F412697

General Info

Members Datasets Scaffolds Average Seq Length
336 189 672 170

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10528379|Ga0207695_105283791
Length 197
Sequence VAQFGRLCESAFTQSKLIANMVASNAFPLDGGCDCRVVRYRMLKPPLFVHCCHCRWCQRESGASFALNAMIEADYVVHLGVEPEITDTPSNSGKGQRIARCPKCRVAIWSNYVGAGPVIRFVRVGTLDAPDHLPPDIHIFTSSKQPWVQLPADIPAVPEYYDRESYWPPESLARRQLILPRIEAYQASLRATPPIAR

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
86 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
138 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
184 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
185 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
186 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
189 2919462493 Variovorax sp. 3319 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.3
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.76
Nodule 0
Rhizoplane 1.19
Rhizosphere 93.45
Stem 0
Stem Tuber 0
Unclassified 3.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10528379 3300025913 Unclassified 1061
2 Ga0055531_10051675 3300003794 Bacteria 1076
3 Ga0065712_10006703 3300005290 Bacteria 3259
4 Ga0070676_10000587 3300005328 Bacteria 17616
5 Ga0070676_10149953 3300005328 Bacteria 1492
6 Ga0070690_100030167 3300005330 Bacteria 3368
7 Ga0070670_100001950 3300005331 Bacteria 16914
8 Ga0070670_100031661 3300005331 Bacteria 4555
9 Ga0070677_10013386 3300005333 Bacteria 2867
10 Ga0070677_10071605 3300005333 Bacteria 1460
11 Ga0070677_10519965 3300005333 Bacteria 648
12 Ga0068869_100004621 3300005334 Bacteria 8588
13 Ga0068869_100098205 3300005334 Bacteria 2212
14 Ga0070666_10004385 3300005335 Bacteria 8596
15 Ga0070666_10016150 3300005335 Bacteria 4772
16 Ga0070666_10181227 3300005335 Bacteria 1477
17 Ga0070680_100018620 3300005336 Bacteria 5490
18 Ga0068868_100004933 3300005338 Bacteria 9373
19 Ga0068868_100016999 3300005338 Bacteria 5412
20 Ga0070660_100226821 3300005339 Bacteria 1519
21 Ga0070661_100182042 3300005344 Bacteria 1599
22 Ga0070661_100894555 3300005344 Bacteria 733
23 Ga0070668_100003653 3300005347 Bacteria 11348
24 Ga0070668_100014315 3300005347 Bacteria 5927
25 Ga0070669_100002397 3300005353 Bacteria 13564
26 Ga0070669_100006936 3300005353 Bacteria 8140
27 Ga0070669_100064240 3300005353 Bacteria 2703
28 Ga0070675_100005672 3300005354 Bacteria 9559
29 Ga0070675_100217300 3300005354 Bacteria 1663
30 Ga0070675_100391487 3300005354 Bacteria 1238
31 Ga0070671_100093577 3300005355 Bacteria 2519
32 Ga0070671_100110729 3300005355 Bacteria 2307
33 Ga0070674_100002030 3300005356 Bacteria 11096
34 Ga0070674_100027159 3300005356 Bacteria 3748
35 Ga0070674_100044524 3300005356 Bacteria 3026
36 Ga0070673_100014503 3300005364 Bacteria 5493
37 Ga0070673_100025508 3300005364 Bacteria 4353
38 Ga0070667_100013783 3300005367 Bacteria 6683
39 Ga0070667_100118962 3300005367 Bacteria 2297
40 Ga0070667_100265814 3300005367 Bacteria 1537
41 Ga0070667_100491832 3300005367 Bacteria 1124
42 Ga0070667_101363488 3300005367 Bacteria 665
43 Ga0070714_100039165 3300005435 Bacteria 3989
44 Ga0070700_100102490 3300005441 Bacteria 1888
45 Ga0070708_100495445 3300005445 Bacteria 1152
46 Ga0070663_100018469 3300005455 Bacteria 4574
47 Ga0070678_100002199 3300005456 Bacteria 10605
48 Ga0070678_100022140 3300005456 Bacteria 4203
49 Ga0070678_100031867 3300005456 Bacteria 3641
50 Ga0070678_100306351 3300005456 Bacteria 1352
51 Ga0070662_100084394 3300005457 Bacteria 2372
52 Ga0070681_10011361 3300005458 Bacteria 8808
53 Ga0068867_100001680 3300005459 Bacteria 15431
54 Ga0068867_100005598 3300005459 Bacteria 8900
55 Ga0068867_101572402 3300005459 Bacteria 614
56 Ga0070697_100111351 3300005536 Bacteria 2282
57 Ga0068853_100083322 3300005539 Bacteria 2802
58 Ga0068853_100142642 3300005539 Bacteria 2151
59 Ga0068853_100377186 3300005539 Bacteria 1324
60 Ga0070672_100003281 3300005543 Bacteria 10476
61 Ga0070672_100012903 3300005543 Bacteria 5887
62 Ga0070686_100952806 3300005544 Bacteria 701
63 Ga0070665_100043396 3300005548 Bacteria 4519
64 Ga0070665_100166565 3300005548 Bacteria 2206
65 Ga0070665_100366906 3300005548 Unclassified 1446
66 Ga0070665_100920817 3300005548 Bacteria 887
67 Ga0068855_100729539 3300005563 Bacteria 1058
68 Ga0070664_100008286 3300005564 Bacteria 8409
69 Ga0070664_100588862 3300005564 Unclassified 1031
70 Ga0068857_101477764 3300005577 Bacteria 662
71 Ga0068854_100129164 3300005578 Bacteria 1927
72 Ga0068852_100049199 3300005616 Bacteria 3605
73 Ga0068859_100012962 3300005617 Bacteria 8376
74 Ga0068859_100019435 3300005617 Bacteria 6823
75 Ga0068859_100761259 3300005617 Bacteria 1057
76 Ga0068864_100024871 3300005618 Bacteria 5038
77 Ga0068864_100318559 3300005618 Unclassified 1460
78 Ga0068864_100967315 3300005618 Unclassified 843
79 Ga0068866_10014971 3300005718 Bacteria 3437
80 Ga0068861_100001583 3300005719 Bacteria 14476
81 Ga0068861_100018637 3300005719 Bacteria 4946
82 Ga0068861_100020066 3300005719 Bacteria 4781
83 Ga0068851_10435434 3300005834 Bacteria 777
84 Ga0068870_10023339 3300005840 Bacteria 3049
85 Ga0068870_10034952 3300005840 Bacteria 2575
86 Ga0068863_100004608 3300005841 Bacteria 13579
87 Ga0068863_100006843 3300005841 Bacteria 11177
88 Ga0068863_100809105 3300005841 Bacteria 935
89 Ga0068858_100001760 3300005842 Bacteria 22084
90 Ga0068858_100005177 3300005842 Bacteria 12772
91 Ga0068860_100001433 3300005843 Bacteria 25834
92 Ga0068860_100002164 3300005843 Bacteria 20700
93 Ga0068862_100046927 3300005844 Bacteria 3685
94 Ga0081455_10000240 3300005937 Bacteria 71150
95 Ga0081455_10228612 3300005937 Bacteria 1374
96 Ga0081538_10031773 3300005981 Bacteria 3552
97 Ga0075364_10065041 3300006051 Bacteria 2394
98 Ga0075366_10177569 3300006195 Bacteria 1293
99 Ga0097621_100003339 3300006237 Bacteria 11041
100 Ga0097621_100482907 3300006237 Bacteria 1120
101 Ga0097621_100532409 3300006237 Bacteria 1068
102 Ga0075370_10003842 3300006353 Bacteria 7189
103 Ga0068871_100005315 3300006358 Bacteria 9021
104 Ga0068871_100206763 3300006358 Bacteria 1697
105 Ga0075428_100019928 3300006844 Bacteria 7428
106 Ga0075428_100411832 3300006844 Bacteria 1448
107 Ga0075430_100019019 3300006846 Bacteria 5843
108 Ga0075430_100350247 3300006846 Bacteria 1220
109 Ga0075431_100002983 3300006847 Bacteria 16384
110 Ga0075431_100187971 3300006847 Bacteria 2117
111 Ga0075433_10047489 3300006852 Bacteria 3734
112 Ga0075434_100037868 3300006871 Bacteria 4775
113 Ga0075429_100027405 3300006880 Bacteria 4945
114 Ga0075429_100430583 3300006880 Bacteria 1156
115 Ga0075429_100588345 3300006880 Bacteria 975
116 Ga0075436_100608179 3300006914 Bacteria 806
117 Ga0097620_100012962 3300006931 Bacteria 8376
118 Ga0097620_100019438 3300006931 Bacteria 6823
119 Ga0097620_100761208 3300006931 Bacteria 1057
120 Ga0075435_100014355 3300007076 Bacteria 5917
121 Ga0111539_12842995 3300009094 Unclassified 561
122 Ga0114129_10348047 3300009147 Bacteria 1964
123 Ga0105243_10019079 3300009148 Bacteria 5200
124 Ga0105243_10243298 3300009148 Bacteria 1602
125 Ga0105241_10036799 3300009174 Bacteria 3684
126 Ga0105242_10029212 3300009176 Bacteria 4394
127 Ga0105242_10086807 3300009176 Bacteria 2626
128 Ga0105242_10897932 3300009176 Bacteria 886
129 Ga0105248_10003651 3300009177 Bacteria 17086
130 Ga0105248_10063604 3300009177 Bacteria 4142
131 Ga0105248_10271245 3300009177 Bacteria 1911
132 Ga0105237_10142536 3300009545 Unclassified 2391
133 Ga0105237_10651267 3300009545 Bacteria 1060
134 Ga0105238_10054823 3300009551 Unclassified 4003
135 Ga0105238_10249417 3300009551 Bacteria 1753
136 Ga0105249_10009522 3300009553 Bacteria 8513
137 Ga0105249_10019560 3300009553 Bacteria 6042
138 Ga0105249_10074056 3300009553 Bacteria 3151
139 Ga0105249_11549360 3300009553 Bacteria 735
140 Ga0099796_10232613 3300010159 Unclassified 759
141 Ga0157370_10180240 3300013104 Bacteria 1963
142 Ga0157374_10003902 3300013296 Bacteria 12522
143 Ga0157378_10037086 3300013297 Bacteria 4317
144 Ga0157378_10194458 3300013297 Bacteria 1915
145 Ga0163162_10099301 3300013306 Bacteria 3002
146 Ga0163162_10183852 3300013306 Unclassified 2217
147 Ga0163162_10261010 3300013306 Bacteria 1864
148 Ga0163162_11822103 3300013306 Bacteria 696
149 Ga0157375_10046194 3300013308 Bacteria 4244
150 Ga0157375_10134638 3300013308 Bacteria 2593
151 Ga0157375_10543085 3300013308 Bacteria 1324
152 Ga0157375_10920718 3300013308 Bacteria 1017
153 Ga0163163_10028020 3300014325 Bacteria 5405
154 Ga0157380_10001135 3300014326 Bacteria 17187
155 Ga0157379_10007130 3300014968 Bacteria 9666
156 Ga0157379_10393353 3300014968 Bacteria 1273
157 Ga0157376_10008447 3300014969 Bacteria 7433
158 Ga0163161_10003504 3300017792 Bacteria 10984
159 Ga0163161_10011861 3300017792 Bacteria 6045
160 Ga0163161_10336738 3300017792 Bacteria 1196
161 Ga0163161_10374960 3300017792 Bacteria 1136
162 Ga0213871_10004268 3300021441 Bacteria 2846
163 Ga0209675_1000522 3300025291 Bacteria 28174
164 Ga0209676_1008851 3300025292 Bacteria 4427
165 Ga0209025_1103712 3300025294 Bacteria 892
166 Ga0209051_1009198 3300025303 Bacteria 5119
167 Ga0209257_1013123 3300025304 Bacteria 3728
168 Ga0207697_10050959 3300025315 Bacteria 1710
169 Ga0207656_10194334 3300025321 Bacteria 978
170 Ga0207653_10344379 3300025885 Bacteria 582
171 Ga0207682_10000964 3300025893 Bacteria 13338
172 Ga0207682_10026706 3300025893 Bacteria 2297
173 Ga0207682_10050646 3300025893 Bacteria 1717
174 Ga0207682_10136379 3300025893 Bacteria 1098
175 Ga0207642_10032834 3300025899 Bacteria 2190
176 Ga0207680_10001218 3300025903 Bacteria 12163
177 Ga0207680_10028053 3300025903 Bacteria 3144
178 Ga0207680_10358067 3300025903 Bacteria 1026
179 Ga0207699_10149838 3300025906 Bacteria 1542
180 Ga0207645_10000997 3300025907 Bacteria 23377
181 Ga0207645_10003743 3300025907 Bacteria 11440
182 Ga0207645_10023179 3300025907 Bacteria 4035
183 Ga0207645_10053856 3300025907 Bacteria 2570
184 Ga0207645_10211328 3300025907 Bacteria 1278
185 Ga0207643_10036671 3300025908 Bacteria 2750
186 Ga0207643_10043728 3300025908 Bacteria 2528
187 Ga0207671_10422682 3300025914 Bacteria 1060
188 Ga0207663_10436744 3300025916 Unclassified 1007
189 Ga0207649_10146070 3300025920 Bacteria 1623
190 Ga0207681_10001759 3300025923 Bacteria 13911
191 Ga0207681_10115755 3300025923 Bacteria 1958
192 Ga0207681_10277059 3300025923 Bacteria 1319
193 Ga0207681_10815280 3300025923 Bacteria 780
194 Ga0207650_10000597 3300025925 Bacteria 28883
195 Ga0207650_10000827 3300025925 Bacteria 23730
196 Ga0207650_10024046 3300025925 Bacteria 4326
197 Ga0207659_10003127 3300025926 Bacteria 9890
198 Ga0207659_10023486 3300025926 Bacteria 4116
199 Ga0207659_10088290 3300025926 Bacteria 2309
200 Ga0207659_10123274 3300025926 Bacteria 1989
201 Ga0207659_10153231 3300025926 Bacteria 1802
202 Ga0207659_10279740 3300025926 Bacteria 1364
203 Ga0207687_10323872 3300025927 Bacteria 1248
204 Ga0207664_10004065 3300025929 Bacteria 9856
205 Ga0207644_10073942 3300025931 Bacteria 2500
206 Ga0207644_10076569 3300025931 Bacteria 2461
207 Ga0207690_10420546 3300025932 Bacteria 1069
208 Ga0207706_10067409 3300025933 Bacteria 3148
209 Ga0207706_10152315 3300025933 Bacteria 2034
210 Ga0207706_10762074 3300025933 Bacteria 824
211 Ga0207686_10286353 3300025934 Bacteria 1218
212 Ga0207686_10787845 3300025934 Bacteria 761
213 Ga0207709_10076849 3300025935 Bacteria 2138
214 Ga0207669_10332077 3300025937 Bacteria 1167
215 Ga0207704_10001647 3300025938 Bacteria 10023
216 Ga0207691_10002769 3300025940 Bacteria 17084
217 Ga0207691_10015569 3300025940 Bacteria 7230
218 Ga0207691_10033951 3300025940 Bacteria 4749
219 Ga0207691_10067838 3300025940 Bacteria 3224
220 Ga0207691_10223840 3300025940 Bacteria 1631
221 Ga0207711_10010992 3300025941 Bacteria 7521
222 Ga0207711_10101401 3300025941 Bacteria 2547
223 Ga0207689_10001598 3300025942 Bacteria 21447
224 Ga0207689_10007936 3300025942 Bacteria 9271
225 Ga0207689_10066507 3300025942 Bacteria 2963
226 Ga0207689_10763731 3300025942 Bacteria 816
227 Ga0207679_10003470 3300025945 Bacteria 9743
228 Ga0207679_10194100 3300025945 Bacteria 1691
229 Ga0207651_10014400 3300025960 Bacteria 4564
230 Ga0207651_10038120 3300025960 Bacteria 3155
231 Ga0207651_10141051 3300025960 Bacteria 1861
232 Ga0207651_10268948 3300025960 Bacteria 1403
233 Ga0207712_10005181 3300025961 Bacteria 8251
234 Ga0207668_10001592 3300025972 Bacteria 13253
235 Ga0207668_10011891 3300025972 Bacteria 5308
236 Ga0207668_10025513 3300025972 Bacteria 3826
237 Ga0207668_10165499 3300025972 Bacteria 1728
238 Ga0207658_10002123 3300025986 Bacteria 14734
239 Ga0207658_10002849 3300025986 Bacteria 12386
240 Ga0207658_10010616 3300025986 Bacteria 6259
241 Ga0207658_10335785 3300025986 Bacteria 1312
242 Ga0207658_10388340 3300025986 Bacteria 1224
243 Ga0207658_10641512 3300025986 Bacteria 957
244 Ga0207677_10236645 3300026023 Bacteria 1475
245 Ga0207677_11306416 3300026023 Bacteria 666
246 Ga0207703_10001350 3300026035 Bacteria 22464
247 Ga0207703_10004578 3300026035 Bacteria 11334
248 Ga0207703_10252565 3300026035 Bacteria 1590
249 Ga0207639_10045289 3300026041 Bacteria 3312
250 Ga0207678_10696018 3300026067 Bacteria 894
251 Ga0207708_10134927 3300026075 Bacteria 1932
252 Ga0207702_10773999 3300026078 Bacteria 948
253 Ga0207641_10001705 3300026088 Bacteria 21390
254 Ga0207641_10002757 3300026088 Bacteria 16029
255 Ga0207648_10002091 3300026089 Bacteria 21749
256 Ga0207648_10003315 3300026089 Bacteria 16908
257 Ga0207648_10840385 3300026089 Bacteria 856
258 Ga0207676_10169520 3300026095 Bacteria 1900
259 Ga0207676_10510591 3300026095 Unclassified 1143
260 Ga0207676_10729847 3300026095 Bacteria 962
261 Ga0207675_100006494 3300026118 Bacteria 11063
262 Ga0207675_100023319 3300026118 Bacteria 5756
263 Ga0207675_100031791 3300026118 Bacteria 4917
264 Ga0207675_101086566 3300026118 Unclassified 820
265 Ga0207683_10000250 3300026121 Bacteria 48026
266 Ga0207683_10011765 3300026121 Bacteria 7468
267 Ga0207683_10021658 3300026121 Bacteria 5508
268 Ga0207683_10036799 3300026121 Bacteria 4262
269 Ga0207683_10050787 3300026121 Bacteria 3633
270 Ga0207683_10051584 3300026121 Bacteria 3604
271 Ga0207683_10183789 3300026121 Bacteria 1896
272 Ga0207698_10065165 3300026142 Bacteria 2860
273 Ga0268266_10858833 3300028379 Bacteria 877
274 Ga0268266_10888451 3300028379 Bacteria 862
275 Ga0268264_10005288 3300028381 Bacteria 10932
276 Ga0268264_10013358 3300028381 Bacteria 6758
277 Ga0268264_10321286 3300028381 Bacteria 1464
278 Ga0265334_10032257 3300028573 Bacteria 2090
279 Ga0265762_1009845 3300030760 Bacteria 1707
280 Ga0265332_10035893 3300031238 Bacteria 2152
281 Ga0265325_10034472 3300031241 Bacteria 2692
282 Ga0265329_10006199 3300031242 Bacteria 4764
283 Ga0265331_10005110 3300031250 Bacteria 8000
284 Ga0265331_10007245 3300031250 Bacteria 6433
285 Ga0265327_10011878 3300031251 Bacteria 5948
286 Ga0265316_10046862 3300031344 Bacteria 3422
287 Ga0265314_10030399 3300031711 Bacteria 3998
288 Ga0265314_10037071 3300031711 Bacteria 3536
289 Ga0316578_10204300 3300031728 Bacteria 1189
290 Ga0307416_101198260 3300032002 Bacteria 865
291 Ga0307510_10023830 3300033180 Bacteria 7087
292 Ga0373954_0124485 3300035118 Bacteria 1253
293 Ga0373957_0301649 3300035120 Bacteria 679
294 Ga0373943_0159778 3300035170 Bacteria 1226
295 Ga0373943_0501632 3300035170 Bacteria 709
296 Ga0373935_0025235 3300035692 Bacteria 3663
297 Ga0373927_0207245 3300035695 Bacteria 1288
298 Ga0373925_0673783 3300037068 Bacteria 852
299 Ga0373925_0957848 3300037068 Bacteria 705
300 Ga0395905_0128429 3300037471 Bacteria 2384
301 Ga0436360_0824698 3300039438 Bacteria 14081
302 Ga0436361_0544814 3300039447 Bacteria 2016
303 Ga0436363_0448141 3300039450 Bacteria 3515
304 Ga0451577_0480230 3300042876 Bacteria 1128
305 Ga0453684_0140599 3300044712 Bacteria 2883
306 Ga0453684_0244883 3300044712 Bacteria 2062
307 Ga0495580_0735690 3300046472 Bacteria 643
308 Ga0495598_0047205 3300046537 Bacteria 1283
309 Ga0495621_0141073 3300046539 Bacteria 943
310 Ga0495659_0254855 3300046664 Bacteria 732
311 Ga0495658_0019274 3300046683 Bacteria 3558
312 Ga0495636_0016844 3300047318 Bacteria 2923
313 Ga0495684_0088207 3300047471 Bacteria 2351
314 Ga0496105_0289566 3300048908 Bacteria 1319
315 Ga0496109_0050852 3300048912 Bacteria 3774
316 Ga0496111_0073451 3300048914 Bacteria 2491
317 Ga0496112_0628300 3300048915 Bacteria 1005
318 Ga0501071_0535604 3300049587 Bacteria 899
319 Ga0501076_0293705 3300049592 Bacteria 1332
320 nmdc:mga03n38_15516_c1 3300050490 Bacteria 2943
321 nmdc:mga0k408_255696_c1 3300050493 Bacteria 1046
322 nmdc:mga07m45_4465_c1 3300050496 Bacteria 6844
323 nmdc:mga09592_687756_c1 3300050508 Bacteria 871
324 nmdc:mga06r32_183473_c1 3300050510 Bacteria 2079
325 nmdc:mga08y16_921159_c1 3300050511 Bacteria 859
326 nmdc:mga0rr50_1045667_c1 3300050513 Bacteria 695
327 nmdc:mga08x19_1201115_c1 3300050514 Bacteria 538
328 nmdc:mga0a205_129675_c1 3300050515 Bacteria 2422
329 Ga0500566_0095453 3300053094 Bacteria 1638
330 Ga0500641_0000294 3300053096 Bacteria 18684
331 Ga0500604_0118223 3300053151 Bacteria 885
332 Ga0500661_001844 3300055283 Bacteria 4001
333 Ga0501082_0152191 3300060353 Bacteria 2010
334 Ga0530510_0429830 3300061734 Bacteria 997
335 Ga0530510_0618446 3300061734 Bacteria 824
336 2919465526 2919462493 Bacteria 5817112
337 Ga0207695_10528379
338 Ga0055531_10051675
339 Ga0065712_10006703
340 Ga0070676_10000587
341 Ga0070676_10149953
342 Ga0070690_100030167
343 Ga0070670_100001950
344 Ga0070670_100031661
345 Ga0070677_10013386
346 Ga0070677_10071605
347 Ga0070677_10519965
348 Ga0068869_100004621
349 Ga0068869_100098205
350 Ga0070666_10004385
351 Ga0070666_10016150
352 Ga0070666_10181227
353 Ga0070680_100018620
354 Ga0068868_100004933
355 Ga0068868_100016999
356 Ga0070660_100226821
357 Ga0070661_100182042
358 Ga0070661_100894555
359 Ga0070668_100003653
360 Ga0070668_100014315
361 Ga0070669_100002397
362 Ga0070669_100006936
363 Ga0070669_100064240
364 Ga0070675_100005672
365 Ga0070675_100217300
366 Ga0070675_100391487
367 Ga0070671_100093577
368 Ga0070671_100110729
369 Ga0070674_100002030
370 Ga0070674_100027159
371 Ga0070674_100044524
372 Ga0070673_100014503
373 Ga0070673_100025508
374 Ga0070667_100013783
375 Ga0070667_100118962
376 Ga0070667_100265814
377 Ga0070667_100491832
378 Ga0070667_101363488
379 Ga0070714_100039165
380 Ga0070700_100102490
381 Ga0070708_100495445
382 Ga0070663_100018469
383 Ga0070678_100002199
384 Ga0070678_100022140
385 Ga0070678_100031867
386 Ga0070678_100306351
387 Ga0070662_100084394
388 Ga0070681_10011361
389 Ga0068867_100001680
390 Ga0068867_100005598
391 Ga0068867_101572402
392 Ga0070697_100111351
393 Ga0068853_100083322
394 Ga0068853_100142642
395 Ga0068853_100377186
396 Ga0070672_100003281
397 Ga0070672_100012903
398 Ga0070686_100952806
399 Ga0070665_100043396
400 Ga0070665_100166565
401 Ga0070665_100366906
402 Ga0070665_100920817
403 Ga0068855_100729539
404 Ga0070664_100008286
405 Ga0070664_100588862
406 Ga0068857_101477764
407 Ga0068854_100129164
408 Ga0068852_100049199
409 Ga0068859_100012962
410 Ga0068859_100019435
411 Ga0068859_100761259
412 Ga0068864_100024871
413 Ga0068864_100318559
414 Ga0068864_100967315
415 Ga0068866_10014971
416 Ga0068861_100001583
417 Ga0068861_100018637
418 Ga0068861_100020066
419 Ga0068851_10435434
420 Ga0068870_10023339
421 Ga0068870_10034952
422 Ga0068863_100004608
423 Ga0068863_100006843
424 Ga0068863_100809105
425 Ga0068858_100001760
426 Ga0068858_100005177
427 Ga0068860_100001433
428 Ga0068860_100002164
429 Ga0068862_100046927
430 Ga0081455_10000240
431 Ga0081455_10228612
432 Ga0081538_10031773
433 Ga0075364_10065041
434 Ga0075366_10177569
435 Ga0097621_100003339
436 Ga0097621_100482907
437 Ga0097621_100532409
438 Ga0075370_10003842
439 Ga0068871_100005315
440 Ga0068871_100206763
441 Ga0075428_100019928
442 Ga0075428_100411832
443 Ga0075430_100019019
444 Ga0075430_100350247
445 Ga0075431_100002983
446 Ga0075431_100187971
447 Ga0075433_10047489
448 Ga0075434_100037868
449 Ga0075429_100027405
450 Ga0075429_100430583
451 Ga0075429_100588345
452 Ga0075436_100608179
453 Ga0097620_100012962
454 Ga0097620_100019438
455 Ga0097620_100761208
456 Ga0075435_100014355
457 Ga0111539_12842995
458 Ga0114129_10348047
459 Ga0105243_10019079
460 Ga0105243_10243298
461 Ga0105241_10036799
462 Ga0105242_10029212
463 Ga0105242_10086807
464 Ga0105242_10897932
465 Ga0105248_10003651
466 Ga0105248_10063604
467 Ga0105248_10271245
468 Ga0105237_10142536
469 Ga0105237_10651267
470 Ga0105238_10054823
471 Ga0105238_10249417
472 Ga0105249_10009522
473 Ga0105249_10019560
474 Ga0105249_10074056
475 Ga0105249_11549360
476 Ga0099796_10232613
477 Ga0157370_10180240
478 Ga0157374_10003902
479 Ga0157378_10037086
480 Ga0157378_10194458
481 Ga0163162_10099301
482 Ga0163162_10183852
483 Ga0163162_10261010
484 Ga0163162_11822103
485 Ga0157375_10046194
486 Ga0157375_10134638
487 Ga0157375_10543085
488 Ga0157375_10920718
489 Ga0163163_10028020
490 Ga0157380_10001135
491 Ga0157379_10007130
492 Ga0157379_10393353
493 Ga0157376_10008447
494 Ga0163161_10003504
495 Ga0163161_10011861
496 Ga0163161_10336738
497 Ga0163161_10374960
498 Ga0213871_10004268
499 Ga0209675_1000522
500 Ga0209676_1008851
501 Ga0209025_1103712
502 Ga0209051_1009198
503 Ga0209257_1013123
504 Ga0207697_10050959
505 Ga0207656_10194334
506 Ga0207653_10344379
507 Ga0207682_10000964
508 Ga0207682_10026706
509 Ga0207682_10050646
510 Ga0207682_10136379
511 Ga0207642_10032834
512 Ga0207680_10001218
513 Ga0207680_10028053
514 Ga0207680_10358067
515 Ga0207699_10149838
516 Ga0207645_10000997
517 Ga0207645_10003743
518 Ga0207645_10023179
519 Ga0207645_10053856
520 Ga0207645_10211328
521 Ga0207643_10036671
522 Ga0207643_10043728
523 Ga0207671_10422682
524 Ga0207663_10436744
525 Ga0207649_10146070
526 Ga0207681_10001759
527 Ga0207681_10115755
528 Ga0207681_10277059
529 Ga0207681_10815280
530 Ga0207650_10000597
531 Ga0207650_10000827
532 Ga0207650_10024046
533 Ga0207659_10003127
534 Ga0207659_10023486
535 Ga0207659_10088290
536 Ga0207659_10123274
537 Ga0207659_10153231
538 Ga0207659_10279740
539 Ga0207687_10323872
540 Ga0207664_10004065
541 Ga0207644_10073942
542 Ga0207644_10076569
543 Ga0207690_10420546
544 Ga0207706_10067409
545 Ga0207706_10152315
546 Ga0207706_10762074
547 Ga0207686_10286353
548 Ga0207686_10787845
549 Ga0207709_10076849
550 Ga0207669_10332077
551 Ga0207704_10001647
552 Ga0207691_10002769
553 Ga0207691_10015569
554 Ga0207691_10033951
555 Ga0207691_10067838
556 Ga0207691_10223840
557 Ga0207711_10010992
558 Ga0207711_10101401
559 Ga0207689_10001598
560 Ga0207689_10007936
561 Ga0207689_10066507
562 Ga0207689_10763731
563 Ga0207679_10003470
564 Ga0207679_10194100
565 Ga0207651_10014400
566 Ga0207651_10038120
567 Ga0207651_10141051
568 Ga0207651_10268948
569 Ga0207712_10005181
570 Ga0207668_10001592
571 Ga0207668_10011891
572 Ga0207668_10025513
573 Ga0207668_10165499
574 Ga0207658_10002123
575 Ga0207658_10002849
576 Ga0207658_10010616
577 Ga0207658_10335785
578 Ga0207658_10388340
579 Ga0207658_10641512
580 Ga0207677_10236645
581 Ga0207677_11306416
582 Ga0207703_10001350
583 Ga0207703_10004578
584 Ga0207703_10252565
585 Ga0207639_10045289
586 Ga0207678_10696018
587 Ga0207708_10134927
588 Ga0207702_10773999
589 Ga0207641_10001705
590 Ga0207641_10002757
591 Ga0207648_10002091
592 Ga0207648_10003315
593 Ga0207648_10840385
594 Ga0207676_10169520
595 Ga0207676_10510591
596 Ga0207676_10729847
597 Ga0207675_100006494
598 Ga0207675_100023319
599 Ga0207675_100031791
600 Ga0207675_101086566
601 Ga0207683_10000250
602 Ga0207683_10011765
603 Ga0207683_10021658
604 Ga0207683_10036799
605 Ga0207683_10050787
606 Ga0207683_10051584
607 Ga0207683_10183789
608 Ga0207698_10065165
609 Ga0268266_10858833
610 Ga0268266_10888451
611 Ga0268264_10005288
612 Ga0268264_10013358
613 Ga0268264_10321286
614 Ga0265334_10032257
615 Ga0265762_1009845
616 Ga0265332_10035893
617 Ga0265325_10034472
618 Ga0265329_10006199
619 Ga0265331_10005110
620 Ga0265331_10007245
621 Ga0265327_10011878
622 Ga0265316_10046862
623 Ga0265314_10030399
624 Ga0265314_10037071
625 Ga0316578_10204300
626 Ga0307416_101198260
627 Ga0307510_10023830
628 Ga0373954_0124485
629 Ga0373957_0301649
630 Ga0373943_0159778
631 Ga0373943_0501632
632 Ga0373935_0025235
633 Ga0373927_0207245
634 Ga0373925_0673783
635 Ga0373925_0957848
636 Ga0395905_0128429
637 Ga0436360_0824698
638 Ga0436361_0544814
639 Ga0436363_0448141
640 Ga0451577_0480230
641 Ga0453684_0140599
642 Ga0453684_0244883
643 Ga0495580_0735690
644 Ga0495598_0047205
645 Ga0495621_0141073
646 Ga0495659_0254855
647 Ga0495658_0019274
648 Ga0495636_0016844
649 Ga0495684_0088207
650 Ga0496105_0289566
651 Ga0496109_0050852
652 Ga0496111_0073451
653 Ga0496112_0628300
654 Ga0501071_0535604
655 Ga0501076_0293705
656 nmdc:mga03n38_15516_c1
657 nmdc:mga0k408_255696_c1
658 nmdc:mga07m45_4465_c1
659 nmdc:mga09592_687756_c1
660 nmdc:mga06r32_183473_c1
661 nmdc:mga08y16_921159_c1
662 nmdc:mga0rr50_1045667_c1
663 nmdc:mga08x19_1201115_c1
664 nmdc:mga0a205_129675_c1
665 Ga0500566_0095453
666 Ga0500641_0000294
667 Ga0500604_0118223
668 Ga0500661_001844
669 Ga0501082_0152191
670 Ga0530510_0429830
671 Ga0530510_0618446
672 2919465526

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

50

143

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8469 7 142
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.7762 7 142
4zgr-assembly1.cif.gz_A structural studies on a non-toxic homologue of type ii rips from momordica charantia (bitter gourd) in complex with t-antigen. 0.7719 62 93
5sv3-assembly2.cif.gz_D rta1-33/44-198 (rvec) bound to single domain antibody a3c8 0.7545 62 91
1mom-assembly1.cif.gz_A crystal structure of momordin, a type i ribosome inactivating protein from the seeds of momordica charantia 0.7429 61 91
ID Description Score Start End Superfamily
af_Q4CKB7_124_268_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.756 62 92 2.130.10.10
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.7476 7 140 3.90.1590.10
af_A0A0P0W298_97_213_3.40.420.10 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.73 62 95 3.40.420.10
af_P76402_1_110_2.30.29.80 Mainly Beta;Roll;PH-domain like; 0.7283 62 92 2.30.29.80
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7212 10 108 2.170.150.70
ID Description Score Start End GO Terms
AF-A0A422QX46-F1-model_v4 GFA family protein 0.9667 7 160 GO:0016846
GO:0046872
AF-A0A4P8J2G6-F1-model_v4 GFA family protein 0.9643 6 163 GO:0016846
GO:0046872
AF-A0A6M4GWV9-F1-model_v4 CENP-V/GFA domain-containing protein 0.9637 7 158 GO:0016846
GO:0046872
AF-A0A0R3M6V1-F1-model_v4 Aldehyde-activating protein 0.9623 10 163 GO:0016846
GO:0046872
AF-A0A6P1T209-F1-model_v4 Aldehyde-activating protein 0.962 10 161 GO:0016846
GO:0046872

Map