F412502

General Info

Members Datasets Scaffolds Average Seq Length
336 209 672 132

Family's Representative Sequence

Representative Sequence 3300002067|JGI24735J21928_10010955|JGI24735J21928_100109553
Length 142
Sequence MSIFGAMNTSGTGMSTMRSWLDVLANNIANVNTVRPTSQNAFQASYVEVSEIKGDSSAAPGDAAGHGVEITTLRQGSAEGRLTYQPDNPLADKKGYVRLPDVDLGEQMGNLIMAQRGFQANAAVIDRARTVYEAAINIGKNH

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
75 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
76 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
77 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
107 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
108 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
111 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
112 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
113 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
114 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
115 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
116 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
117 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
138 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
183 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
184 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
187 2643221553 Microbacterium sp. Root553 Isolate Unclassified
188 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
189 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
190 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
191 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
192 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
193 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
194 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
195 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
196 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
197 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
198 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
199 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
200 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
201 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
202 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
203 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
204 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
205 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
206 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
207 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
208 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
209 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 91.07
Metatranscriptomes 2.08
Isolates 6.85

Biome Distribution

Category Percentage (%)
Aerial Root 0.6
Bulb 0
Endosphere 2.08
Nodule 0
Rhizoplane 9.52
Rhizosphere 74.7
Stem 0
Stem Tuber 0
Unclassified 3.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10010955 3300002067 Bacteria 2881
2 JGI25406J46586_10001287 3300003203 Bacteria 11799
3 rootH2_10187235 3300003320 Bacteria 4914
4 Ga0070658_10000157 3300005327 Bacteria 60238
5 Ga0070658_10005852 3300005327 Bacteria 9970
6 Ga0070658_10099740 3300005327 Bacteria 2400
7 Ga0070658_10318537 3300005327 Bacteria 1328
8 Ga0070658_10511259 3300005327 Bacteria 1038
9 Ga0070658_10828287 3300005327 Unclassified 804
10 Ga0070658_10965774 3300005327 Bacteria 741
11 Ga0070683_100018404 3300005329 Bacteria 6187
12 Ga0070683_100657940 3300005329 Bacteria 1003
13 Ga0070680_100000038 3300005336 Bacteria 66468
14 Ga0070680_100181911 3300005336 Bacteria 1770
15 Ga0070680_100698287 3300005336 Bacteria 873
16 Ga0070682_100061465 3300005337 Bacteria 2377
17 Ga0070682_100436139 3300005337 Bacteria 1000
18 Ga0068868_100438469 3300005338 Bacteria 1134
19 Ga0070659_100646178 3300005366 Bacteria 912
20 Ga0070667_100455687 3300005367 Bacteria 1169
21 Ga0070714_100000116 3300005435 Bacteria 64800
22 Ga0070714_100002504 3300005435 Bacteria 13550
23 Ga0070714_100441702 3300005435 Bacteria 1235
24 Ga0070711_100759469 3300005439 Bacteria 820
25 Ga0070663_100302412 3300005455 Bacteria 1281
26 Ga0070663_101562338 3300005455 Bacteria 588
27 Ga0070662_100665005 3300005457 Bacteria 879
28 Ga0070681_10000106 3300005458 Bacteria 62398
29 Ga0070681_10304195 3300005458 Bacteria 1504
30 Ga0070681_11749666 3300005458 Bacteria 548
31 Ga0070685_10201729 3300005466 Bacteria 1293
32 Ga0070679_100000026 3300005530 Bacteria 115669
33 Ga0070679_100147226 3300005530 Bacteria 2332
34 Ga0070679_100651790 3300005530 Bacteria 996
35 Ga0070684_100201079 3300005535 Bacteria 1815
36 Ga0070684_100424702 3300005535 Bacteria 1227
37 Ga0068855_100092706 3300005563 Bacteria 3483
38 Ga0068855_101399768 3300005563 Bacteria 721
39 Ga0068855_101932388 3300005563 Bacteria 597
40 Ga0070664_101421256 3300005564 Bacteria 656
41 Ga0068857_102528355 3300005577 Bacteria 504
42 Ga0068854_100124726 3300005578 Bacteria 1960
43 Ga0068856_100041209 3300005614 Bacteria 4537
44 Ga0068856_100229956 3300005614 Bacteria 1870
45 Ga0068856_100681977 3300005614 Bacteria 1048
46 Ga0068852_100348227 3300005616 Bacteria 1446
47 Ga0068852_100474110 3300005616 Bacteria 1243
48 Ga0068852_100947171 3300005616 Bacteria 879
49 Ga0068859_100030443 3300005617 Bacteria 5416
50 Ga0068864_100426957 3300005618 Bacteria 1264
51 Ga0068863_100067348 3300005841 Bacteria 3387
52 Ga0081540_1007049 3300005983 Bacteria 8081
53 Ga0081539_10048172 3300005985 Bacteria 2427
54 Ga0081539_10104127 3300005985 Bacteria 1441
55 Ga0070717_10324099 3300006028 Bacteria 1373
56 Ga0075365_10277438 3300006038 Bacteria 1179
57 Ga0075367_10074499 3300006178 Bacteria 2047
58 Ga0075428_102321746 3300006844 Unclassified 552
59 Ga0097620_100030443 3300006931 Bacteria 5416
60 Ga0105240_10695434 3300009093 Bacteria 1110
61 Ga0111539_11481957 3300009094 Bacteria 787
62 Ga0105247_10003370 3300009101 Bacteria 10454
63 Ga0114129_10716548 3300009147 Bacteria 1284
64 Ga0105242_11544703 3300009176 Bacteria 696
65 Ga0105237_10020837 3300009545 Bacteria 6751
66 Ga0105237_10583496 3300009545 Bacteria 1125
67 Ga0105238_10121863 3300009551 Bacteria 2587
68 Ga0105238_10126091 3300009551 Bacteria 2538
69 Ga0105238_11111412 3300009551 Bacteria 813
70 Ga0105239_10028455 3300010375 Bacteria 6147
71 Ga0105239_13131649 3300010375 Bacteria 539
72 Ga0157371_10001726 3300013102 Bacteria 22181
73 Ga0157371_10133178 3300013102 Bacteria 1769
74 Ga0157371_10152439 3300013102 Bacteria 1649
75 Ga0157370_10863627 3300013104 Bacteria 822
76 Ga0157369_10265286 3300013105 Bacteria 1790
77 Ga0157369_10357388 3300013105 Bacteria 1517
78 Ga0157369_10836809 3300013105 Bacteria 945
79 Ga0163162_12502191 3300013306 Unclassified 594
80 Ga0157372_10000023 3300013307 Bacteria 198536
81 Ga0157372_10098689 3300013307 Bacteria 3332
82 Ga0157372_11603066 3300013307 Bacteria 749
83 Ga0163163_10897654 3300014325 Bacteria 950
84 Ga0182008_10340943 3300014497 Bacteria 793
85 Ga0182008_10737637 3300014497 Bacteria 566
86 Ga0157377_11133310 3300014745 Bacteria 601
87 Ga0206354_10353655 3300020081 Bacteria 1043
88 Ga0206354_10914441 3300020081 Bacteria 649
89 Ga0206353_10445773 3300020082 Bacteria 2297
90 Ga0206353_11266225 3300020082 Bacteria 3277
91 Ga0206353_11289145 3300020082 Bacteria 938
92 Ga0206353_11538786 3300020082 Bacteria 2510
93 Ga0206353_11790157 3300020082 Bacteria 570
94 Ga0207656_10304171 3300025321 Bacteria 790
95 Ga0207710_10012016 3300025900 Bacteria 3640
96 Ga0207647_10044329 3300025904 Bacteria 2780
97 Ga0207705_10002261 3300025909 Bacteria 14896
98 Ga0207705_10033205 3300025909 Bacteria 3687
99 Ga0207705_10195142 3300025909 Bacteria 1532
100 Ga0207707_10000071 3300025912 Bacteria 102604
101 Ga0207707_10271851 3300025912 Bacteria 1469
102 Ga0207695_10433163 3300025913 Bacteria 1198
103 Ga0207671_10015276 3300025914 Bacteria 6025
104 Ga0207660_10000774 3300025917 Bacteria 21256
105 Ga0207660_10208009 3300025917 Bacteria 1531
106 Ga0207652_10005984 3300025921 Bacteria 9844
107 Ga0207652_10517397 3300025921 Bacteria 1074
108 Ga0207694_10119551 3300025924 Bacteria 2103
109 Ga0207694_10857208 3300025924 Bacteria 768
110 Ga0207694_10980411 3300025924 Bacteria 715
111 Ga0207687_10351394 3300025927 Bacteria 1201
112 Ga0207664_10000002 3300025929 Bacteria 657053
113 Ga0207664_10005336 3300025929 Bacteria 8780
114 Ga0207664_10791287 3300025929 Bacteria 853
115 Ga0207661_10056355 3300025944 Bacteria 3155
116 Ga0207667_10073802 3300025949 Bacteria 3545
117 Ga0207640_10167100 3300025981 Bacteria 1635
118 Ga0207658_10018711 3300025986 Bacteria 4788
119 Ga0207677_11809698 3300026023 Bacteria 567
120 Ga0207678_10227820 3300026067 Bacteria 1596
121 Ga0207678_11236208 3300026067 Bacteria 661
122 Ga0207702_10620170 3300026078 Bacteria 1062
123 Ga0207641_10071311 3300026088 Bacteria 2988
124 Ga0207698_10191232 3300026142 Bacteria 1823
125 Ga0265326_10198280 3300028558 Bacteria 576
126 Ga0265319_1025457 3300028563 Bacteria 2117
127 Ga0265334_10009096 3300028573 Bacteria 4211
128 Ga0265334_10079102 3300028573 Bacteria 1213
129 Ga0307515_10405238 3300028794 Bacteria 988
130 Ga0265338_10003370 3300028800 Bacteria 22562
131 Ga0265320_10113960 3300031240 Bacteria 1237
132 Ga0265325_10025920 3300031241 Bacteria 3180
133 Ga0265340_10001266 3300031247 Bacteria 14505
134 Ga0265339_10004122 3300031249 Bacteria 10017
135 Ga0265339_10278887 3300031249 Bacteria 802
136 Ga0265331_10461918 3300031250 Bacteria 571
137 Ga0265331_10474103 3300031250 Unclassified 563
138 Ga0265327_10252790 3300031251 Bacteria 784
139 Ga0265316_10105219 3300031344 Bacteria 2141
140 Ga0307513_10005977 3300031456 Bacteria 15977
141 Ga0265313_10000368 3300031595 Bacteria 48821
142 Ga0265314_10087920 3300031711 Bacteria 2030
143 Ga0265314_10274085 3300031711 Unclassified 957
144 Ga0307405_10641673 3300031731 Bacteria 872
145 Ga0307413_10600229 3300031824 Bacteria 901
146 Ga0307410_10427934 3300031852 Bacteria 1075
147 Ga0307406_10000027 3300031901 Bacteria 91856
148 Ga0307406_10117147 3300031901 Bacteria 1845
149 Ga0307407_10366827 3300031903 Bacteria 1024
150 Ga0307409_100936192 3300031995 Bacteria 882
151 Ga0307409_101512835 3300031995 Bacteria 699
152 Ga0307409_101643912 3300031995 Bacteria 671
153 Ga0307414_10164831 3300032004 Bacteria 1765
154 Ga0307411_10162283 3300032005 Bacteria 1676
155 Ga0307415_100179948 3300032126 Bacteria 1658
156 Ga0373927_0348187 3300035695 Bacteria 976
157 Ga0373937_0746865 3300036401 Unclassified 926
158 Ga0316584_0362307 3300036712 Bacteria 1039
159 Ga0373925_0751505 3300037068 Bacteria 804
160 Ga0395900_0515012 3300037418 Bacteria 1145
161 Ga0395900_0628642 3300037418 Bacteria 1012
162 Ga0395898_0306256 3300037466 Bacteria 1515
163 Ga0395905_0051901 3300037471 Bacteria 3841
164 Ga0395901_0052141 3300038443 Bacteria 4252
165 Ga0395901_0108704 3300038443 Bacteria 2911
166 Ga0395901_0286834 3300038443 Bacteria 1709
167 Ga0400485_01612 3300038735 Bacteria 30354
168 Ga0400488_52972 3300038741 Bacteria 7479
169 Ga0400486_23270 3300038742 Bacteria 10183
170 Ga0436363_0554910 3300039450 Bacteria 515
171 Ga0436363_1247137 3300039450 Bacteria 2267
172 Ga0436363_1596252 3300039450 Bacteria 609
173 Ga0451793_0711570 3300041452 Unclassified 616
174 Ga0451793_1564418 3300041452 Bacteria 736
175 Ga0451797_1454330 3300041453 Bacteria 926
176 Ga0451795_0096960 3300041456 Bacteria 1581
177 Ga0451807_1156497 3300041486 Bacteria 738
178 Ga0451833_0340883 3300041491 Bacteria 844
179 Ga0451851_0712998 3300041507 Bacteria 830
180 Ga0451843_1102626 3300041509 Bacteria 1962
181 Ga0451843_1284714 3300041509 Bacteria 695
182 Ga0451855_0740312 3300041511 Bacteria 893
183 Ga0466972_0116042 3300044658 Bacteria 1264
184 Ga0466972_0292035 3300044658 Bacteria 762
185 Ga0466965_0100834 3300044683 Bacteria 1476
186 Ga0466965_0166302 3300044683 Bacteria 1158
187 Ga0466966_0238552 3300044684 Bacteria 1096
188 Ga0466966_0528938 3300044684 Bacteria 709
189 Ga0466966_0800845 3300044684 Bacteria 568
190 Ga0466961_0154739 3300044693 Bacteria 1430
191 Ga0466961_0312415 3300044693 Bacteria 959
192 Ga0466961_0452329 3300044693 Bacteria 777
193 Ga0466961_0828775 3300044693 Bacteria 552
194 Ga0466963_0098688 3300044694 Bacteria 1997
195 Ga0466963_0304636 3300044694 Bacteria 1121
196 Ga0466963_0415447 3300044694 Unclassified 949
197 Ga0466963_1127066 3300044694 Bacteria 552
198 Ga0466964_0205171 3300044706 Bacteria 949
199 Ga0466971_0038330 3300044719 Bacteria 2151
200 Ga0466971_0214181 3300044719 Bacteria 912
201 Ga0466971_0283386 3300044719 Bacteria 793
202 Ga0466968_0292113 3300044735 Bacteria 782
203 Ga0466970_0030162 3300044765 Bacteria 2859
204 Ga0466970_0054757 3300044765 Bacteria 2130
205 Ga0466970_0093396 3300044765 Bacteria 1634
206 Ga0466970_0163577 3300044765 Bacteria 1231
207 Ga0466970_0174058 3300044765 Bacteria 1193
208 Ga0466970_0204316 3300044765 Bacteria 1099
209 Ga0466970_0304912 3300044765 Bacteria 899
210 Ga0466970_0611364 3300044765 Bacteria 633
211 Ga0466957_0133419 3300044842 Bacteria 1594
212 Ga0466957_0598828 3300044842 Bacteria 771
213 Ga0466957_1324874 3300044842 Bacteria 523
214 Ga0466960_0072829 3300044901 Bacteria 1713
215 Ga0466960_0285753 3300044901 Bacteria 926
216 Ga0466959_0085232 3300045049 Bacteria 2274
217 Ga0466959_0872850 3300045049 Bacteria 600
218 Ga0466958_0151510 3300045836 Bacteria 1463
219 Ga0466958_0197847 3300045836 Bacteria 1279
220 Ga0466958_0210792 3300045836 Bacteria 1238
221 Ga0466958_0358629 3300045836 Bacteria 939
222 Ga0466958_0475786 3300045836 Bacteria 810
223 Ga0466967_0505587 3300045976 Bacteria 1186
224 Ga0466967_0676376 3300045976 Bacteria 1022
225 Ga0466967_1541111 3300045976 Bacteria 662
226 Ga0466967_1927117 3300045976 Bacteria 588
227 Ga0495650_0259311 3300046471 Bacteria 589
228 Ga0495608_0820745 3300046511 Bacteria 548
229 Ga0495620_0143030 3300046515 Bacteria 935
230 Ga0495630_0561881 3300046517 Bacteria 875
231 Ga0495652_0637574 3300046529 Unclassified 723
232 Ga0495609_0064414 3300046538 Bacteria 1617
233 Ga0495597_0121372 3300046542 Bacteria 1089
234 Ga0495645_0535328 3300046543 Unclassified 728
235 Ga0495593_0370337 3300047673 Unclassified 716
236 Ga0496100_0719968 3300048903 Bacteria 779
237 Ga0496100_1051128 3300048903 Bacteria 641
238 Ga0496101_0199953 3300048904 Bacteria 1545
239 Ga0496102_0000029 3300048905 Bacteria 222195
240 Ga0496102_0403772 3300048905 Bacteria 1284
241 Ga0496104_0260200 3300048907 Bacteria 1648
242 Ga0496104_0636422 3300048907 Bacteria 976
243 Ga0496105_0123399 3300048908 Bacteria 2135
244 Ga0496105_0204057 3300048908 Bacteria 1613
245 Ga0496108_0017784 3300048911 Bacteria 5813
246 Ga0496108_0218413 3300048911 Bacteria 1656
247 Ga0496109_0003689 3300048912 Bacteria 12801
248 Ga0496109_0041851 3300048912 Bacteria 4150
249 Ga0496109_0681892 3300048912 Bacteria 965
250 Ga0496109_1253963 3300048912 Bacteria 678
251 Ga0496110_0007230 3300048913 Bacteria 8847
252 Ga0496110_0470510 3300048913 Bacteria 1145
253 Ga0496111_0352103 3300048914 Bacteria 1090
254 Ga0496111_0442131 3300048914 Bacteria 960
255 Ga0496112_0001388 3300048915 Bacteria 18480
256 Ga0496112_0137710 3300048915 Bacteria 2411
257 Ga0496112_0833680 3300048915 Bacteria 846
258 Ga0496112_1658003 3300048915 Bacteria 552
259 Ga0496113_0168451 3300048916 Bacteria 1734
260 Ga0496113_1374968 3300048916 Bacteria 547
261 Ga0496115_0093517 3300048918 Bacteria 2458
262 Ga0496115_0383416 3300048918 Bacteria 1143
263 Ga0496117_0004584 3300048920 Bacteria 15115
264 Ga0496117_0171105 3300048920 Bacteria 1261
265 Ga0496118_0000270 3300048921 Bacteria 91081
266 Ga0496118_0012908 3300048921 Bacteria 7955
267 Ga0496118_0058736 3300048921 Bacteria 2871
268 Ga0496119_0130771 3300048922 Bacteria 1368
269 Ga0496119_0152561 3300048922 Bacteria 1236
270 Ga0496119_0180042 3300048922 Bacteria 1109
271 Ga0496120_0041793 3300048923 Bacteria 2682
272 Ga0496121_0099163 3300048924 Bacteria 2252
273 Ga0496122_0001848 3300048925 Bacteria 32283
274 Ga0496122_0141485 3300048925 Bacteria 1504
275 Ga0496123_0000112 3300048926 Bacteria 163990
276 Ga0496123_0183586 3300048926 Bacteria 1089
277 Ga0496124_0002132 3300048927 Bacteria 26592
278 Ga0496124_0044855 3300048927 Bacteria 3792
279 Ga0496124_0110503 3300048927 Bacteria 2213
280 Ga0496126_0000013 3300048929 Bacteria 690046
281 Ga0496126_0392892 3300048929 Bacteria 1127
282 Ga0501031_0035269 3300049568 Bacteria 3263
283 Ga0501032_0047634 3300049569 Bacteria 2894
284 Ga0501033_0065700 3300049570 Bacteria 2669
285 Ga0501033_0081372 3300049570 Bacteria 2375
286 Ga0501034_0060646 3300049571 Bacteria 3800
287 Ga0501036_0311393 3300049572 Bacteria 1316
288 Ga0501037_0207856 3300049573 Bacteria 1381
289 Ga0501038_0005774 3300049574 Bacteria 11462
290 Ga0501039_0301262 3300049575 Bacteria 1260
291 Ga0501043_0168231 3300049579 Bacteria 1711
292 Ga0501047_0001104 3300049581 Bacteria 26810
293 Ga0501048_0002743 3300049582 Bacteria 13429
294 Ga0501070_0012279 3300049586 Bacteria 7229
295 Ga0501073_0046242 3300049589 Bacteria 3062
296 Ga0501074_0352617 3300049590 Bacteria 1044
297 Ga0501080_1288402 3300049742 Unclassified 626
298 Ga0501035_0004467 3300049822 Bacteria 13276
299 Ga0501044_0104869 3300049823 Bacteria 2840
300 nmdc:mga06z11_26971_c1 3300050494 Bacteria 2741
301 nmdc:mga05p37_966312_c1 3300050507 Bacteria 909
302 Ga0495601_0677208 3300053077 Bacteria 659
303 Ga0500628_016731 3300053129 Bacteria 1422
304 Ga0500628_018623 3300053129 Bacteria 1372
305 Ga0500604_0077841 3300053151 Bacteria 1067
306 Ga0500616_0002092 3300053153 Bacteria 17409
307 Ga0501082_0522404 3300060353 Bacteria 1038
308 Ga0501082_0790385 3300060353 Bacteria 830
309 Ga0466962_0215761 3300061719 Bacteria 939
310 Ga0466962_0309157 3300061719 Bacteria 783
311 Ga0466962_0429949 3300061719 Bacteria 663
312 Ga0466962_0573216 3300061719 Bacteria 574
313 Ga0466962_0659440 3300061719 Bacteria 535
314 2643785909 2643221553 Bacteria 3544260
315 2643851658 2643221567 Bacteria 4163945
316 2644137751 2643221624 Bacteria 4384879
317 2644680314 2643221724 Bacteria 3593515
318 2730229766 2728369380 Bacteria 3620317
319 2734968418 2734482000 Bacteria 5525167
320 2747954663 2747842429 Bacteria 3914386
321 2753301906 2751185788 Bacteria 4541048
322 2808884194 2808606368 Bacteria 3174172
323 2857723078 2857720070 Bacteria 3189373
324 2857723958 2857723135 Bacteria 4217853
325 2904432971 2904430863 Bacteria 3486923
326 2904502905 2904501621 Bacteria 3401437
327 2908675919 2908674828 Bacteria 3382763
328 2909074978 2909074476 Bacteria 3436050
329 2919041146 2919039151 Bacteria 3391018
330 2919044532 2919042368 Bacteria 3905917
331 2919448348 2919446982 Bacteria 3994487
332 2928093616 2928090899 Bacteria 3158267
333 2928502241 2928500415 Bacteria 3384541
334 2966926465 2966924647 Bacteria 3268643
335 2984554053 2984551494 Bacteria 3877562
336 2984582690 2984580707 Bacteria 3351387
337 JGI24735J21928_10010955
338 JGI25406J46586_10001287
339 rootH2_10187235
340 Ga0070658_10000157
341 Ga0070658_10005852
342 Ga0070658_10099740
343 Ga0070658_10318537
344 Ga0070658_10511259
345 Ga0070658_10828287
346 Ga0070658_10965774
347 Ga0070683_100018404
348 Ga0070683_100657940
349 Ga0070680_100000038
350 Ga0070680_100181911
351 Ga0070680_100698287
352 Ga0070682_100061465
353 Ga0070682_100436139
354 Ga0068868_100438469
355 Ga0070659_100646178
356 Ga0070667_100455687
357 Ga0070714_100000116
358 Ga0070714_100002504
359 Ga0070714_100441702
360 Ga0070711_100759469
361 Ga0070663_100302412
362 Ga0070663_101562338
363 Ga0070662_100665005
364 Ga0070681_10000106
365 Ga0070681_10304195
366 Ga0070681_11749666
367 Ga0070685_10201729
368 Ga0070679_100000026
369 Ga0070679_100147226
370 Ga0070679_100651790
371 Ga0070684_100201079
372 Ga0070684_100424702
373 Ga0068855_100092706
374 Ga0068855_101399768
375 Ga0068855_101932388
376 Ga0070664_101421256
377 Ga0068857_102528355
378 Ga0068854_100124726
379 Ga0068856_100041209
380 Ga0068856_100229956
381 Ga0068856_100681977
382 Ga0068852_100348227
383 Ga0068852_100474110
384 Ga0068852_100947171
385 Ga0068859_100030443
386 Ga0068864_100426957
387 Ga0068863_100067348
388 Ga0081540_1007049
389 Ga0081539_10048172
390 Ga0081539_10104127
391 Ga0070717_10324099
392 Ga0075365_10277438
393 Ga0075367_10074499
394 Ga0075428_102321746
395 Ga0097620_100030443
396 Ga0105240_10695434
397 Ga0111539_11481957
398 Ga0105247_10003370
399 Ga0114129_10716548
400 Ga0105242_11544703
401 Ga0105237_10020837
402 Ga0105237_10583496
403 Ga0105238_10121863
404 Ga0105238_10126091
405 Ga0105238_11111412
406 Ga0105239_10028455
407 Ga0105239_13131649
408 Ga0157371_10001726
409 Ga0157371_10133178
410 Ga0157371_10152439
411 Ga0157370_10863627
412 Ga0157369_10265286
413 Ga0157369_10357388
414 Ga0157369_10836809
415 Ga0163162_12502191
416 Ga0157372_10000023
417 Ga0157372_10098689
418 Ga0157372_11603066
419 Ga0163163_10897654
420 Ga0182008_10340943
421 Ga0182008_10737637
422 Ga0157377_11133310
423 Ga0206354_10353655
424 Ga0206354_10914441
425 Ga0206353_10445773
426 Ga0206353_11266225
427 Ga0206353_11289145
428 Ga0206353_11538786
429 Ga0206353_11790157
430 Ga0207656_10304171
431 Ga0207710_10012016
432 Ga0207647_10044329
433 Ga0207705_10002261
434 Ga0207705_10033205
435 Ga0207705_10195142
436 Ga0207707_10000071
437 Ga0207707_10271851
438 Ga0207695_10433163
439 Ga0207671_10015276
440 Ga0207660_10000774
441 Ga0207660_10208009
442 Ga0207652_10005984
443 Ga0207652_10517397
444 Ga0207694_10119551
445 Ga0207694_10857208
446 Ga0207694_10980411
447 Ga0207687_10351394
448 Ga0207664_10000002
449 Ga0207664_10005336
450 Ga0207664_10791287
451 Ga0207661_10056355
452 Ga0207667_10073802
453 Ga0207640_10167100
454 Ga0207658_10018711
455 Ga0207677_11809698
456 Ga0207678_10227820
457 Ga0207678_11236208
458 Ga0207702_10620170
459 Ga0207641_10071311
460 Ga0207698_10191232
461 Ga0265326_10198280
462 Ga0265319_1025457
463 Ga0265334_10009096
464 Ga0265334_10079102
465 Ga0307515_10405238
466 Ga0265338_10003370
467 Ga0265320_10113960
468 Ga0265325_10025920
469 Ga0265340_10001266
470 Ga0265339_10004122
471 Ga0265339_10278887
472 Ga0265331_10461918
473 Ga0265331_10474103
474 Ga0265327_10252790
475 Ga0265316_10105219
476 Ga0307513_10005977
477 Ga0265313_10000368
478 Ga0265314_10087920
479 Ga0265314_10274085
480 Ga0307405_10641673
481 Ga0307413_10600229
482 Ga0307410_10427934
483 Ga0307406_10000027
484 Ga0307406_10117147
485 Ga0307407_10366827
486 Ga0307409_100936192
487 Ga0307409_101512835
488 Ga0307409_101643912
489 Ga0307414_10164831
490 Ga0307411_10162283
491 Ga0307415_100179948
492 Ga0373927_0348187
493 Ga0373937_0746865
494 Ga0316584_0362307
495 Ga0373925_0751505
496 Ga0395900_0515012
497 Ga0395900_0628642
498 Ga0395898_0306256
499 Ga0395905_0051901
500 Ga0395901_0052141
501 Ga0395901_0108704
502 Ga0395901_0286834
503 Ga0400485_01612
504 Ga0400488_52972
505 Ga0400486_23270
506 Ga0436363_0554910
507 Ga0436363_1247137
508 Ga0436363_1596252
509 Ga0451793_0711570
510 Ga0451793_1564418
511 Ga0451797_1454330
512 Ga0451795_0096960
513 Ga0451807_1156497
514 Ga0451833_0340883
515 Ga0451851_0712998
516 Ga0451843_1102626
517 Ga0451843_1284714
518 Ga0451855_0740312
519 Ga0466972_0116042
520 Ga0466972_0292035
521 Ga0466965_0100834
522 Ga0466965_0166302
523 Ga0466966_0238552
524 Ga0466966_0528938
525 Ga0466966_0800845
526 Ga0466961_0154739
527 Ga0466961_0312415
528 Ga0466961_0452329
529 Ga0466961_0828775
530 Ga0466963_0098688
531 Ga0466963_0304636
532 Ga0466963_0415447
533 Ga0466963_1127066
534 Ga0466964_0205171
535 Ga0466971_0038330
536 Ga0466971_0214181
537 Ga0466971_0283386
538 Ga0466968_0292113
539 Ga0466970_0030162
540 Ga0466970_0054757
541 Ga0466970_0093396
542 Ga0466970_0163577
543 Ga0466970_0174058
544 Ga0466970_0204316
545 Ga0466970_0304912
546 Ga0466970_0611364
547 Ga0466957_0133419
548 Ga0466957_0598828
549 Ga0466957_1324874
550 Ga0466960_0072829
551 Ga0466960_0285753
552 Ga0466959_0085232
553 Ga0466959_0872850
554 Ga0466958_0151510
555 Ga0466958_0197847
556 Ga0466958_0210792
557 Ga0466958_0358629
558 Ga0466958_0475786
559 Ga0466967_0505587
560 Ga0466967_0676376
561 Ga0466967_1541111
562 Ga0466967_1927117
563 Ga0495650_0259311
564 Ga0495608_0820745
565 Ga0495620_0143030
566 Ga0495630_0561881
567 Ga0495652_0637574
568 Ga0495609_0064414
569 Ga0495597_0121372
570 Ga0495645_0535328
571 Ga0495593_0370337
572 Ga0496100_0719968
573 Ga0496100_1051128
574 Ga0496101_0199953
575 Ga0496102_0000029
576 Ga0496102_0403772
577 Ga0496104_0260200
578 Ga0496104_0636422
579 Ga0496105_0123399
580 Ga0496105_0204057
581 Ga0496108_0017784
582 Ga0496108_0218413
583 Ga0496109_0003689
584 Ga0496109_0041851
585 Ga0496109_0681892
586 Ga0496109_1253963
587 Ga0496110_0007230
588 Ga0496110_0470510
589 Ga0496111_0352103
590 Ga0496111_0442131
591 Ga0496112_0001388
592 Ga0496112_0137710
593 Ga0496112_0833680
594 Ga0496112_1658003
595 Ga0496113_0168451
596 Ga0496113_1374968
597 Ga0496115_0093517
598 Ga0496115_0383416
599 Ga0496117_0004584
600 Ga0496117_0171105
601 Ga0496118_0000270
602 Ga0496118_0012908
603 Ga0496118_0058736
604 Ga0496119_0130771
605 Ga0496119_0152561
606 Ga0496119_0180042
607 Ga0496120_0041793
608 Ga0496121_0099163
609 Ga0496122_0001848
610 Ga0496122_0141485
611 Ga0496123_0000112
612 Ga0496123_0183586
613 Ga0496124_0002132
614 Ga0496124_0044855
615 Ga0496124_0110503
616 Ga0496126_0000013
617 Ga0496126_0392892
618 Ga0501031_0035269
619 Ga0501032_0047634
620 Ga0501033_0065700
621 Ga0501033_0081372
622 Ga0501034_0060646
623 Ga0501036_0311393
624 Ga0501037_0207856
625 Ga0501038_0005774
626 Ga0501039_0301262
627 Ga0501043_0168231
628 Ga0501047_0001104
629 Ga0501048_0002743
630 Ga0501070_0012279
631 Ga0501073_0046242
632 Ga0501074_0352617
633 Ga0501080_1288402
634 Ga0501035_0004467
635 Ga0501044_0104869
636 nmdc:mga06z11_26971_c1
637 nmdc:mga05p37_966312_c1
638 Ga0495601_0677208
639 Ga0500628_016731
640 Ga0500628_018623
641 Ga0500604_0077841
642 Ga0500616_0002092
643 Ga0501082_0522404
644 Ga0501082_0790385
645 Ga0466962_0215761
646 Ga0466962_0309157
647 Ga0466962_0429949
648 Ga0466962_0573216
649 Ga0466962_0659440
650 2643785909
651 2643851658
652 2644137751
653 2644680314
654 2730229766
655 2734968418
656 2747954663
657 2753301906
658 2808884194
659 2857723078
660 2857723958
661 2904432971
662 2904502905
663 2908675919
664 2909074978
665 2919041146
666 2919044532
667 2919448348
668 2928093616
669 2928502241
670 2966926465
671 2984554053
672 2984582690

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00460

Flg_bb_rod

Flagella basal body rod protein

7

37

0.95

PF06429

Flg_bbr_C

Flagellar basal body rod FlgEFG protein C-terminal

93

138

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cg0-assembly1.cif.gz_p cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.8214 2 138
7cg0-assembly1.cif.gz_i cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.8212 2 136
7cg0-assembly1.cif.gz_h cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.8135 2 136
7cg0-assembly1.cif.gz_p cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.81 2 138
7cg0-assembly1.cif.gz_g cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.8084 2 139
ID Description Score Start End Superfamily
af_A0A1D6HEZ3_130_415_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9757 101 131 1.20.1270.60
af_G5EDU9_166_462_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.831 3 137 2.60.40.150
5jdhA01 Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region 0.6905 104 138 6.10.280.80
5jdmA01 Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region 0.6866 101 138 6.10.280.80
5jdfA01 Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region 0.6865 104 138 6.10.280.80
ID Description Score Start End GO Terms
AF-A0A7W7WZ28-F1-model_v4 Flagellar basal-body rod protein FlgC 0.9762 4 142
AF-A0A7W7WZ28-F1-model_v4 Flagellar basal-body rod protein FlgC 0.9614 4 142
AF-A0A6J4JWE2-F1-model_v4 Flagellar basal-body rod protein FlgC 0.9569 4 140 GO:0030694
GO:0071978
AF-A0A7V1XNU3-F1-model_v4 Flagellar basal-body rod protein FlgC 0.9527 2 142 GO:0030694
GO:0071978
AF-A0A7K0JY81-F1-model_v4 deleted 0.9425 4 138

Map