F412600

General Info

Members Datasets Scaffolds Average Seq Length
336 189 673 159

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100824266|Ga0068860_1008242662
Length 165
Sequence MREKGMTVQFGYEKKQVIQALRYHFLMRPEIKILLILINVFAITSAVLYAMKKIHELPFLIFSLLWFMLMLVVWRILPGSIYRKNFTFQDHFTMHFEEENVVLETAKGAKGWPWKQFSHFVESPHFFHLYFDARSFFLVPKDSFKSITDLQDAREMLRVRIGKGK

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
124 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
125 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
126 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
127 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
128 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
129 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
130 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
131 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
132 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
133 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
134 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
137 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
138 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
139 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
164 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
165 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
166 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
170 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
174 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
175 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
176 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
177 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
178 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
179 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
180 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
181 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
182 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
183 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
184 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
185 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
186 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.25
Nodule 0
Rhizoplane 2.08
Rhizosphere 86.31
Stem 0
Stem Tuber 0
Unclassified 9.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100824266 3300005843 Unclassified 942
2 rootH1_10074192 3300003316 Bacteria 3855
3 rootH2_10164387 3300003320 Unclassified 1299
4 rootH1_10019743 3300003316 Bacteria 1229
5 rootH1_10019743 3300003323 Bacteria 3234
6 rootH1_10021532 3300003323 Bacteria 20565
7 rootH1_10216327 3300003323 Bacteria 1125
8 Ga0070658_10303830 3300005327 Bacteria 1361
9 Ga0070683_100368682 3300005329 Unclassified 1368
10 Ga0070683_100656514 3300005329 Bacteria 1004
11 Ga0070690_100382307 3300005330 Bacteria 1029
12 Ga0070670_100126408 3300005331 Bacteria 2207
13 Ga0070670_100128004 3300005331 Bacteria 2192
14 Ga0068869_100039983 3300005334 Bacteria 3351
15 Ga0070666_10000301 3300005335 Bacteria 31985
16 Ga0070680_100003518 3300005336 Bacteria 11694
17 Ga0070682_100002391 3300005337 Bacteria 10396
18 Ga0068868_100010528 3300005338 Bacteria 6701
19 Ga0068868_100149173 3300005338 Bacteria 1925
20 Ga0070660_100262942 3300005339 Bacteria 1409
21 Ga0070660_100318746 3300005339 Bacteria 1277
22 Ga0070691_10000660 3300005341 Bacteria 13368
23 Ga0070668_100110608 3300005347 Bacteria 2186
24 Ga0070675_100446326 3300005354 Bacteria 1160
25 Ga0070675_101270444 3300005354 Bacteria 678
26 Ga0070671_100044695 3300005355 Bacteria 3681
27 Ga0070671_100126124 3300005355 Bacteria 2155
28 Ga0070674_100155625 3300005356 Unclassified 1729
29 Ga0070673_100027225 3300005364 Bacteria 4236
30 Ga0070673_102070300 3300005364 Bacteria 540
31 Ga0070688_100021244 3300005365 Bacteria 3789
32 Ga0070659_100039673 3300005366 Bacteria 3677
33 Ga0070659_100152816 3300005366 Bacteria 1884
34 Ga0070667_100022974 3300005367 Bacteria 5171
35 Ga0070667_100044446 3300005367 Bacteria 3731
36 Ga0070708_101914043 3300005445 Bacteria 550
37 Ga0070678_100093218 3300005456 Unclassified 2316
38 Ga0068867_100015002 3300005459 Bacteria 5493
39 Ga0068867_101445000 3300005459 Bacteria 639
40 Ga0070685_10127494 3300005466 Bacteria 1587
41 Ga0070679_100019131 3300005530 Bacteria 6654
42 Ga0070679_100364955 3300005530 Bacteria 1391
43 Ga0068853_100082369 3300005539 Bacteria 2818
44 Ga0068853_100097142 3300005539 Bacteria 2600
45 Ga0068853_100101060 3300005539 Bacteria 2550
46 Ga0068853_100109193 3300005539 Bacteria 2455
47 Ga0068853_100274374 3300005539 Bacteria 1553
48 Ga0070672_100716461 3300005543 Bacteria 877
49 Ga0070693_100013320 3300005547 Bacteria 4187
50 Ga0068855_100016778 3300005563 Bacteria 8806
51 Ga0068855_100041810 3300005563 Bacteria 5431
52 Ga0068855_100114154 3300005563 Bacteria 3097
53 Ga0070664_100953481 3300005564 Bacteria 805
54 Ga0070664_101306855 3300005564 Unclassified 685
55 Ga0068857_100053584 3300005577 Bacteria 3579
56 Ga0068857_100163623 3300005577 Bacteria 2020
57 Ga0068857_100527871 3300005577 Bacteria 1110
58 Ga0068857_100841342 3300005577 Unclassified 878
59 Ga0068857_100913106 3300005577 Bacteria 842
60 Ga0068854_100126121 3300005578 Bacteria 1949
61 Ga0068856_100019637 3300005614 Bacteria 6559
62 Ga0068856_100066996 3300005614 Bacteria 3548
63 Ga0068852_100000721 3300005616 Bacteria 21702
64 Ga0068852_100085657 3300005616 Bacteria 2807
65 Ga0068852_100104132 3300005616 Bacteria 2568
66 Ga0068859_100000006 3300005617 Bacteria 421509
67 Ga0068859_100006790 3300005617 Bacteria 11629
68 Ga0068864_100020644 3300005618 Bacteria 5511
69 Ga0068864_100168252 3300005618 Bacteria 1997
70 Ga0068851_10030436 3300005834 Bacteria 2677
71 Ga0068851_10076977 3300005834 Bacteria 1736
72 Ga0068851_10124631 3300005834 Bacteria 1388
73 Ga0068870_10012815 3300005840 Bacteria 3925
74 Ga0068863_100028166 3300005841 Bacteria 5364
75 Ga0068863_100030637 3300005841 Bacteria 5136
76 Ga0068863_100092475 3300005841 Unclassified 2869
77 Ga0068860_100001345 3300005843 Bacteria 26726
78 Ga0068860_100002872 3300005843 Bacteria 17875
79 Ga0068860_100039221 3300005843 Bacteria 4530
80 Ga0068862_100314073 3300005844 Bacteria 1445
81 Ga0068862_100467327 3300005844 Bacteria 1192
82 Ga0075366_10071917 3300006195 Bacteria 2061
83 Ga0075366_10154102 3300006195 Bacteria 1392
84 Ga0075366_10154249 3300006195 Bacteria 1391
85 Ga0097621_100000869 3300006237 Bacteria 21243
86 Ga0097621_100023987 3300006237 Bacteria 4757
87 Ga0097621_100213628 3300006237 Bacteria 1679
88 Ga0097621_100592554 3300006237 Bacteria 1012
89 Ga0068871_100000042 3300006358 Bacteria 67951
90 Ga0068871_100231421 3300006358 Unclassified 1604
91 Ga0097620_100000006 3300006931 Bacteria 421509
92 Ga0097620_100006790 3300006931 Bacteria 11629
93 Ga0105240_10005515 3300009093 Bacteria 18851
94 Ga0105240_10150422 3300009093 Bacteria 2773
95 Ga0105240_10288918 3300009093 Bacteria 1881
96 Ga0105240_10923499 3300009093 Bacteria 938
97 Ga0105240_10932073 3300009093 Bacteria 932
98 Ga0105245_10059258 3300009098 Bacteria 3447
99 Ga0105245_11796794 3300009098 Bacteria 666
100 Ga0105247_10920135 3300009101 Bacteria 677
101 Ga0114129_10018174 3300009147 Bacteria 10010
102 Ga0105241_10002922 3300009174 Bacteria 12760
103 Ga0105241_10003877 3300009174 Bacteria 11089
104 Ga0105241_10015107 3300009174 Bacteria 5655
105 Ga0105241_10137916 3300009174 Bacteria 1983
106 Ga0105242_10009531 3300009176 Bacteria 7439
107 Ga0105248_10153321 3300009177 Bacteria 2599
108 Ga0105248_11390626 3300009177 Unclassified 794
109 Ga0105237_10031026 3300009545 Bacteria 5421
110 Ga0105237_10046731 3300009545 Bacteria 4354
111 Ga0105237_10047857 3300009545 Bacteria 4299
112 Ga0105238_10363710 3300009551 Bacteria 1436
113 Ga0105249_10049421 3300009553 Bacteria 3836
114 Ga0105239_10002212 3300010375 Bacteria 24980
115 Ga0105239_10065550 3300010375 Bacteria 3989
116 Ga0105239_10171405 3300010375 Bacteria 2427
117 Ga0105246_10063447 3300011119 Bacteria 2577
118 Ga0157373_10017427 3300013100 Bacteria 5231
119 Ga0157373_10259304 3300013100 Bacteria 1230
120 Ga0157371_10015698 3300013102 Bacteria 5670
121 Ga0157371_10085964 3300013102 Bacteria 2228
122 Ga0157371_10399507 3300013102 Bacteria 1005
123 Ga0157370_10011590 3300013104 Bacteria 9203
124 Ga0157370_10248072 3300013104 Bacteria 1647
125 Ga0157370_10447584 3300013104 Bacteria 1187
126 Ga0157370_10482432 3300013104 Unclassified 1139
127 Ga0157370_10831202 3300013104 Bacteria 840
128 Ga0157369_10021772 3300013105 Bacteria 7168
129 Ga0157369_10022350 3300013105 Bacteria 7059
130 Ga0157369_10421424 3300013105 Bacteria 1384
131 Ga0157374_10048709 3300013296 Bacteria 3933
132 Ga0157374_10177658 3300013296 Unclassified 2078
133 Ga0157374_10230340 3300013296 Bacteria 1820
134 Ga0157378_10020928 3300013297 Bacteria 5756
135 Ga0157378_10057508 3300013297 Bacteria 3466
136 Ga0157378_10104671 3300013297 Bacteria 2587
137 Ga0157378_10154436 3300013297 Bacteria 2141
138 Ga0157378_10592812 3300013297 Bacteria 1118
139 Ga0163162_10001206 3300013306 Bacteria 24134
140 Ga0163162_10033366 3300013306 Bacteria 5115
141 Ga0163162_10116430 3300013306 Bacteria 2773
142 Ga0163162_10291888 3300013306 Unclassified 1762
143 Ga0163162_10510945 3300013306 Bacteria 1331
144 Ga0157372_10028585 3300013307 Bacteria 6086
145 Ga0157372_10223201 3300013307 Bacteria 2184
146 Ga0157372_10252104 3300013307 Bacteria 2049
147 Ga0157372_10444696 3300013307 Bacteria 1511
148 Ga0157372_11550952 3300013307 Bacteria 763
149 Ga0157375_10000182 3300013308 Bacteria 59120
150 Ga0157375_10254322 3300013308 Bacteria 1918
151 Ga0157375_11570349 3300013308 Bacteria 778
152 Ga0163163_10002634 3300014325 Bacteria 15189
153 Ga0163163_10039841 3300014325 Bacteria 4587
154 Ga0163163_10397004 3300014325 Bacteria 1437
155 Ga0157380_11345012 3300014326 Bacteria 763
156 Ga0157380_11370889 3300014326 Bacteria 757
157 Ga0157379_10162800 3300014968 Unclassified 2014
158 Ga0157379_10172980 3300014968 Bacteria 1949
159 Ga0157376_10020995 3300014969 Bacteria 5065
160 Ga0157376_10089244 3300014969 Bacteria 2665
161 Ga0157376_10220640 3300014969 Bacteria 1756
162 Ga0157376_10423272 3300014969 Bacteria 1293
163 Ga0157376_10763886 3300014969 Bacteria 977
164 Ga0157376_12085431 3300014969 Unclassified 605
165 Ga0163161_10003202 3300017792 Bacteria 11507
166 Ga0209258_105841 3300025242 Bacteria 2013
167 Ga0207697_10039391 3300025315 Bacteria 1939
168 Ga0207682_10079560 3300025893 Unclassified 1402
169 Ga0207680_10000748 3300025903 Bacteria 15314
170 Ga0207680_10199411 3300025903 Unclassified 1363
171 Ga0207647_10000088 3300025904 Bacteria 70267
172 Ga0207643_10022862 3300025908 Bacteria 3445
173 Ga0207705_10108203 3300025909 Bacteria 2052
174 Ga0207654_10001346 3300025911 Bacteria 13038
175 Ga0207654_10004336 3300025911 Bacteria 7149
176 Ga0207654_10565514 3300025911 Unclassified 809
177 Ga0207707_10000160 3300025912 Bacteria 70695
178 Ga0207707_10038488 3300025912 Bacteria 4179
179 Ga0207695_10002404 3300025913 Bacteria 27705
180 Ga0207695_10011310 3300025913 Bacteria 10819
181 Ga0207695_10906427 3300025913 Bacteria 761
182 Ga0207671_10003071 3300025914 Bacteria 17063
183 Ga0207660_10001905 3300025917 Bacteria 13897
184 Ga0207657_10754950 3300025919 Bacteria 754
185 Ga0207657_11042823 3300025919 Unclassified 626
186 Ga0207652_10000406 3300025921 Bacteria 44756
187 Ga0207650_10021745 3300025925 Bacteria 4535
188 Ga0207650_10392008 3300025925 Unclassified 1148
189 Ga0207650_10447475 3300025925 Bacteria 1075
190 Ga0207650_10826739 3300025925 Bacteria 785
191 Ga0207687_10184330 3300025927 Bacteria 1619
192 Ga0207644_10177731 3300025931 Bacteria 1666
193 Ga0207644_10511005 3300025931 Bacteria 992
194 Ga0207690_10027729 3300025932 Bacteria 3582
195 Ga0207690_10541233 3300025932 Bacteria 946
196 Ga0207686_10061967 3300025934 Bacteria 2373
197 Ga0207686_10250089 3300025934 Unclassified 1294
198 Ga0207669_10057457 3300025937 Bacteria 2369
199 Ga0207691_10014406 3300025940 Bacteria 7540
200 Ga0207691_10104250 3300025940 Bacteria 2528
201 Ga0207691_10451315 3300025940 Bacteria 1094
202 Ga0207691_10985547 3300025940 Bacteria 704
203 Ga0207711_10113632 3300025941 Bacteria 2411
204 Ga0207689_10002845 3300025942 Bacteria 15974
205 Ga0207689_10159617 3300025942 Unclassified 1858
206 Ga0207689_10554600 3300025942 Bacteria 965
207 Ga0207661_10098527 3300025944 Bacteria 2450
208 Ga0207661_10267478 3300025944 Bacteria 1525
209 Ga0207661_11267157 3300025944 Bacteria 678
210 Ga0207679_10316106 3300025945 Bacteria 1351
211 Ga0207667_10005458 3300025949 Bacteria 15498
212 Ga0207667_10343707 3300025949 Bacteria 1522
213 Ga0207667_10512433 3300025949 Unclassified 1216
214 Ga0207651_10263462 3300025960 Unclassified 1416
215 Ga0207712_10002253 3300025961 Bacteria 12531
216 Ga0207658_10035661 3300025986 Bacteria 3564
217 Ga0207658_10115248 3300025986 Bacteria 2132
218 Ga0207677_10005793 3300026023 Bacteria 6722
219 Ga0207677_10122000 3300026023 Bacteria 1962
220 Ga0207703_10004255 3300026035 Bacteria 11782
221 Ga0207639_10021145 3300026041 Bacteria 4669
222 Ga0207639_10082003 3300026041 Bacteria 2556
223 Ga0207639_10211750 3300026041 Bacteria 1669
224 Ga0207639_10247314 3300026041 Bacteria 1554
225 Ga0207702_10069038 3300026078 Bacteria 3037
226 Ga0207702_10130100 3300026078 Bacteria 2264
227 Ga0207702_11077355 3300026078 Bacteria 797
228 Ga0207641_10000159 3300026088 Bacteria 96072
229 Ga0207641_10024276 3300026088 Bacteria 4997
230 Ga0207641_10363032 3300026088 Unclassified 1383
231 Ga0207648_10084131 3300026089 Bacteria 2775
232 Ga0207648_10139680 3300026089 Bacteria 2135
233 Ga0207648_10663907 3300026089 Bacteria 964
234 Ga0207676_10005638 3300026095 Bacteria 8862
235 Ga0207674_10067692 3300026116 Bacteria 3594
236 Ga0207674_10755659 3300026116 Bacteria 938
237 Ga0207674_11289657 3300026116 Bacteria 700
238 Ga0207683_10019772 3300026121 Bacteria 5753
239 Ga0207683_10471317 3300026121 Bacteria 1158
240 Ga0207698_10001428 3300026142 Bacteria 13881
241 Ga0207698_10029361 3300026142 Bacteria 3938
242 Ga0207698_10671147 3300026142 Bacteria 1029
243 Ga0268265_10515025 3300028380 Bacteria 1130
244 Ga0268265_11305403 3300028380 Bacteria 726
245 Ga0268264_10004566 3300028381 Bacteria 11791
246 Ga0268264_10005045 3300028381 Bacteria 11175
247 Ga0268264_10025470 3300028381 Bacteria 4833
248 Ga0268264_10654586 3300028381 Bacteria 1040
249 Ga0307515_10000021 3300028794 Bacteria 406008
250 Ga0307513_10163064 3300031456 Bacteria 2118
251 Ga0307508_10003995 3300031616 Bacteria 14615
252 Ga0307413_10564257 3300031824 Unclassified 926
253 Ga0307407_10967822 3300031903 Bacteria 656
254 Ga0373927_0174198 3300035695 Bacteria 1411
255 Ga0395900_0886470 3300037418 Unclassified 816
256 Ga0395905_0000744 3300037471 Bacteria 42929
257 Ga0439436_0002350 3300041404 Bacteria 5663
258 Ga0439439_0061827 3300041406 Bacteria 995
259 Ga0451793_0433993 3300041452 Bacteria 932
260 Ga0451797_1428417 3300041453 Bacteria 741
261 Ga0451800_1104598 3300041459 Bacteria 719
262 Ga0451802_2196245 3300041460 Bacteria 1403
263 Ga0451839_0809059 3300041496 Bacteria 716
264 Ga0451841_1281751 3300041498 Bacteria 2163
265 Ga0451849_0511390 3300041505 Unclassified 909
266 Ga0451849_1271056 3300041505 Bacteria 1365
267 Ga0451851_0489023 3300041507 Bacteria 1004
268 Ga0451843_0251719 3300041509 Bacteria 1001
269 Ga0451855_1906620 3300041511 Unclassified 633
270 Ga0451853_1254495 3300041512 Bacteria 2005
271 Ga0451853_3705800 3300041512 Bacteria 1179
272 Ga0439449_0047702 3300042007 Bacteria 1586
273 Ga0439449_0232996 3300042007 Bacteria 691
274 Ga0439457_000569 3300042014 Bacteria 10772
275 Ga0439457_021617 3300042014 Bacteria 1427
276 Ga0439457_039833 3300042014 Bacteria 1047
277 Ga0439462_0001985 3300042015 Bacteria 4683
278 Ga0466969_0004160 3300044656 Bacteria 7683
279 Ga0466972_0000471 3300044658 Bacteria 20416
280 Ga0466966_0002262 3300044684 Bacteria 12537
281 Ga0466971_0166571 3300044719 Bacteria 1033
282 Ga0466968_0121740 3300044735 Bacteria 1181
283 Ga0466957_0030735 3300044842 Bacteria 3207
284 Ga0466959_0000004 3300045049 Bacteria 216815
285 Ga0466967_1265461 3300045976 Unclassified 735
286 Ga0495638_0057003 3300046460 Bacteria 2424
287 Ga0495580_0376249 3300046472 Unclassified 960
288 Ga0495668_0076971 3300046616 Bacteria 1832
289 Ga0495625_0050341 3300046660 Bacteria 2990
290 Ga0496101_0110027 3300048904 Unclassified 2073
291 Ga0496104_0228115 3300048907 Bacteria 1774
292 Ga0496114_0078525 3300048917 Unclassified 2785
293 Ga0495682_0070841 3300049460 Bacteria 1255
294 Ga0501034_0161270 3300049571 Bacteria 2213
295 Ga0501043_0095950 3300049579 Bacteria 2331
296 Ga0501043_0403208 3300049579 Bacteria 1033
297 Ga0501046_0110115 3300049580 Bacteria 2105
298 Ga0501047_0016087 3300049581 Bacteria 7135
299 Ga0501047_0053391 3300049581 Bacteria 3908
300 Ga0501047_0057390 3300049581 Bacteria 3765
301 Ga0501067_0065372 3300049583 Bacteria 2013
302 Ga0501070_0017407 3300049586 Bacteria 6033
303 Ga0501073_0075291 3300049589 Bacteria 2349
304 Ga0501074_0055987 3300049590 Bacteria 2842
305 Ga0501202_023004 3300049652 Bacteria 1255
306 Ga0501207_052077 3300049654 Bacteria 733
307 Ga0501219_000112 3300049703 Bacteria 14228
308 Ga0501225_0004173 3300049705 Bacteria 4320
309 Ga0501225_0041888 3300049705 Bacteria 1264
310 Ga0501225_0082088 3300049705 Bacteria 926
311 Ga0501080_0094252 3300049742 Bacteria 2780
312 Ga0501083_0113337 3300049744 Bacteria 1781
313 Ga0501241_015001 3300049758 Bacteria 1409
314 Ga0501266_001932 3300049763 Bacteria 2610
315 Ga0501044_0019370 3300049823 Bacteria 7283
316 Ga0501044_0022826 3300049823 Bacteria 6665
317 nmdc:mga05p37_57390_c1 3300050507 Bacteria 4795
318 Ga0500578_0000010 3300053086 Bacteria 217642
319 Ga0500578_0041265 3300053086 Bacteria 2964
320 Ga0500644_0291084 3300053088 Bacteria 697
321 Ga0500646_0007531 3300053090 Bacteria 2785
322 Ga0500646_0011843 3300053090 Bacteria 2246
323 Ga0500646_0034699 3300053090 Bacteria 1400
324 Ga0500583_0000683 3300053092 Bacteria 9939
325 Ga0500650_0097332 3300053098 Bacteria 1378
326 Ga0500554_280433 3300053102 Bacteria 543
327 Ga0500556_0023487 3300053104 Bacteria 2015
328 Ga0500642_0133161 3300053130 Bacteria 1165
329 Ga0500568_0141006 3300053139 Bacteria 894
330 Ga0500577_0341128 3300053142 Bacteria 655
331 Ga0500589_019349 3300053147 Bacteria 3095
332 Ga0500604_0013380 3300053151 Bacteria 2223
333 Ga0500622_0138983 3300053156 Bacteria 1160
334 Ga0500637_0397150 3300053178 Bacteria 717
335 Ga0501084_0115868 3300054114 Bacteria 2252
336 Ga0501082_0162558 3300060353 Bacteria 1940
337 2738724674 2738541278 Bacteria 9755573
338 Ga0068860_100824266
339 rootH1_10074192
340 rootH2_10164387
341 rootH1_10019743
342 rootH1_10021532
343 rootH1_10216327
344 Ga0070658_10303830
345 Ga0070683_100368682
346 Ga0070683_100656514
347 Ga0070690_100382307
348 Ga0070670_100126408
349 Ga0070670_100128004
350 Ga0068869_100039983
351 Ga0070666_10000301
352 Ga0070680_100003518
353 Ga0070682_100002391
354 Ga0068868_100010528
355 Ga0068868_100149173
356 Ga0070660_100262942
357 Ga0070660_100318746
358 Ga0070691_10000660
359 Ga0070668_100110608
360 Ga0070675_100446326
361 Ga0070675_101270444
362 Ga0070671_100044695
363 Ga0070671_100126124
364 Ga0070674_100155625
365 Ga0070673_100027225
366 Ga0070673_102070300
367 Ga0070688_100021244
368 Ga0070659_100039673
369 Ga0070659_100152816
370 Ga0070667_100022974
371 Ga0070667_100044446
372 Ga0070708_101914043
373 Ga0070678_100093218
374 Ga0068867_100015002
375 Ga0068867_101445000
376 Ga0070685_10127494
377 Ga0070679_100019131
378 Ga0070679_100364955
379 Ga0068853_100082369
380 Ga0068853_100097142
381 Ga0068853_100101060
382 Ga0068853_100109193
383 Ga0068853_100274374
384 Ga0070672_100716461
385 Ga0070693_100013320
386 Ga0068855_100016778
387 Ga0068855_100041810
388 Ga0068855_100114154
389 Ga0070664_100953481
390 Ga0070664_101306855
391 Ga0068857_100053584
392 Ga0068857_100163623
393 Ga0068857_100527871
394 Ga0068857_100841342
395 Ga0068857_100913106
396 Ga0068854_100126121
397 Ga0068856_100019637
398 Ga0068856_100066996
399 Ga0068852_100000721
400 Ga0068852_100085657
401 Ga0068852_100104132
402 Ga0068859_100000006
403 Ga0068859_100006790
404 Ga0068864_100020644
405 Ga0068864_100168252
406 Ga0068851_10030436
407 Ga0068851_10076977
408 Ga0068851_10124631
409 Ga0068870_10012815
410 Ga0068863_100028166
411 Ga0068863_100030637
412 Ga0068863_100092475
413 Ga0068860_100001345
414 Ga0068860_100002872
415 Ga0068860_100039221
416 Ga0068862_100314073
417 Ga0068862_100467327
418 Ga0075366_10071917
419 Ga0075366_10154102
420 Ga0075366_10154249
421 Ga0097621_100000869
422 Ga0097621_100023987
423 Ga0097621_100213628
424 Ga0097621_100592554
425 Ga0068871_100000042
426 Ga0068871_100231421
427 Ga0097620_100000006
428 Ga0097620_100006790
429 Ga0105240_10005515
430 Ga0105240_10150422
431 Ga0105240_10288918
432 Ga0105240_10923499
433 Ga0105240_10932073
434 Ga0105245_10059258
435 Ga0105245_11796794
436 Ga0105247_10920135
437 Ga0114129_10018174
438 Ga0105241_10002922
439 Ga0105241_10003877
440 Ga0105241_10015107
441 Ga0105241_10137916
442 Ga0105242_10009531
443 Ga0105248_10153321
444 Ga0105248_11390626
445 Ga0105237_10031026
446 Ga0105237_10046731
447 Ga0105237_10047857
448 Ga0105238_10363710
449 Ga0105249_10049421
450 Ga0105239_10002212
451 Ga0105239_10065550
452 Ga0105239_10171405
453 Ga0105246_10063447
454 Ga0157373_10017427
455 Ga0157373_10259304
456 Ga0157371_10015698
457 Ga0157371_10085964
458 Ga0157371_10399507
459 Ga0157370_10011590
460 Ga0157370_10248072
461 Ga0157370_10447584
462 Ga0157370_10482432
463 Ga0157370_10831202
464 Ga0157369_10021772
465 Ga0157369_10022350
466 Ga0157369_10421424
467 Ga0157374_10048709
468 Ga0157374_10177658
469 Ga0157374_10230340
470 Ga0157378_10020928
471 Ga0157378_10057508
472 Ga0157378_10104671
473 Ga0157378_10154436
474 Ga0157378_10592812
475 Ga0163162_10001206
476 Ga0163162_10033366
477 Ga0163162_10116430
478 Ga0163162_10291888
479 Ga0163162_10510945
480 Ga0157372_10028585
481 Ga0157372_10223201
482 Ga0157372_10252104
483 Ga0157372_10444696
484 Ga0157372_11550952
485 Ga0157375_10000182
486 Ga0157375_10254322
487 Ga0157375_11570349
488 Ga0163163_10002634
489 Ga0163163_10039841
490 Ga0163163_10397004
491 Ga0157380_11345012
492 Ga0157380_11370889
493 Ga0157379_10162800
494 Ga0157379_10172980
495 Ga0157376_10020995
496 Ga0157376_10089244
497 Ga0157376_10220640
498 Ga0157376_10423272
499 Ga0157376_10763886
500 Ga0157376_12085431
501 Ga0163161_10003202
502 Ga0209258_105841
503 Ga0207697_10039391
504 Ga0207682_10079560
505 Ga0207680_10000748
506 Ga0207680_10199411
507 Ga0207647_10000088
508 Ga0207643_10022862
509 Ga0207705_10108203
510 Ga0207654_10001346
511 Ga0207654_10004336
512 Ga0207654_10565514
513 Ga0207707_10000160
514 Ga0207707_10038488
515 Ga0207695_10002404
516 Ga0207695_10011310
517 Ga0207695_10906427
518 Ga0207671_10003071
519 Ga0207660_10001905
520 Ga0207657_10754950
521 Ga0207657_11042823
522 Ga0207652_10000406
523 Ga0207650_10021745
524 Ga0207650_10392008
525 Ga0207650_10447475
526 Ga0207650_10826739
527 Ga0207687_10184330
528 Ga0207644_10177731
529 Ga0207644_10511005
530 Ga0207690_10027729
531 Ga0207690_10541233
532 Ga0207686_10061967
533 Ga0207686_10250089
534 Ga0207669_10057457
535 Ga0207691_10014406
536 Ga0207691_10104250
537 Ga0207691_10451315
538 Ga0207691_10985547
539 Ga0207711_10113632
540 Ga0207689_10002845
541 Ga0207689_10159617
542 Ga0207689_10554600
543 Ga0207661_10098527
544 Ga0207661_10267478
545 Ga0207661_11267157
546 Ga0207679_10316106
547 Ga0207667_10005458
548 Ga0207667_10343707
549 Ga0207667_10512433
550 Ga0207651_10263462
551 Ga0207712_10002253
552 Ga0207658_10035661
553 Ga0207658_10115248
554 Ga0207677_10005793
555 Ga0207677_10122000
556 Ga0207703_10004255
557 Ga0207639_10021145
558 Ga0207639_10082003
559 Ga0207639_10211750
560 Ga0207639_10247314
561 Ga0207702_10069038
562 Ga0207702_10130100
563 Ga0207702_11077355
564 Ga0207641_10000159
565 Ga0207641_10024276
566 Ga0207641_10363032
567 Ga0207648_10084131
568 Ga0207648_10139680
569 Ga0207648_10663907
570 Ga0207676_10005638
571 Ga0207674_10067692
572 Ga0207674_10755659
573 Ga0207674_11289657
574 Ga0207683_10019772
575 Ga0207683_10471317
576 Ga0207698_10001428
577 Ga0207698_10029361
578 Ga0207698_10671147
579 Ga0268265_10515025
580 Ga0268265_11305403
581 Ga0268264_10004566
582 Ga0268264_10005045
583 Ga0268264_10025470
584 Ga0268264_10654586
585 Ga0307515_10000021
586 Ga0307513_10163064
587 Ga0307508_10003995
588 Ga0307413_10564257
589 Ga0307407_10967822
590 Ga0373927_0174198
591 Ga0395900_0886470
592 Ga0395905_0000744
593 Ga0439436_0002350
594 Ga0439439_0061827
595 Ga0451793_0433993
596 Ga0451797_1428417
597 Ga0451800_1104598
598 Ga0451802_2196245
599 Ga0451839_0809059
600 Ga0451841_1281751
601 Ga0451849_0511390
602 Ga0451849_1271056
603 Ga0451851_0489023
604 Ga0451843_0251719
605 Ga0451855_1906620
606 Ga0451853_1254495
607 Ga0451853_3705800
608 Ga0439449_0047702
609 Ga0439449_0232996
610 Ga0439457_000569
611 Ga0439457_021617
612 Ga0439457_039833
613 Ga0439462_0001985
614 Ga0466969_0004160
615 Ga0466972_0000471
616 Ga0466966_0002262
617 Ga0466971_0166571
618 Ga0466968_0121740
619 Ga0466957_0030735
620 Ga0466959_0000004
621 Ga0466967_1265461
622 Ga0495638_0057003
623 Ga0495580_0376249
624 Ga0495668_0076971
625 Ga0495625_0050341
626 Ga0496101_0110027
627 Ga0496104_0228115
628 Ga0496114_0078525
629 Ga0495682_0070841
630 Ga0501034_0161270
631 Ga0501043_0095950
632 Ga0501043_0403208
633 Ga0501046_0110115
634 Ga0501047_0016087
635 Ga0501047_0053391
636 Ga0501047_0057390
637 Ga0501067_0065372
638 Ga0501070_0017407
639 Ga0501073_0075291
640 Ga0501074_0055987
641 Ga0501202_023004
642 Ga0501207_052077
643 Ga0501219_000112
644 Ga0501225_0004173
645 Ga0501225_0041888
646 Ga0501225_0082088
647 Ga0501080_0094252
648 Ga0501083_0113337
649 Ga0501241_015001
650 Ga0501266_001932
651 Ga0501044_0019370
652 Ga0501044_0022826
653 nmdc:mga05p37_57390_c1
654 Ga0500578_0000010
655 Ga0500578_0041265
656 Ga0500644_0291084
657 Ga0500646_0007531
658 Ga0500646_0011843
659 Ga0500646_0034699
660 Ga0500583_0000683
661 Ga0500650_0097332
662 Ga0500554_280433
663 Ga0500556_0023487
664 Ga0500642_0133161
665 Ga0500568_0141006
666 Ga0500577_0341128
667 Ga0500589_019349
668 Ga0500604_0013380
669 Ga0500622_0138983
670 Ga0500637_0397150
671 Ga0501084_0115868
672 Ga0501082_0162558
673 2738724674

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14317

YcxB

YcxB-like protein

96

157

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ymz-assembly2.cif.gz_C crystal structure of chicken galectin 2 0.8425 85 108
2gcj-assembly4.cif.gz_D crystal structure of the pob3 middle domain 0.8351 82 124
1qmj-assembly1.cif.gz_B cg-16, a homodimeric agglutinin from chicken liver 0.8109 84 108
3wud-assembly1.cif.gz_A-2 x-ray crystal structure of xenopus laevis galectin-ib 0.7932 85 108
1c1f-assembly1.cif.gz_A ligand-free congerin i 0.7637 85 108
ID Description Score Start End Superfamily
af_A0A2C9C3B6_21_157_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.8766 85 108 2.60.120.200
af_A0A5K1K8Z2_108_206_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8136 86 134 2.30.29.30
af_Q23532_7_215_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8087 85 108 1.20.140.150
af_O17231_1_185_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.8044 84 108 3.80.10.10
5ewsB00 Mainly Beta;Sandwich;Jelly Rolls; 0.7952 85 108 2.60.120.200
ID Description Score Start End GO Terms
AF-A0A4Q3S0G7-F1-model_v4 YcxB family protein 0.9761 1 156 GO:0016020
AF-A0A849UUP3-F1-model_v4 YcxB family protein 0.9668 1 156 GO:0016020
AF-A0A4Q3S0G7-F1-model_v4 YcxB family protein 0.9579 1 156 GO:0016020
AF-A0A6I6GB82-F1-model_v4 YcxB family protein 0.9501 1 159 GO:0016020
AF-A0A849UUP3-F1-model_v4 YcxB family protein 0.949 1 156 GO:0016020

Map