F412663

General Info

Members Datasets Scaffolds Average Seq Length
336 259 321 216

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10047410|Ga0157374_100474104
Length 245
Sequence MISPKDLNSATDNTAATRRTVNARGDQILTFDLFGDETPKGSEREIMAPGATLLRGYALPSEAELLAAIAQIAADAPFRHMTTPGGFVMSVAMTNCGKVGWVTDRKGYRYDPLDPESGKSWPQMPASFSELAAGAAQAAGYPEFEPDACLINRYEPGARMSLHQDKDEKDFEQPIVSVSLGLPAVFQFGGAKRTDPVTKYALRHGDVVVWGGPSRAFYHGVPTLKEGDHPKLGRRRLNLTFRKAL

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
3 2643221609 Acidovorax sp. Root217 Isolate Unclassified
4 2643221618 Ensifer sp. Root231 Isolate Unclassified
5 2643221655 Ensifer sp. Root1252 Isolate Unclassified
6 2643221659 Ensifer sp. Root127 Isolate Unclassified
7 2643221698 Ensifer sp. Root142 Isolate Unclassified
8 2643221712 Ensifer sp. Root258 Isolate Unclassified
9 2844163670 Ensifer sp. 1H6 Isolate Unclassified
10 2855730933 Achromobacter sp. HZ28 Isolate Nodule
11 2855767633 Achromobacter sp. HZ34 Isolate Nodule
12 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
13 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
14 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
15 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
16 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
17 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
18 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
19 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
20 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
90 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
144 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
145 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
146 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
147 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
189 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
198 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
234 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
235 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
236 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
237 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
238 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
239 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
240 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
241 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
242 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
243 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
244 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
245 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
246 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
247 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
248 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
249 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
250 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
251 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
252 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
253 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
254 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
255 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
256 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
259 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.64
Metatranscriptomes 0.3
Isolates 5.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.77
Nodule 0.89
Rhizoplane 2.08
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 14.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000212 3300002705 Bacteria 40452
2 JGI25154J39366_1001959 3300002738 Bacteria 6090
3 JGI25157J39369_1000075 3300002741 Bacteria 88169
4 JGI25151J46595_10000190 3300003187 Bacteria 75765
5 rootH1_10009260 3300003316 Bacteria 2036
6 rootH1_10009260 3300003323 Bacteria 16518
7 rootH1_10053130 3300003316 Bacteria 2306
8 rootH1_10053130 3300003323 Bacteria 6288
9 rootH2_10222366 3300003320 Bacteria 1344
10 rootH1_10031052 3300003323 Bacteria 7115
11 Ga0055529_1001167 3300003763 Bacteria 10792
12 Ga0055540_1002816 3300003792 Bacteria 8891
13 Ga0070676_10460481 3300005328 Unclassified 896
14 Ga0070680_100049153 3300005336 Bacteria 3437
15 Ga0070680_100673579 3300005336 Bacteria 890
16 Ga0070660_100022011 3300005339 Bacteria 4709
17 Ga0070660_100058223 3300005339 Bacteria 2995
18 Ga0070689_100315857 3300005340 Bacteria 1303
19 Ga0070692_10017873 3300005345 Bacteria 3399
20 Ga0070688_100317937 3300005365 Bacteria 1130
21 Ga0070659_100014508 3300005366 Bacteria 5889
22 Ga0070709_10042323 3300005434 Bacteria 2812
23 Ga0070701_10010032 3300005438 Bacteria 4173
24 Ga0070700_100041671 3300005441 Bacteria 2815
25 Ga0070663_100017625 3300005455 Bacteria 4665
26 Ga0070678_100044222 3300005456 Bacteria 3179
27 Ga0070662_100133133 3300005457 Bacteria 1919
28 Ga0070681_10018314 3300005458 Bacteria 6999
29 Ga0070681_10625685 3300005458 Bacteria 991
30 Ga0070706_100213045 3300005467 Bacteria 1803
31 Ga0070684_100166983 3300005535 Bacteria 1998
32 Ga0068853_100037059 3300005539 Bacteria 4148
33 Ga0070695_100156900 3300005545 Bacteria 1593
34 Ga0070665_100091930 3300005548 Bacteria 3039
35 Ga0070704_100165446 3300005549 Bacteria 1753
36 Ga0068855_100003502 3300005563 Bacteria 19224
37 Ga0068855_100004310 3300005563 Bacteria 17394
38 Ga0068855_100082686 3300005563 Bacteria 3721
39 Ga0068855_100110208 3300005563 Bacteria 3160
40 Ga0068855_100214447 3300005563 Bacteria 2162
41 Ga0068855_100459968 3300005563 Bacteria 1388
42 Ga0068857_100002629 3300005577 Bacteria 14741
43 Ga0068857_100272111 3300005577 Bacteria 1557
44 Ga0068854_100002212 3300005578 Bacteria 11972
45 Ga0068854_100036051 3300005578 Bacteria 3466
46 Ga0068856_100000871 3300005614 Bacteria 32354
47 Ga0068852_100039527 3300005616 Bacteria 3972
48 Ga0068852_100204822 3300005616 Bacteria 1868
49 Ga0068852_100552978 3300005616 Bacteria 1151
50 Ga0068866_10003204 3300005718 Bacteria 6744
51 Ga0068851_10002001 3300005834 Bacteria 8977
52 Ga0068851_10005246 3300005834 Bacteria 5880
53 Ga0068851_10298973 3300005834 Bacteria 925
54 Ga0068863_100366435 3300005841 Bacteria 1405
55 Ga0068858_100240714 3300005842 Bacteria 1717
56 Ga0068862_100308630 3300005844 Bacteria 1457
57 Ga0075365_10003306 3300006038 Bacteria 8275
58 Ga0075363_100051172 3300006048 Bacteria 2202
59 Ga0075364_10006610 3300006051 Bacteria 6827
60 Ga0075364_10444675 3300006051 Bacteria 885
61 Ga0070716_100241464 3300006173 Bacteria 1225
62 Ga0070712_100000982 3300006175 Bacteria 17141
63 Ga0075367_10051743 3300006178 Bacteria 2429
64 Ga0075367_10132026 3300006178 Bacteria 1544
65 Ga0075366_10031342 3300006195 Bacteria 3128
66 Ga0097621_100154441 3300006237 Bacteria 1969
67 Ga0068871_100183479 3300006358 Bacteria 1799
68 Ga0105240_10017256 3300009093 Bacteria 9738
69 Ga0105240_10021697 3300009093 Bacteria 8537
70 Ga0105240_10048021 3300009093 Bacteria 5397
71 Ga0111539_10022111 3300009094 Bacteria 7816
72 Ga0114129_10792718 3300009147 Bacteria 1209
73 Ga0105241_10026612 3300009174 Bacteria 4305
74 Ga0105242_10044092 3300009176 Bacteria 3610
75 Ga0105248_10197764 3300009177 Bacteria 2265
76 Ga0105237_10064124 3300009545 Bacteria 3671
77 Ga0105238_10002530 3300009551 Bacteria 18269
78 Ga0105238_10274644 3300009551 Bacteria 1666
79 Ga0105239_10375509 3300010375 Bacteria 1607
80 Ga0105246_10033754 3300011119 Bacteria 3404
81 Ga0157370_10506101 3300013104 Bacteria 1109
82 Ga0157369_10016991 3300013105 Bacteria 8178
83 Ga0157374_10047410 3300013296 Bacteria 3984
84 Ga0157378_10106390 3300013297 Bacteria 2566
85 Ga0163162_10236550 3300013306 Bacteria 1957
86 Ga0157372_10004754 3300013307 Bacteria 14419
87 Ga0157380_10046086 3300014326 Bacteria 3423
88 Ga0157379_10015135 3300014968 Bacteria 6766
89 Ga0157376_10281386 3300014969 Bacteria 1567
90 Ga0206356_10172038 3300020070 Bacteria 1309
91 Ga0209258_100162 3300025242 Bacteria 151725
92 Ga0209646_1000066 3300025246 Bacteria 244823
93 Ga0209026_1000027 3300025250 Bacteria 351282
94 Ga0209677_100128 3300025253 Bacteria 76547
95 Ga0209759_1000387 3300025256 Bacteria 55041
96 Ga0209759_1000634 3300025256 Bacteria 33022
97 Ga0209759_1008305 3300025256 Bacteria 3249
98 Ga0207666_1002957 3300025271 Bacteria 2066
99 Ga0209455_1000128 3300025272 Bacteria 162413
100 Ga0209025_1000026 3300025294 Bacteria 519850
101 Ga0209564_1000385 3300025295 Bacteria 80273
102 Ga0209051_1000354 3300025303 Bacteria 68119
103 Ga0209051_1031762 3300025303 Bacteria 2026
104 Ga0207697_10001936 3300025315 Bacteria 10998
105 Ga0207656_10026678 3300025321 Bacteria 2357
106 Ga0207682_10000740 3300025893 Bacteria 15117
107 Ga0207692_10055970 3300025898 Bacteria 2021
108 Ga0207642_10056877 3300025899 Bacteria 1796
109 Ga0207688_10000602 3300025901 Bacteria 17683
110 Ga0207647_10093788 3300025904 Bacteria 1789
111 Ga0207643_10000480 3300025908 Bacteria 25852
112 Ga0207705_10468168 3300025909 Bacteria 978
113 Ga0207684_10407945 3300025910 Bacteria 1168
114 Ga0207654_10000757 3300025911 Bacteria 17843
115 Ga0207707_10267086 3300025912 Bacteria 1483
116 Ga0207695_10000424 3300025913 Bacteria 93657
117 Ga0207695_10077313 3300025913 Bacteria 3381
118 Ga0207671_10098128 3300025914 Bacteria 2216
119 Ga0207693_10000649 3300025915 Bacteria 31124
120 Ga0207660_10223068 3300025917 Bacteria 1480
121 Ga0207662_10003173 3300025918 Bacteria 8407
122 Ga0207657_10008136 3300025919 Bacteria 10690
123 Ga0207657_10008364 3300025919 Bacteria 10507
124 Ga0207657_10030873 3300025919 Bacteria 4857
125 Ga0207694_10000119 3300025924 Bacteria 83771
126 Ga0207694_10050607 3300025924 Bacteria 3218
127 Ga0207694_10232266 3300025924 Bacteria 1506
128 Ga0207694_10455293 3300025924 Unclassified 1068
129 Ga0207650_10034864 3300025925 Bacteria 3651
130 Ga0207700_10639245 3300025928 Bacteria 948
131 Ga0207664_10308198 3300025929 Bacteria 1394
132 Ga0207644_10040337 3300025931 Bacteria 3299
133 Ga0207690_10021060 3300025932 Bacteria 4039
134 Ga0207706_10006029 3300025933 Bacteria 11274
135 Ga0207669_10464558 3300025937 Bacteria 1005
136 Ga0207704_10191419 3300025938 Bacteria 1488
137 Ga0207665_10000407 3300025939 Bacteria 29572
138 Ga0207665_10112100 3300025939 Bacteria 1918
139 Ga0207691_10067244 3300025940 Bacteria 3240
140 Ga0207661_10116226 3300025944 Bacteria 2271
141 Ga0207667_10001159 3300025949 Bacteria 33115
142 Ga0207667_10011792 3300025949 Bacteria 10126
143 Ga0207667_10014365 3300025949 Bacteria 9031
144 Ga0207667_10104515 3300025949 Bacteria 2921
145 Ga0207667_10123972 3300025949 Bacteria 2662
146 Ga0207667_10223197 3300025949 Bacteria 1930
147 Ga0207667_10254931 3300025949 Bacteria 1795
148 Ga0207668_10165862 3300025972 Bacteria 1726
149 Ga0207640_10009833 3300025981 Bacteria 5365
150 Ga0207640_10048633 3300025981 Bacteria 2742
151 Ga0207658_10092751 3300025986 Bacteria 2346
152 Ga0207703_10129365 3300026035 Bacteria 2178
153 Ga0207703_10385564 3300026035 Bacteria 1297
154 Ga0207639_10274024 3300026041 Bacteria 1481
155 Ga0207639_10574899 3300026041 Bacteria 1037
156 Ga0207678_10004746 3300026067 Bacteria 12210
157 Ga0207708_10062938 3300026075 Bacteria 2834
158 Ga0207702_10000002 3300026078 Bacteria 491507
159 Ga0207702_10000128 3300026078 Bacteria 89386
160 Ga0207702_10000244 3300026078 Bacteria 63493
161 Ga0207702_10000432 3300026078 Bacteria 47878
162 Ga0207648_10084202 3300026089 Bacteria 2773
163 Ga0207676_10043823 3300026095 Bacteria 3447
164 Ga0207674_10001403 3300026116 Bacteria 31095
165 Ga0207674_10014341 3300026116 Bacteria 8756
166 Ga0207675_100022204 3300026118 Bacteria 5909
167 Ga0207683_10077383 3300026121 Bacteria 2946
168 Ga0207698_10041407 3300026142 Bacteria 3432
169 Ga0207698_10146731 3300026142 Bacteria 2041
170 Ga0209813_10015355 3300027866 Bacteria 2073
171 Ga0268266_10465302 3300028379 Bacteria 1203
172 Ga0268264_10144795 3300028381 Bacteria 2123
173 Ga0265326_10008052 3300028558 Bacteria 3196
174 Ga0265319_1027058 3300028563 Bacteria 2038
175 Ga0265334_10001696 3300028573 Bacteria 10529
176 Ga0265322_10001590 3300028654 Bacteria 7289
177 Ga0265336_10000008 3300028666 Bacteria 336082
178 Ga0265336_10000135 3300028666 Bacteria 52478
179 Ga0307515_10197034 3300028794 Bacteria 1903
180 Ga0265338_10000034 3300028800 Bacteria 244623
181 Ga0265338_10164700 3300028800 Bacteria 1708
182 Ga0265324_10004339 3300029957 Bacteria 6458
183 Ga0265327_10000225 3300031251 Bacteria 115061
184 Ga0307513_10159773 3300031456 Bacteria 2148
185 Ga0307508_10022377 3300031616 Bacteria 5746
186 Ga0307516_10000060 3300031730 Bacteria 118638
187 Ga0307516_10027386 3300031730 Bacteria 5779
188 Ga0307413_10172782 3300031824 Bacteria 1531
189 Ga0307410_10183066 3300031852 Bacteria 1587
190 Ga0307412_10150727 3300031911 Bacteria 1715
191 Ga0307409_100155556 3300031995 Bacteria 1991
192 Ga0307414_10108530 3300032004 Bacteria 2106
193 Ga0307415_100160608 3300032126 Bacteria 1741
194 Ga0307510_10047128 3300033180 Bacteria 4623
195 Ga0373931_0008073 3300035691 Bacteria 4982
196 Ga0373931_0086197 3300035691 Bacteria 1742
197 Ga0395900_0130125 3300037418 Bacteria 2580
198 Ga0395898_0021688 3300037466 Bacteria 6511
199 Ga0395898_0363548 3300037466 Bacteria 1380
200 Ga0395905_0484108 3300037471 Bacteria 1137
201 Ga0395905_0957580 3300037471 Bacteria 759
202 Ga0395901_0001198 3300038443 Bacteria 27598
203 Ga0436361_0687601 3300039447 Bacteria 3369
204 Ga0436363_1095038 3300039450 Bacteria 4701
205 Ga0451853_0483640 3300041512 Bacteria 788
206 Ga0466969_0024761 3300044656 Bacteria 3087
207 Ga0466972_0060016 3300044658 Bacteria 1825
208 Ga0466965_0061408 3300044683 Bacteria 1878
209 Ga0466961_0246869 3300044693 Bacteria 1096
210 Ga0466963_0058819 3300044694 Bacteria 2564
211 Ga0466963_0179887 3300044694 Bacteria 1476
212 Ga0466963_0245040 3300044694 Bacteria 1257
213 Ga0466963_0346702 3300044694 Unclassified 1046
214 Ga0466971_0037921 3300044719 Bacteria 2161
215 Ga0466970_0009106 3300044765 Bacteria 5010
216 Ga0466957_0025379 3300044842 Bacteria 3512
217 Ga0466957_0443819 3300044842 Bacteria 893
218 Ga0466960_0009499 3300044901 Bacteria 4012
219 Ga0466959_0059550 3300045049 Bacteria 2781
220 Ga0466959_0145460 3300045049 Bacteria 1673
221 Ga0466958_0006865 3300045836 Bacteria 6223
222 Ga0466967_0091246 3300045976 Bacteria 2768
223 Ga0466967_0807606 3300045976 Bacteria 931
224 Ga0495629_0056500 3300046459 Bacteria 2744
225 Ga0495638_0005277 3300046460 Bacteria 9656
226 Ga0495638_0008841 3300046460 Bacteria 7110
227 Ga0495580_0138344 3300046472 Bacteria 1688
228 Ga0495606_0003759 3300046507 Bacteria 15784
229 Ga0495610_0020734 3300046512 Bacteria 3641
230 Ga0495616_0026432 3300046513 Bacteria 3090
231 Ga0495643_0052052 3300046522 Bacteria 2200
232 Ga0495648_0172820 3300046524 Bacteria 1106
233 Ga0495666_0000016 3300046526 Bacteria 68631
234 Ga0495621_0094622 3300046539 Bacteria 1130
235 Ga0495622_0000045 3300046557 Bacteria 114324
236 Ga0495622_0018702 3300046557 Bacteria 3227
237 Ga0495625_0068896 3300046660 Bacteria 2486
238 Ga0495661_0030247 3300046665 Bacteria 3450
239 Ga0495588_0074893 3300046674 Bacteria 1763
240 Ga0495669_0033014 3300046684 Bacteria 2277
241 Ga0495649_0000396 3300046694 Bacteria 37744
242 Ga0495589_0011393 3300046794 Bacteria 4618
243 Ga0495604_0400801 3300047317 Bacteria 904
244 Ga0495674_0010710 3300047319 Bacteria 8674
245 Ga0495686_0011260 3300047472 Bacteria 6306
246 Ga0495686_0016769 3300047472 Bacteria 4955
247 Ga0495686_0446525 3300047472 Bacteria 688
248 Ga0495626_0140571 3300048091 Bacteria 1024
249 Ga0496101_0067225 3300048904 Bacteria 2616
250 Ga0496106_0057143 3300048909 Bacteria 2950
251 Ga0496106_0099104 3300048909 Bacteria 2259
252 Ga0496108_0421362 3300048911 Bacteria 1166
253 Ga0496114_0035986 3300048917 Bacteria 4091
254 Ga0496114_0792732 3300048917 Bacteria 826
255 Ga0496116_0042143 3300048919 Bacteria 3124
256 Ga0496117_0062861 3300048920 Bacteria 2541
257 Ga0496117_0063559 3300048920 Bacteria 2522
258 Ga0496117_0067523 3300048920 Bacteria 2419
259 Ga0496118_0110798 3300048921 Bacteria 1822
260 Ga0496120_0071650 3300048923 Bacteria 1902
261 Ga0496121_0005159 3300048924 Bacteria 16967
262 Ga0496121_0458149 3300048924 Bacteria 820
263 Ga0496122_0069322 3300048925 Bacteria 2526
264 Ga0496122_0186045 3300048925 Bacteria 1232
265 Ga0496123_0079188 3300048926 Bacteria 2009
266 Ga0496125_0008234 3300048928 Bacteria 10959
267 Ga0496125_0225155 3300048928 Bacteria 1204
268 Ga0496126_0206966 3300048929 Bacteria 1653
269 Ga0496126_0338925 3300048929 Bacteria 1232
270 Ga0496126_0546894 3300048929 Bacteria 919
271 Ga0501033_0161294 3300049570 Bacteria 1614
272 Ga0501033_0296231 3300049570 Bacteria 1140
273 Ga0501038_0200637 3300049574 Bacteria 1601
274 Ga0501038_0532981 3300049574 Bacteria 895
275 Ga0501042_0202534 3300049578 Bacteria 1431
276 Ga0501071_0214673 3300049587 Bacteria 1447
277 Ga0501072_0490569 3300049588 Bacteria 972
278 Ga0501073_0090915 3300049589 Bacteria 2121
279 Ga0501080_0142256 3300049742 Bacteria 2218
280 Ga0501083_0059432 3300049744 Bacteria 2557
281 Ga0501044_0125382 3300049823 Bacteria 2566
282 nmdc:mga03n38_10272_c1 3300050490 Bacteria 3435
283 nmdc:mga03n38_31494_c1 3300050490 Bacteria 2238
284 nmdc:mga00v17_12825_c1 3300050491 Bacteria 4634
285 nmdc:mga0yw44_342847_c1 3300050492 Bacteria 1005
286 nmdc:mga06z11_126961_c1 3300050494 Bacteria 1428
287 nmdc:mga06z11_46749_c1 3300050494 Bacteria 2195
288 nmdc:mga04h51_10452_c1 3300050495 Bacteria 2549
289 nmdc:mga07m45_18985_c1 3300050496 Bacteria 3720
290 nmdc:mga05p37_37524_c1 3300050507 Bacteria 5942
291 nmdc:mga0n895_12644_c1 3300050512 Bacteria 7577
292 Ga0500635_0011870 3300053080 Bacteria 2487
293 Ga0500643_027379 3300053087 Bacteria 1773
294 Ga0500644_0054269 3300053088 Bacteria 1386
295 Ga0500581_083549 3300053089 Bacteria 1591
296 Ga0500651_0215295 3300053093 Bacteria 1128
297 Ga0500566_0000370 3300053094 Bacteria 24642
298 Ga0500650_0000365 3300053098 Bacteria 10988
299 Ga0500556_0000468 3300053104 Bacteria 28502
300 Ga0500562_017886 3300053108 Bacteria 1829
301 Ga0500562_103495 3300053108 Bacteria 775
302 Ga0500592_005556 3300053116 Bacteria 2008
303 Ga0500595_017788 3300053119 Bacteria 2615
304 Ga0500595_028661 3300053119 Bacteria 1897
305 Ga0500608_055243 3300053122 Bacteria 1904
306 Ga0500642_0000019 3300053130 Bacteria 159944
307 Ga0500658_0320360 3300053134 Bacteria 712
308 Ga0500559_0001011 3300053136 Bacteria 17309
309 Ga0500568_0031207 3300053139 Bacteria 2200
310 Ga0500590_087912 3300053148 Bacteria 1514
311 Ga0500616_0000041 3300053153 Bacteria 359328
312 Ga0500622_0004419 3300053156 Bacteria 8842
313 Ga0500633_0052974 3300053160 Bacteria 1406
314 Ga0500636_0075535 3300053177 Bacteria 1949
315 Ga0500636_0130468 3300053177 Bacteria 1400
316 Ga0500637_0086448 3300053178 Bacteria 1813
317 Ga0500570_145243 3300053724 Bacteria 860
318 Ga0500596_009332 3300053735 Bacteria 1534
319 Ga0501082_0131831 3300060353 Bacteria 2169
320 Ga0466962_0006644 3300061719 Bacteria 5550
321 Ga0466962_0033810 3300061719 Bacteria 2447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005336 Ga0070680_100049153 Ga0070680_1000491535 179
2 3300005458 Ga0070681_10018314 Ga0070681_100183142 179
3 3300009093 Ga0105240_10048021 Ga0105240_100480215 179
4 3300025912 Ga0207707_10267086 Ga0207707_102670862 179
5 3300025913 Ga0207695_10077313 Ga0207695_100773133 179
6 3300047472 Ga0495686_0446525 Ga0495686_0446525_57_656 199
7 3300044694 Ga0466963_0346702 Ga0466963_0346702_204_854 200
8 3300003187 JGI25151J46595_10000190 JGI25151J46595_1000019034 203
9 3300025294 Ga0209025_1000026 Ga0209025_100002677 203
10 3300037418 Ga0395900_0130125 Ga0395900_0130125_881_1543 203
11 3300037466 Ga0395898_0363548 Ga0395898_0363548_630_1292 203
12 3300044694 Ga0466963_0058819 Ga0466963_0058819_1682_2311 203
13 3300053122 Ga0500608_055243 Ga0500608_055243_1199_1852 204
14 3300044694 Ga0466963_0179887 Ga0466963_0179887_720_1364 205
15 3300049588 Ga0501072_0490569 Ga0501072_0490569_19_672 205
16 3300005328 Ga0070676_10460481 Ga0070676_104604812 208
17 3300003316 rootH1_10009260 rootH1_100092602 209
18 3300005365 Ga0070688_100317937 Ga0070688_1003179372 209
19 3300005456 Ga0070678_100044222 Ga0070678_1000442222 209
20 3300005535 Ga0070684_100166983 Ga0070684_1001669831 209
21 3300005563 Ga0068855_100110208 Ga0068855_1001102083 209
22 3300005577 Ga0068857_100002629 Ga0068857_1000026296 209
23 3300005578 Ga0068854_100036051 Ga0068854_1000360513 209
24 3300005614 Ga0068856_100000871 Ga0068856_10000087113 209
25 3300005616 Ga0068852_100552978 Ga0068852_1005529781 209
26 3300005834 Ga0068851_10298973 Ga0068851_102989732 209
27 3300009177 Ga0105248_10197764 Ga0105248_101977642 209
28 3300009545 Ga0105237_10064124 Ga0105237_100641241 209
29 3300013105 Ga0157369_10016991 Ga0157369_100169913 209
30 3300025914 Ga0207671_10098128 Ga0207671_100981282 209
31 3300025924 Ga0207694_10050607 Ga0207694_100506073 209
32 3300025924 Ga0207694_10455293 Ga0207694_104552931 209
33 3300025925 Ga0207650_10034864 Ga0207650_100348642 209
34 3300025944 Ga0207661_10116226 Ga0207661_101162262 209
35 3300025949 Ga0207667_10104515 Ga0207667_101045152 209
36 3300025981 Ga0207640_10048633 Ga0207640_100486333 209
37 3300026078 Ga0207702_10000128 Ga0207702_1000012869 209
38 3300026078 Ga0207702_10000244 Ga0207702_1000024415 209
39 3300026078 Ga0207702_10000432 Ga0207702_1000043232 209
40 3300026116 Ga0207674_10014341 Ga0207674_100143414 209
41 3300026142 Ga0207698_10146731 Ga0207698_101467313 209
42 3300045976 Ga0466967_0807606 Ga0466967_0807606_106_762 209
43 3300046526 Ga0495666_0000016 Ga0495666_0000016_5028_5672 209
44 3300047319 Ga0495674_0010710 Ga0495674_0010710_3597_4241 209
45 3300048917 Ga0496114_0792732 Ga0496114_0792732_80_736 209
46 3300050492 nmdc:mga0yw44_342847_c1 nmdc:mga0yw44_342847_c1_230_865 209
47 3300053119 Ga0500595_017788 Ga0500595_017788_243_878 209
48 3300003316 rootH1_10053130 rootH1_100531302 210
49 3300003320 rootH2_10222366 rootH2_102223662 210
50 3300003323 rootH1_10031052 rootH1_100310521 210
51 3300005339 Ga0070660_100022011 Ga0070660_1000220113 210
52 3300005366 Ga0070659_100014508 Ga0070659_1000145087 210
53 3300005455 Ga0070663_100017625 Ga0070663_1000176253 210
54 3300005563 Ga0068855_100004310 Ga0068855_10000431010 210
55 3300005563 Ga0068855_100214447 Ga0068855_1002144472 210
56 3300005578 Ga0068854_100002212 Ga0068854_1000022123 210
57 3300005616 Ga0068852_100204822 Ga0068852_1002048222 210
58 3300013307 Ga0157372_10004754 Ga0157372_100047546 210
59 3300020070 Ga0206356_10172038 Ga0206356_101720382 210
60 3300025909 Ga0207705_10468168 Ga0207705_104681682 210
61 3300025919 Ga0207657_10030873 Ga0207657_100308734 210
62 3300025932 Ga0207690_10021060 Ga0207690_100210605 210
63 3300025949 Ga0207667_10014365 Ga0207667_100143658 210
64 3300025949 Ga0207667_10123972 Ga0207667_101239721 210
65 3300025981 Ga0207640_10009833 Ga0207640_100098332 210
66 3300028800 Ga0265338_10164700 Ga0265338_101647002 210
67 3300031456 Ga0307513_10159773 Ga0307513_101597731 210
68 3300037471 Ga0395905_0957580 Ga0395905_0957580_12_656 210
69 3300044658 Ga0466972_0060016 Ga0466972_0060016_717_1370 210
70 3300044901 Ga0466960_0009499 Ga0466960_0009499_758_1411 210
71 3300045049 Ga0466959_0059550 Ga0466959_0059550_1247_1894 210
72 3300045049 Ga0466959_0145460 Ga0466959_0145460_671_1318 210
73 3300045836 Ga0466958_0006865 Ga0466958_0006865_3435_4082 210
74 3300046557 Ga0495622_0000045 Ga0495622_0000045_13178_13831 210
75 3300047317 Ga0495604_0400801 Ga0495604_0400801_176_835 210
76 3300048920 Ga0496117_0062861 Ga0496117_0062861_1054_1710 210
77 3300048929 Ga0496126_0206966 Ga0496126_0206966_170_826 210
78 3300049570 Ga0501033_0161294 Ga0501033_0161294_713_1348 210
79 3300049574 Ga0501038_0200637 Ga0501038_0200637_331_966 210
80 3300049589 Ga0501073_0090915 Ga0501073_0090915_586_1221 210
81 3300049744 Ga0501083_0059432 Ga0501083_0059432_1118_1753 210
82 3300049823 Ga0501044_0125382 Ga0501044_0125382_1835_2470 210
83 3300061719 Ga0466962_0033810 Ga0466962_0033810_291_944 210
84 iso_pu_bacteria 2602042107 2603860910 210
85 iso_pu_bacteria 2893066018 2893069159 210
86 iso_pu_bacteria 2919073203 2919078520 210
87 3300009093 Ga0105240_10017256 Ga0105240_100172563 211
88 3300037466 Ga0395898_0021688 Ga0395898_0021688_306_959 211
89 3300038443 Ga0395901_0001198 Ga0395901_0001198_3040_3693 211
90 3300049570 Ga0501033_0296231 Ga0501033_0296231_472_1113 211
91 3300049574 Ga0501038_0532981 Ga0501038_0532981_219_860 211
92 iso_pu_bacteria 2643221618 2644106340 211
93 iso_pu_bacteria 2643221655 2644308417 211
94 iso_pu_bacteria 2643221659 2644331782 211
95 iso_pu_bacteria 2643221698 2644542162 211
96 iso_pu_bacteria 2643221712 2644615610 211
97 iso_pu_bacteria 2844163670 2844166818 211
98 iso_pu_bacteria 2906626472 2906627331 211
99 iso_pu_bacteria 8016583857 8016594320 211
100 3300025256 Ga0209759_1008305 Ga0209759_10083053 212
101 iso_pu_bacteria 2547132374 2548497194 212
102 iso_pu_bacteria 2643221609 2644060535 212
103 3300028558 Ga0265326_10008052 Ga0265326_100080522 213
104 3300028563 Ga0265319_1027058 Ga0265319_10270581 213
105 3300028573 Ga0265334_10001696 Ga0265334_100016966 213
106 3300028654 Ga0265322_10001590 Ga0265322_100015907 213
107 3300028666 Ga0265336_10000135 Ga0265336_1000013529 213
108 3300028800 Ga0265338_10000034 Ga0265338_10000034177 213
109 iso_pu_bacteria 2895395659 2895395719 213
110 3300005339 Ga0070660_100058223 Ga0070660_1000582233 214
111 3300005340 Ga0070689_100315857 Ga0070689_1003158572 214
112 3300005345 Ga0070692_10017873 Ga0070692_100178734 214
113 3300005438 Ga0070701_10010032 Ga0070701_100100325 214
114 3300005441 Ga0070700_100041671 Ga0070700_1000416712 214
115 3300005457 Ga0070662_100133133 Ga0070662_1001331332 214
116 3300005467 Ga0070706_100213045 Ga0070706_1002130453 214
117 3300005539 Ga0068853_100037059 Ga0068853_1000370595 214
118 3300005545 Ga0070695_100156900 Ga0070695_1001569002 214
119 3300005548 Ga0070665_100091930 Ga0070665_1000919304 214
120 3300005549 Ga0070704_100165446 Ga0070704_1001654463 214
121 3300005563 Ga0068855_100082686 Ga0068855_1000826862 214
122 3300005616 Ga0068852_100039527 Ga0068852_1000395272 214
123 3300005718 Ga0068866_10003204 Ga0068866_100032045 214
124 3300005834 Ga0068851_10002001 Ga0068851_100020019 214
125 3300005834 Ga0068851_10005246 Ga0068851_100052463 214
126 3300005841 Ga0068863_100366435 Ga0068863_1003664352 214
127 3300005842 Ga0068858_100240714 Ga0068858_1002407142 214
128 3300005844 Ga0068862_100308630 Ga0068862_1003086302 214
129 3300006038 Ga0075365_10003306 Ga0075365_100033069 214
130 3300006048 Ga0075363_100051172 Ga0075363_1000511721 214
131 3300006051 Ga0075364_10006610 Ga0075364_100066106 214
132 3300006051 Ga0075364_10444675 Ga0075364_104446751 214
133 3300006178 Ga0075367_10051743 Ga0075367_100517432 214
134 3300006178 Ga0075367_10132026 Ga0075367_101320262 214
135 3300006237 Ga0097621_100154441 Ga0097621_1001544413 214
136 3300006358 Ga0068871_100183479 Ga0068871_1001834792 214
137 3300009093 Ga0105240_10021697 Ga0105240_1002169710 214
138 3300009094 Ga0111539_10022111 Ga0111539_100221113 214
139 3300009174 Ga0105241_10026612 Ga0105241_100266123 214
140 3300009176 Ga0105242_10044092 Ga0105242_100440922 214
141 3300009551 Ga0105238_10002530 Ga0105238_100025305 214
142 3300009551 Ga0105238_10274644 Ga0105238_102746442 214
143 3300010375 Ga0105239_10375509 Ga0105239_103755092 214
144 3300011119 Ga0105246_10033754 Ga0105246_100337545 214
145 3300013297 Ga0157378_10106390 Ga0157378_101063903 214
146 3300013306 Ga0163162_10236550 Ga0163162_102365501 214
147 3300014326 Ga0157380_10046086 Ga0157380_100460862 214
148 3300014968 Ga0157379_10015135 Ga0157379_100151358 214
149 3300014969 Ga0157376_10281386 Ga0157376_102813862 214
150 3300025271 Ga0207666_1002957 Ga0207666_10029573 214
151 3300025295 Ga0209564_1000385 Ga0209564_100038567 214
152 3300025315 Ga0207697_10001936 Ga0207697_1000193612 214
153 3300025321 Ga0207656_10026678 Ga0207656_100266783 214
154 3300025893 Ga0207682_10000740 Ga0207682_1000074012 214
155 3300025899 Ga0207642_10056877 Ga0207642_100568772 214
156 3300025901 Ga0207688_10000602 Ga0207688_100006022 214
157 3300025904 Ga0207647_10093788 Ga0207647_100937882 214
158 3300025908 Ga0207643_10000480 Ga0207643_1000048017 214
159 3300025910 Ga0207684_10407945 Ga0207684_104079452 214
160 3300025911 Ga0207654_10000757 Ga0207654_100007575 214
161 3300025913 Ga0207695_10000424 Ga0207695_1000042413 214
162 3300025918 Ga0207662_10003173 Ga0207662_1000317310 214
163 3300025919 Ga0207657_10008136 Ga0207657_100081369 214
164 3300025924 Ga0207694_10000119 Ga0207694_1000011947 214
165 3300025924 Ga0207694_10232266 Ga0207694_102322662 214
166 3300025931 Ga0207644_10040337 Ga0207644_100403372 214
167 3300025933 Ga0207706_10006029 Ga0207706_100060296 214
168 3300025937 Ga0207669_10464558 Ga0207669_104645581 214
169 3300025938 Ga0207704_10191419 Ga0207704_101914192 214
170 3300025939 Ga0207665_10112100 Ga0207665_101121003 214
171 3300025940 Ga0207691_10067244 Ga0207691_100672443 214
172 3300025949 Ga0207667_10011792 Ga0207667_100117926 214
173 3300025972 Ga0207668_10165862 Ga0207668_101658622 214
174 3300025986 Ga0207658_10092751 Ga0207658_100927513 214
175 3300026035 Ga0207703_10129365 Ga0207703_101293652 214
176 3300026035 Ga0207703_10385564 Ga0207703_103855642 214
177 3300026041 Ga0207639_10274024 Ga0207639_102740242 214
178 3300026067 Ga0207678_10004746 Ga0207678_100047465 214
179 3300026075 Ga0207708_10062938 Ga0207708_100629384 214
180 3300026078 Ga0207702_10000002 Ga0207702_1000000247 214
181 3300026089 Ga0207648_10084202 Ga0207648_100842023 214
182 3300026095 Ga0207676_10043823 Ga0207676_100438233 214
183 3300026116 Ga0207674_10001403 Ga0207674_100014038 214
184 3300026118 Ga0207675_100022204 Ga0207675_1000222046 214
185 3300026121 Ga0207683_10077383 Ga0207683_100773833 214
186 3300026142 Ga0207698_10041407 Ga0207698_100414073 214
187 3300027866 Ga0209813_10015355 Ga0209813_100153552 214
188 3300028379 Ga0268266_10465302 Ga0268266_104653022 214
189 3300028381 Ga0268264_10144795 Ga0268264_101447953 214
190 3300028794 Ga0307515_10197034 Ga0307515_101970341 214
191 3300031616 Ga0307508_10022377 Ga0307508_100223772 214
192 3300033180 Ga0307510_10047128 Ga0307510_100471284 214
193 3300039450 Ga0436363_1095038 Ga0436363_1095038_1397_2047 214
194 3300046460 Ga0495638_0005277 Ga0495638_0005277_7208_7858 214
195 3300046460 Ga0495638_0008841 Ga0495638_0008841_3160_3810 214
196 3300046512 Ga0495610_0020734 Ga0495610_0020734_1061_1711 214
197 3300046513 Ga0495616_0026432 Ga0495616_0026432_882_1532 214
198 3300046522 Ga0495643_0052052 Ga0495643_0052052_488_1138 214
199 3300046524 Ga0495648_0172820 Ga0495648_0172820_358_1008 214
200 3300046539 Ga0495621_0094622 Ga0495621_0094622_403_1047 214
201 3300046557 Ga0495622_0018702 Ga0495622_0018702_2556_3206 214
202 3300046660 Ga0495625_0068896 Ga0495625_0068896_966_1616 214
203 3300046665 Ga0495661_0030247 Ga0495661_0030247_1803_2453 214
204 3300047472 Ga0495686_0011260 Ga0495686_0011260_3861_4511 214
205 3300048091 Ga0495626_0140571 Ga0495626_0140571_310_960 214
206 3300048904 Ga0496101_0067225 Ga0496101_0067225_1373_2017 214
207 3300048909 Ga0496106_0057143 Ga0496106_0057143_344_988 214
208 3300048909 Ga0496106_0099104 Ga0496106_0099104_654_1304 214
209 3300048917 Ga0496114_0035986 Ga0496114_0035986_2545_3189 214
210 3300048919 Ga0496116_0042143 Ga0496116_0042143_989_1639 214
211 3300048920 Ga0496117_0063559 Ga0496117_0063559_1609_2259 214
212 3300048920 Ga0496117_0067523 Ga0496117_0067523_853_1503 214
213 3300048921 Ga0496118_0110798 Ga0496118_0110798_251_901 214
214 3300048923 Ga0496120_0071650 Ga0496120_0071650_940_1590 214
215 3300048924 Ga0496121_0458149 Ga0496121_0458149_91_741 214
216 3300048925 Ga0496122_0069322 Ga0496122_0069322_126_776 214
217 3300048925 Ga0496122_0186045 Ga0496122_0186045_531_1181 214
218 3300048926 Ga0496123_0079188 Ga0496123_0079188_747_1397 214
219 3300048928 Ga0496125_0008234 Ga0496125_0008234_1152_1802 214
220 3300048928 Ga0496125_0225155 Ga0496125_0225155_327_977 214
221 3300048929 Ga0496126_0338925 Ga0496126_0338925_24_674 214
222 3300048929 Ga0496126_0546894 Ga0496126_0546894_102_752 214
223 3300050490 nmdc:mga03n38_10272_c1 nmdc:mga03n38_10272_c1_2189_2839 214
224 3300050490 nmdc:mga03n38_31494_c1 nmdc:mga03n38_31494_c1_1296_1946 214
225 3300050491 nmdc:mga00v17_12825_c1 nmdc:mga00v17_12825_c1_3066_3716 214
226 3300050494 nmdc:mga06z11_126961_c1 nmdc:mga06z11_126961_c1_447_1097 214
227 3300050494 nmdc:mga06z11_46749_c1 nmdc:mga06z11_46749_c1_812_1462 214
228 3300050495 nmdc:mga04h51_10452_c1 nmdc:mga04h51_10452_c1_833_1483 214
229 3300050496 nmdc:mga07m45_18985_c1 nmdc:mga07m45_18985_c1_1407_2057 214
230 3300050512 nmdc:mga0n895_12644_c1 nmdc:mga0n895_12644_c1_4499_5149 214
231 3300053087 Ga0500643_027379 Ga0500643_027379_1075_1725 214
232 3300053088 Ga0500644_0054269 Ga0500644_0054269_429_1079 214
233 3300053089 Ga0500581_083549 Ga0500581_083549_916_1566 214
234 3300053093 Ga0500651_0215295 Ga0500651_0215295_432_1082 214
235 3300053094 Ga0500566_0000370 Ga0500566_0000370_16026_16676 214
236 3300053098 Ga0500650_0000365 Ga0500650_0000365_998_1648 214
237 3300053104 Ga0500556_0000468 Ga0500556_0000468_10907_11557 214
238 3300053108 Ga0500562_017886 Ga0500562_017886_540_1190 214
239 3300053116 Ga0500592_005556 Ga0500592_005556_399_1049 214
240 3300053130 Ga0500642_0000019 Ga0500642_0000019_135030_135680 214
241 3300053134 Ga0500658_0320360 Ga0500658_0320360_26_676 214
242 3300053136 Ga0500559_0001011 Ga0500559_0001011_13156_13806 214
243 3300053139 Ga0500568_0031207 Ga0500568_0031207_515_1165 214
244 3300053148 Ga0500590_087912 Ga0500590_087912_176_826 214
245 3300053153 Ga0500616_0000041 Ga0500616_0000041_17277_17927 214
246 3300053156 Ga0500622_0004419 Ga0500622_0004419_2811_3461 214
247 3300053160 Ga0500633_0052974 Ga0500633_0052974_540_1190 214
248 3300053177 Ga0500636_0130468 Ga0500636_0130468_558_1208 214
249 3300053178 Ga0500637_0086448 Ga0500637_0086448_536_1186 214
250 3300053724 Ga0500570_145243 Ga0500570_145243_184_834 214
251 3300053735 Ga0500596_009332 Ga0500596_009332_59_709 214
252 3300005336 Ga0070680_100673579 Ga0070680_1006735791 215
253 3300005434 Ga0070709_10042323 Ga0070709_100423232 215
254 3300005458 Ga0070681_10625685 Ga0070681_106256851 215
255 3300006173 Ga0070716_100241464 Ga0070716_1002414642 215
256 3300006175 Ga0070712_100000982 Ga0070712_10000098211 215
257 3300009147 Ga0114129_10792718 Ga0114129_107927182 215
258 3300013104 Ga0157370_10506101 Ga0157370_105061011 215
259 3300013296 Ga0157374_10047410 Ga0157374_100474104 215
260 3300025898 Ga0207692_10055970 Ga0207692_100559702 215
261 3300025915 Ga0207693_10000649 Ga0207693_1000064920 215
262 3300025917 Ga0207660_10223068 Ga0207660_102230682 215
263 3300025919 Ga0207657_10008364 Ga0207657_100083647 215
264 3300025928 Ga0207700_10639245 Ga0207700_106392451 215
265 3300025929 Ga0207664_10308198 Ga0207664_103081982 215
266 3300025939 Ga0207665_10000407 Ga0207665_1000040728 215
267 3300025949 Ga0207667_10223197 Ga0207667_102231971 215
268 3300031251 Ga0265327_10000225 Ga0265327_1000022543 215
269 3300031824 Ga0307413_10172782 Ga0307413_101727822 215
270 3300031852 Ga0307410_10183066 Ga0307410_101830662 215
271 3300031911 Ga0307412_10150727 Ga0307412_101507272 215
272 3300031995 Ga0307409_100155556 Ga0307409_1001555562 215
273 3300032004 Ga0307414_10108530 Ga0307414_101085302 215
274 3300032126 Ga0307415_100160608 Ga0307415_1001606082 215
275 3300035691 Ga0373931_0086197 Ga0373931_0086197_379_1074 215
276 3300037471 Ga0395905_0484108 Ga0395905_0484108_314_973 215
277 3300039447 Ga0436361_0687601 Ga0436361_0687601_2249_2902 215
278 3300041512 Ga0451853_0483640 Ga0451853_0483640_61_708 215
279 3300046459 Ga0495629_0056500 Ga0495629_0056500_2044_2703 215
280 3300046472 Ga0495580_0138344 Ga0495580_0138344_871_1542 215
281 3300046674 Ga0495588_0074893 Ga0495588_0074893_948_1595 215
282 3300048924 Ga0496121_0005159 Ga0496121_0005159_15268_15948 215
283 3300050507 nmdc:mga05p37_37524_c1 nmdc:mga05p37_37524_c1_721_1416 215
284 3300053108 Ga0500562_103495 Ga0500562_103495_82_741 215
285 3300053119 Ga0500595_028661 Ga0500595_028661_214_867 215
286 3300060353 Ga0501082_0131831 Ga0501082_0131831_1297_1971 215
287 iso_pu_bacteria 2855730933 2855732075 215
288 iso_pu_bacteria 2855767633 2855768782 215
289 iso_pu_bacteria 2881412998 2881415266 215
290 3300025303 Ga0209051_1031762 Ga0209051_10317622 216
291 3300031730 Ga0307516_10027386 Ga0307516_100273863 216
292 3300048911 Ga0496108_0421362 Ga0496108_0421362_268_918 216
293 3300049578 Ga0501042_0202534 Ga0501042_0202534_449_1120 216
294 3300049587 Ga0501071_0214673 Ga0501071_0214673_289_960 216
295 3300049742 Ga0501080_0142256 Ga0501080_0142256_880_1551 216
296 3300002705 JGI25156J39149_1000212 JGI25156J39149_10002122 217
297 3300002738 JGI25154J39366_1001959 JGI25154J39366_10019592 217
298 3300002741 JGI25157J39369_1000075 JGI25157J39369_100007544 217
299 3300003763 Ga0055529_1001167 Ga0055529_10011676 217
300 3300003792 Ga0055540_1002816 Ga0055540_10028166 217
301 3300005563 Ga0068855_100003502 Ga0068855_10000350219 217
302 3300005563 Ga0068855_100459968 Ga0068855_1004599682 217
303 3300005577 Ga0068857_100272111 Ga0068857_1002721112 217
304 3300006195 Ga0075366_10031342 Ga0075366_100313423 217
305 3300025242 Ga0209258_100162 Ga0209258_100162142 217
306 3300025246 Ga0209646_1000066 Ga0209646_100006644 217
307 3300025250 Ga0209026_1000027 Ga0209026_1000027285 217
308 3300025253 Ga0209677_100128 Ga0209677_10012820 217
309 3300025256 Ga0209759_1000387 Ga0209759_10003876 217
310 3300025256 Ga0209759_1000634 Ga0209759_10006346 217
311 3300025272 Ga0209455_1000128 Ga0209455_10001286 217
312 3300025303 Ga0209051_1000354 Ga0209051_100035414 217
313 3300025949 Ga0207667_10001159 Ga0207667_100011597 217
314 3300025949 Ga0207667_10254931 Ga0207667_102549312 217
315 3300026041 Ga0207639_10574899 Ga0207639_105748992 217
316 3300028666 Ga0265336_10000008 Ga0265336_1000000867 217
317 3300029957 Ga0265324_10004339 Ga0265324_100043392 217
318 3300031730 Ga0307516_10000060 Ga0307516_1000006061 217
319 3300035691 Ga0373931_0008073 Ga0373931_0008073_853_1506 217
320 3300044656 Ga0466969_0024761 Ga0466969_0024761_1394_2056 217
321 3300044683 Ga0466965_0061408 Ga0466965_0061408_445_1107 217
322 3300044693 Ga0466961_0246869 Ga0466961_0246869_410_1072 217
323 3300044694 Ga0466963_0245040 Ga0466963_0245040_390_1043 217
324 3300044719 Ga0466971_0037921 Ga0466971_0037921_25_687 217
325 3300044765 Ga0466970_0009106 Ga0466970_0009106_1567_2229 217
326 3300044842 Ga0466957_0025379 Ga0466957_0025379_2819_3481 217
327 3300044842 Ga0466957_0443819 Ga0466957_0443819_176_829 217
328 3300045976 Ga0466967_0091246 Ga0466967_0091246_1431_2084 217
329 3300046507 Ga0495606_0003759 Ga0495606_0003759_3270_3923 217
330 3300046684 Ga0495669_0033014 Ga0495669_0033014_373_1026 217
331 3300046694 Ga0495649_0000396 Ga0495649_0000396_26590_27243 217
332 3300046794 Ga0495589_0011393 Ga0495589_0011393_1192_1845 217
333 3300047472 Ga0495686_0016769 Ga0495686_0016769_2642_3295 217
334 3300053080 Ga0500635_0011870 Ga0500635_0011870_992_1645 217
335 3300053177 Ga0500636_0075535 Ga0500636_0075535_751_1404 217
336 3300061719 Ga0466962_0006644 Ga0466962_0006644_903_1565 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13532

2OG-FeII_Oxy_2

2OG-Fe(II) oxygenase superfamily

50

242

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bkz-assembly1.cif.gz_A x-ray structure of e coli alkb crosslinked to dsdna in the active site 0.9892 18 215
2fdf-assembly1.cif.gz_A crystal structure of alkb in complex with co(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t 0.9876 18 216
3khc-assembly1.cif.gz_B crystal structure of escherichia coli alkb in complex with ssdna containing a 1-methylguanine lesion 0.9873 14 215
2fdf-assembly1.cif.gz_A crystal structure of alkb in complex with co(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t 0.9827 18 216
4zhn-assembly1.cif.gz_A crystal structure of alkb t208a mutant protein in complex with co(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t 0.9756 18 215
ID Description Score Start End Superfamily
4niiA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9682 18 217 2.60.120.590
4niiA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9493 18 217 2.60.120.590
af_Q13686_178_346_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9043 91 215 2.60.120.590
af_C6TKW1_99_311_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8871 18 214 2.60.120.590
af_A0A1Q0YC58_8_168_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8723 82 215 2.60.120.590
ID Description Score Start End GO Terms
AF-A0A534BW94-F1-model_v4 DNA oxidative demethylase AlkB (EC 1.14.11.33) 0.9992 60 216 GO:0005737
GO:0006281
GO:0008168
GO:0008198
GO:0032259
GO:0035513
GO:0035515
GO:0035516
AF-A0A6I1W1U9-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.9991 49 141 GO:0051213
AF-A0A2W0BF37-F1-model_v4 DNA oxidative demethylase AlkB 0.9974 63 216 GO:0005737
GO:0006281
GO:0008168
GO:0008198
GO:0032259
GO:0035513
GO:0035515
GO:0035516
AF-A0A537DLG2-F1-model_v4 DNA oxidative demethylase AlkB (EC 1.14.11.33) 0.9971 14 216 GO:0005737
GO:0006281
GO:0008168
GO:0008198
GO:0032259
GO:0035513
GO:0035515
GO:0035516
AF-A0A645H2Q6-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB (EC 1.14.11.33) 0.9969 95 216 GO:0005737
GO:0006281
GO:0008198
GO:0016020
GO:0035513
GO:0035515
GO:0035516

Feature Viewer

pLDDT pTM Quality
92.85 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map