6AE98-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9869 156 237 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A842I5X9-F1-model_v4 Sigma-54-dependent Fis family transcriptional regulator 0.9734 15 133 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A353GGM4-F1-model_v4 Sigma-54-dependent Fis family transcriptional regulator 0.9667 15 133 GO:0000160
GO:0005524
GO:0006355
AF-A0A523E445-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9667 16 133 GO:0000155

Map