F412704

General Info

Members Datasets Scaffolds Average Seq Length
336 126 672 171

Family's Representative Sequence

Representative Sequence 3300025926|Ga0207659_10188056|Ga0207659_101880562
Length 203
Sequence LRGTAGRFAWANGPDKRAGDVEMIATGTAAVKAVAKPPTDDKRWRIVEAAMRRQGYDVHAVIESLHAVQQAFGFIDDKSMRYVAESLQVPVSKVYGVATFYHYFTLKPQGKHACIVCLGTACYIKGSGDMLRQVEAKYNIKEGQTTEDGELSLLAARCIGACGLAPAAVLDGDVLGKGTASELIEKIETKLAIGSGVSGGVAK

Samples

Sample ID Description Type Environment
1 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
7 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
8 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
9 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
10 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
11 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
12 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
13 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
14 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
15 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
16 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
17 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
18 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
19 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
20 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
21 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
22 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
32 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
33 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
34 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
35 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
36 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
37 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
38 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
39 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
40 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
41 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
42 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
43 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
44 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
45 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
46 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
47 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
48 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
49 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
50 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
51 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
52 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
53 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
54 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
55 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
56 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
57 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
58 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
59 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
60 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
61 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
68 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
69 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
70 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
71 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
72 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
73 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
78 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
81 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
82 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
83 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
84 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
93 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
96 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
99 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
110 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
111 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
126 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.35
Metatranscriptomes 5.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.3
Rhizosphere 99.4
Stem 0
Stem Tuber 0
Unclassified 11.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207659_10188056 3300025926 Bacteria 1641
2 rootH2_10000692 3300003320 Bacteria 7537
3 Ga0070689_100217747 3300005340 Unclassified 1565
4 Ga0070675_100038052 3300005354 Bacteria 3920
5 Ga0070711_100467977 3300005439 Unclassified 1034
6 Ga0068855_100283167 3300005563 Bacteria 1840
7 Ga0068863_100247563 3300005841 Bacteria 1721
8 Ga0070717_10146793 3300006028 Bacteria 2038
9 Ga0070712_101138911 3300006175 Bacteria 678
10 Ga0075428_100029890 3300006844 Bacteria 6026
11 Ga0075430_100004015 3300006846 Bacteria 12411
12 Ga0075434_100383401 3300006871 Bacteria 1426
13 Ga0105240_10005659 3300009093 Bacteria 18545
14 Ga0105240_10261541 3300009093 Bacteria 1996
15 Ga0105240_10492143 3300009093 Unclassified 1365
16 Ga0105248_10384729 3300009177 Bacteria 1580
17 Ga0105248_11332537 3300009177 Unclassified 812
18 Ga0105249_10451651 3300009553 Unclassified 1324
19 Ga0163162_11184485 3300013306 Unclassified 867
20 Ga0163162_12726540 3300013306 Unclassified 569
21 Ga0157372_11030885 3300013307 Unclassified 953
22 Ga0163163_10119668 3300014325 Bacteria 2666
23 Ga0157376_10141370 3300014969 Bacteria 2160
24 Ga0157376_10907330 3300014969 Bacteria 899
25 Ga0163161_10498276 3300017792 Unclassified 991
26 Ga0213872_10002439 3300021361 Bacteria 10937
27 Ga0213872_10257560 3300021361 Bacteria 733
28 Ga0207695_10469101 3300025913 Bacteria 1141
29 Ga0207695_10855674 3300025913 Bacteria 789
30 Ga0207663_10694479 3300025916 Bacteria 805
31 Ga0207694_10383189 3300025924 Bacteria 1167
32 Ga0207670_10207675 3300025936 Unclassified 1491
33 Ga0207711_11421586 3300025941 Unclassified 636
34 Ga0207702_10261648 3300026078 Bacteria 1629
35 Ga0207641_10223287 3300026088 Bacteria 1748
36 Ga0268266_10096746 3300028379 Bacteria 2596
37 Ga0268264_10549717 3300028381 Bacteria 1132
38 Ga0265337_1000980 3300028556 Bacteria 14955
39 Ga0265337_1004843 3300028556 Bacteria 5504
40 Ga0265337_1006055 3300028556 Bacteria 4717
41 Ga0265337_1006312 3300028556 Bacteria 4590
42 Ga0265326_10010027 3300028558 Bacteria 2822
43 Ga0265326_10018242 3300028558 Bacteria 2020
44 Ga0265326_10055529 3300028558 Unclassified 1120
45 Ga0265319_1000007 3300028563 Bacteria 217194
46 Ga0265319_1010701 3300028563 Bacteria 3813
47 Ga0265319_1011417 3300028563 Bacteria 3638
48 Ga0265319_1015892 3300028563 Bacteria 2899
49 Ga0265319_1023162 3300028563 Bacteria 2252
50 Ga0265319_1024215 3300028563 Bacteria 2188
51 Ga0265319_1049999 3300028563 Bacteria 1382
52 Ga0265334_10003156 3300028573 Bacteria 7522
53 Ga0265334_10014353 3300028573 Bacteria 3303
54 Ga0265318_10000034 3300028577 Bacteria 143153
55 Ga0265318_10000102 3300028577 Bacteria 79573
56 Ga0265318_10006045 3300028577 Bacteria 5612
57 Ga0265318_10053423 3300028577 Bacteria 1515
58 Ga0265323_10051872 3300028653 Bacteria 1453
59 Ga0265336_10004796 3300028666 Bacteria 5068
60 Ga0265338_10000016 3300028800 Bacteria 347424
61 Ga0265338_10000150 3300028800 Bacteria 126424
62 Ga0265338_10000198 3300028800 Bacteria 113584
63 Ga0265338_10000243 3300028800 Bacteria 100885
64 Ga0265338_10004648 3300028800 Bacteria 18444
65 Ga0265338_10006448 3300028800 Bacteria 14958
66 Ga0265338_10014568 3300028800 Bacteria 8735
67 Ga0265338_10019673 3300028800 Bacteria 7145
68 Ga0265338_10029221 3300028800 Bacteria 5470
69 Ga0265338_10031083 3300028800 Bacteria 5242
70 Ga0265338_10056401 3300028800 Bacteria 3484
71 Ga0265338_10142706 3300028800 Bacteria 1873
72 Ga0265338_10406646 3300028800 Unclassified 969
73 Ga0265324_10004263 3300029957 Bacteria 6531
74 Ga0265324_10007175 3300029957 Bacteria 4549
75 Ga0265324_10009180 3300029957 Bacteria 3875
76 Ga0265324_10070666 3300029957 Unclassified 1189
77 Ga0265332_10011122 3300031238 Bacteria 4000
78 Ga0265332_10055368 3300031238 Bacteria 1700
79 Ga0265332_10203311 3300031238 Bacteria 823
80 Ga0265328_10062595 3300031239 Bacteria 1366
81 Ga0265320_10000367 3300031240 Bacteria 36497
82 Ga0265320_10001362 3300031240 Bacteria 17820
83 Ga0265320_10001983 3300031240 Bacteria 14441
84 Ga0265320_10005693 3300031240 Bacteria 7951
85 Ga0265320_10015743 3300031240 Bacteria 4263
86 Ga0265320_10053116 3300031240 Bacteria 1959
87 Ga0265320_10088373 3300031240 Bacteria 1438
88 Ga0265320_10126792 3300031240 Bacteria 1161
89 Ga0265320_10128963 3300031240 Bacteria 1149
90 Ga0265325_10005882 3300031241 Bacteria 7517
91 Ga0265325_10017957 3300031241 Bacteria 3928
92 Ga0265325_10020855 3300031241 Bacteria 3607
93 Ga0265325_10144613 3300031241 Bacteria 1128
94 Ga0265329_10034555 3300031242 Bacteria 1633
95 Ga0265340_10001343 3300031247 Bacteria 14104
96 Ga0265340_10031209 3300031247 Bacteria 2666
97 Ga0265340_10120008 3300031247 Unclassified 1210
98 Ga0265339_10005735 3300031249 Bacteria 8246
99 Ga0265339_10009212 3300031249 Bacteria 6225
100 Ga0265339_10062363 3300031249 Bacteria 2004
101 Ga0265339_10128563 3300031249 Bacteria 1297
102 Ga0265339_10207227 3300031249 Unclassified 964
103 Ga0265339_10455675 3300031249 Bacteria 593
104 Ga0265331_10045511 3300031250 Bacteria 2119
105 Ga0265331_10094557 3300031250 Bacteria 1379
106 Ga0265327_10000092 3300031251 Bacteria 195619
107 Ga0265327_10000966 3300031251 Bacteria 41122
108 Ga0265327_10001868 3300031251 Bacteria 24383
109 Ga0265316_10041939 3300031344 Bacteria 3659
110 Ga0265316_10104468 3300031344 Bacteria 2150
111 Ga0265316_10117383 3300031344 Bacteria 2011
112 Ga0265316_10163542 3300031344 Bacteria 1663
113 Ga0265316_10263619 3300031344 Bacteria 1263
114 Ga0265316_10279268 3300031344 Bacteria 1220
115 Ga0265316_10284232 3300031344 Bacteria 1208
116 Ga0265316_10351219 3300031344 Bacteria 1068
117 Ga0265316_10430303 3300031344 Unclassified 948
118 Ga0265316_10606108 3300031344 Bacteria 776
119 Ga0265313_10004583 3300031595 Bacteria 10516
120 Ga0265313_10008236 3300031595 Bacteria 6959
121 Ga0265313_10015634 3300031595 Bacteria 4406
122 Ga0265313_10019845 3300031595 Bacteria 3727
123 Ga0316575_10006847 3300031665 Bacteria 4120
124 Ga0316575_10036673 3300031665 Bacteria 1929
125 Ga0316575_10109516 3300031665 Bacteria 1126
126 Ga0316579_10000467 3300031691 Bacteria 13066
127 Ga0316579_10002202 3300031691 Bacteria 7340
128 Ga0316579_10009209 3300031691 Bacteria 4146
129 Ga0316579_10038426 3300031691 Bacteria 2213
130 Ga0316579_10099145 3300031691 Bacteria 1394
131 Ga0265314_10001931 3300031711 Bacteria 22152
132 Ga0265314_10002132 3300031711 Bacteria 20745
133 Ga0265314_10077002 3300031711 Bacteria 2214
134 Ga0265314_10088561 3300031711 Bacteria 2021
135 Ga0265314_10153542 3300031711 Bacteria 1409
136 Ga0265342_10013266 3300031712 Bacteria 5539
137 Ga0265342_10097287 3300031712 Bacteria 1681
138 Ga0265342_10161209 3300031712 Bacteria 1239
139 Ga0316576_10000271 3300031727 Bacteria 22695
140 Ga0316576_10003571 3300031727 Bacteria 9159
141 Ga0316576_10021484 3300031727 Bacteria 4465
142 Ga0316576_10025227 3300031727 Bacteria 4160
143 Ga0316576_10038989 3300031727 Bacteria 3409
144 Ga0316576_10046361 3300031727 Bacteria 3145
145 Ga0316576_10050622 3300031727 Bacteria 3021
146 Ga0316576_10066263 3300031727 Bacteria 2655
147 Ga0316576_10104621 3300031727 Bacteria 2118
148 Ga0316576_10177195 3300031727 Bacteria 1608
149 Ga0316576_10237369 3300031727 Bacteria 1370
150 Ga0316576_10345315 3300031727 Bacteria 1108
151 Ga0316578_10000044 3300031728 Bacteria 25781
152 Ga0316578_10003377 3300031728 Bacteria 7285
153 Ga0316578_10016683 3300031728 Bacteria 3981
154 Ga0316578_10022055 3300031728 Bacteria 3544
155 Ga0316578_10038380 3300031728 Bacteria 2761
156 Ga0316578_10046512 3300031728 Bacteria 2529
157 Ga0316578_10071441 3300031728 Bacteria 2055
158 Ga0316578_10146866 3300031728 Bacteria 1420
159 Ga0316577_10000086 3300031733 Bacteria 24604
160 Ga0316577_10000839 3300031733 Bacteria 13408
161 Ga0316577_10011359 3300031733 Bacteria 4823
162 Ga0316577_10018915 3300031733 Bacteria 3812
163 Ga0316577_10212698 3300031733 Bacteria 1093
164 Ga0316577_10263357 3300031733 Bacteria 975
165 Ga0316577_10381623 3300031733 Bacteria 800
166 Ga0316577_10476061 3300031733 Bacteria 710
167 Ga0316583_10028220 3300032133 Bacteria 2002
168 Ga0316583_10037842 3300032133 Bacteria 1711
169 Ga0316583_10244423 3300032133 Bacteria 622
170 Ga0316585_10000011 3300032137 Bacteria 28942
171 Ga0316585_10035764 3300032137 Bacteria 1573
172 Ga0316585_10037185 3300032137 Bacteria 1545
173 Ga0316585_10039954 3300032137 Bacteria 1493
174 Ga0316585_10063183 3300032137 Bacteria 1197
175 Ga0316585_10074157 3300032137 Bacteria 1106
176 Ga0316580_10000021 3300032139 Bacteria 24429
177 Ga0316580_10021832 3300032139 Bacteria 1975
178 Ga0316580_10022774 3300032139 Bacteria 1933
179 Ga0316580_10040441 3300032139 Bacteria 1441
180 Ga0316580_10059480 3300032139 Bacteria 1173
181 Ga0316580_10084355 3300032139 Bacteria 971
182 Ga0316593_10012255 3300032168 Bacteria 2513
183 Ga0316593_10027383 3300032168 Bacteria 1828
184 Ga0316593_10077348 3300032168 Bacteria 1157
185 Ga0316593_10206234 3300032168 Bacteria 728
186 Ga0316592_1000605 3300033524 Bacteria 5196
187 Ga0316592_1005280 3300033524 Bacteria 2446
188 Ga0316592_1023756 3300033524 Bacteria 1317
189 Ga0316586_1003875 3300033527 Bacteria 2000
190 Ga0316588_1001056 3300033528 Bacteria 4345
191 Ga0316588_1005408 3300033528 Bacteria 2485
192 Ga0316588_1011050 3300033528 Bacteria 1917
193 Ga0316587_1012511 3300033529 Bacteria 1380
194 Ga0316587_1012893 3300033529 Bacteria 1364
195 Ga0316587_1084080 3300033529 Bacteria 603
196 Ga0316596_1010105 3300033541 Bacteria 2278
197 Ga0316596_1015753 3300033541 Bacteria 1887
198 Ga0316596_1018172 3300033541 Bacteria 1775
199 Ga0316596_1023235 3300033541 Bacteria 1587
200 Ga0316596_1113858 3300033541 Bacteria 735
201 Ga0373926_0019723 3300035083 Bacteria 2326
202 Ga0373926_0037904 3300035083 Bacteria 1716
203 Ga0373934_0189028 3300035086 Unclassified 847
204 Ga0373944_0137591 3300035089 Unclassified 853
205 Ga0373956_0160889 3300035119 Unclassified 1058
206 Ga0373943_0020992 3300035170 Bacteria 3016
207 Ga0373955_0145679 3300035172 Bacteria 1391
208 Ga0316574_0000004 3300035398 Bacteria 49638
209 Ga0316574_0060545 3300035398 Bacteria 2377
210 Ga0316574_0092690 3300035398 Bacteria 1928
211 Ga0316574_0106140 3300035398 Bacteria 1799
212 Ga0316574_0145306 3300035398 Bacteria 1528
213 Ga0316574_0196124 3300035398 Bacteria 1298
214 Ga0316574_0439286 3300035398 Bacteria 818
215 Ga0316574_0715326 3300035398 Bacteria 613
216 Ga0373927_0007273 3300035695 Bacteria 7509
217 Ga0373927_0478632 3300035695 Bacteria 823
218 Ga0373947_0301549 3300035725 Bacteria 1068
219 Ga0373947_0745923 3300035725 Unclassified 668
220 Ga0373947_0805948 3300035725 Unclassified 641
221 Ga0373937_0226120 3300036401 Bacteria 1761
222 Ga0373937_0790421 3300036401 Unclassified 897
223 Ga0316582_0000357 3300036647 Bacteria 16240
224 Ga0316582_0011703 3300036647 Bacteria 4862
225 Ga0316582_0142888 3300036647 Bacteria 1614
226 Ga0316582_0151543 3300036647 Bacteria 1567
227 Ga0316582_0255277 3300036647 Bacteria 1202
228 Ga0316582_0289043 3300036647 Bacteria 1125
229 Ga0316582_0319921 3300036647 Bacteria 1066
230 Ga0316584_0001240 3300036712 Bacteria 15084
231 Ga0316584_0003867 3300036712 Bacteria 9822
232 Ga0316584_0016375 3300036712 Bacteria 5314
233 Ga0316584_0021235 3300036712 Bacteria 4716
234 Ga0316584_0030504 3300036712 Bacteria 3982
235 Ga0316584_0038098 3300036712 Bacteria 3576
236 Ga0316584_0038110 3300036712 Bacteria 3575
237 Ga0316584_0055264 3300036712 Bacteria 2972
238 Ga0316584_0073627 3300036712 Bacteria 2560
239 Ga0316584_0147070 3300036712 Bacteria 1755
240 Ga0316584_0274500 3300036712 Bacteria 1226
241 Ga0316584_0338904 3300036712 Bacteria 1081
242 Ga0316584_0555923 3300036712 Bacteria 800
243 Ga0316584_0692099 3300036712 Bacteria 699
244 Ga0373925_0009994 3300037068 Bacteria 6890
245 Ga0373925_0341547 3300037068 Bacteria 1215
246 Ga0316581_0027319 3300037588 Bacteria 1706
247 Ga0316581_0137165 3300037588 Bacteria 754
248 Ga0436360_0394766 3300039438 Unclassified 1309
249 Ga0436360_1130985 3300039438 Bacteria 2366
250 Ga0436361_0407823 3300039447 Bacteria 1564
251 Ga0436361_0742006 3300039447 Bacteria 1100
252 Ga0436361_0866738 3300039447 Bacteria 1567
253 Ga0436361_0906768 3300039447 Unclassified 966
254 Ga0436361_1172994 3300039447 Bacteria 16033
255 Ga0436361_1220732 3300039447 Bacteria 6855
256 Ga0436362_0505069 3300039453 Bacteria 4811
257 Ga0451807_1779121 3300041486 Bacteria 694
258 Ga0451577_0025440 3300042876 Bacteria 5370
259 Ga0451577_0025803 3300042876 Bacteria 5328
260 Ga0451577_0211654 3300042876 Bacteria 1751
261 Ga0451577_0399007 3300042876 Bacteria 1248
262 Ga0451577_0538535 3300042876 Bacteria 1060
263 Ga0451577_0607074 3300042876 Bacteria 993
264 Ga0453683_0000527 3300044673 Bacteria 43044
265 Ga0453683_0067439 3300044673 Bacteria 2236
266 Ga0453683_0102274 3300044673 Bacteria 1799
267 Ga0453683_0192575 3300044673 Bacteria 1294
268 Ga0453684_0000068 3300044712 Bacteria 461699
269 Ga0453684_0002669 3300044712 Bacteria 42512
270 Ga0453684_0012641 3300044712 Bacteria 13880
271 Ga0453684_0024853 3300044712 Bacteria 8726
272 Ga0453684_0043724 3300044712 Bacteria 6014
273 Ga0453684_0064111 3300044712 Bacteria 4695
274 Ga0453684_0180912 3300044712 Bacteria 2475
275 Ga0453684_0285416 3300044712 Bacteria 1881
276 Ga0453684_0429613 3300044712 Bacteria 1474
277 Ga0453684_0449394 3300044712 Bacteria 1435
278 Ga0453684_0684760 3300044712 Bacteria 1116
279 Ga0451576_0025192 3300045051 Bacteria 6412
280 Ga0451576_0108470 3300045051 Bacteria 2889
281 Ga0451576_0262593 3300045051 Bacteria 1805
282 Ga0451576_0326397 3300045051 Unclassified 1606
283 Ga0451576_0809976 3300045051 Bacteria 983
284 Ga0451576_1780091 3300045051 Bacteria 637
285 Ga0451576_1963740 3300045051 Unclassified 603
286 Ga0495629_0204373 3300046459 Bacteria 1365
287 Ga0495651_0160356 3300046462 Bacteria 1612
288 Ga0495653_0702177 3300046463 Unclassified 614
289 Ga0495580_0401819 3300046472 Bacteria 924
290 Ga0495662_0020026 3300046476 Bacteria 3238
291 Ga0495664_0018477 3300046477 Bacteria 3996
292 Ga0495608_0180107 3300046511 Bacteria 1337
293 Ga0495618_0006965 3300046514 Bacteria 6848
294 Ga0495630_0000049 3300046517 Bacteria 97884
295 Ga0495630_0118700 3300046517 Bacteria 2006
296 Ga0495630_0174837 3300046517 Bacteria 1637
297 Ga0495630_0188957 3300046517 Bacteria 1571
298 Ga0495630_1227846 3300046517 Unclassified 566
299 Ga0495666_0002667 3300046526 Bacteria 8899
300 Ga0495666_0116149 3300046526 Bacteria 1255
301 Ga0495665_0125005 3300046531 Bacteria 1347
302 Ga0495665_0182188 3300046531 Unclassified 1091
303 Ga0495640_0178124 3300046533 Bacteria 1356
304 Ga0495586_0000185 3300046535 Bacteria 41119
305 Ga0495586_0004030 3300046535 Bacteria 7873
306 Ga0495587_0057428 3300046536 Bacteria 2288
307 Ga0495645_0823824 3300046543 Unclassified 555
308 Ga0495622_0222238 3300046557 Unclassified 836
309 Ga0495667_0158352 3300046559 Bacteria 1457
310 Ga0495634_0001149 3300046642 Bacteria 24443
311 Ga0495634_0053923 3300046642 Bacteria 2692
312 Ga0495634_0100815 3300046642 Bacteria 1865
313 Ga0495635_0041617 3300046663 Bacteria 3174
314 Ga0495599_0068929 3300046678 Bacteria 2208
315 Ga0495647_0107559 3300046681 Bacteria 1161
316 Ga0495658_0401495 3300046683 Unclassified 874
317 Ga0495658_0708484 3300046683 Unclassified 645
318 Ga0495613_0007466 3300046689 Bacteria 8144
319 Ga0495613_0152757 3300046689 Bacteria 1646
320 Ga0495613_0216959 3300046689 Unclassified 1344
321 Ga0495600_0411486 3300046809 Unclassified 840
322 Ga0495581_0060647 3300047315 Unclassified 2186
323 Ga0495674_0002484 3300047319 Bacteria 17985
324 Ga0495674_0077107 3300047319 Bacteria 2866
325 Ga0495676_0104476 3300047321 Unclassified 2090
326 Ga0495680_0383910 3300047322 Unclassified 972
327 Ga0495675_0059191 3300047444 Bacteria 2429
328 Ga0495684_0142288 3300047471 Bacteria 1798
329 Ga0501036_0526449 3300049572 Bacteria 983
330 Ga0501043_0113086 3300049579 Bacteria 2132
331 Ga0501047_0293628 3300049581 Bacteria 1469
332 nmdc:mga09592_1205392_c1 3300050508 Bacteria 625
333 nmdc:mga0qj67_8987_c1 3300050509 Bacteria 7411
334 nmdc:mga06r32_7072_c1 3300050510 Bacteria 10098
335 nmdc:mga08x19_333621_c1 3300050514 Bacteria 1057
336 Ga0495619_0502478 3300053085 Bacteria 834
337 Ga0207659_10188056
338 rootH2_10000692
339 Ga0070689_100217747
340 Ga0070675_100038052
341 Ga0070711_100467977
342 Ga0068855_100283167
343 Ga0068863_100247563
344 Ga0070717_10146793
345 Ga0070712_101138911
346 Ga0075428_100029890
347 Ga0075430_100004015
348 Ga0075434_100383401
349 Ga0105240_10005659
350 Ga0105240_10261541
351 Ga0105240_10492143
352 Ga0105248_10384729
353 Ga0105248_11332537
354 Ga0105249_10451651
355 Ga0163162_11184485
356 Ga0163162_12726540
357 Ga0157372_11030885
358 Ga0163163_10119668
359 Ga0157376_10141370
360 Ga0157376_10907330
361 Ga0163161_10498276
362 Ga0213872_10002439
363 Ga0213872_10257560
364 Ga0207695_10469101
365 Ga0207695_10855674
366 Ga0207663_10694479
367 Ga0207694_10383189
368 Ga0207670_10207675
369 Ga0207711_11421586
370 Ga0207702_10261648
371 Ga0207641_10223287
372 Ga0268266_10096746
373 Ga0268264_10549717
374 Ga0265337_1000980
375 Ga0265337_1004843
376 Ga0265337_1006055
377 Ga0265337_1006312
378 Ga0265326_10010027
379 Ga0265326_10018242
380 Ga0265326_10055529
381 Ga0265319_1000007
382 Ga0265319_1010701
383 Ga0265319_1011417
384 Ga0265319_1015892
385 Ga0265319_1023162
386 Ga0265319_1024215
387 Ga0265319_1049999
388 Ga0265334_10003156
389 Ga0265334_10014353
390 Ga0265318_10000034
391 Ga0265318_10000102
392 Ga0265318_10006045
393 Ga0265318_10053423
394 Ga0265323_10051872
395 Ga0265336_10004796
396 Ga0265338_10000016
397 Ga0265338_10000150
398 Ga0265338_10000198
399 Ga0265338_10000243
400 Ga0265338_10004648
401 Ga0265338_10006448
402 Ga0265338_10014568
403 Ga0265338_10019673
404 Ga0265338_10029221
405 Ga0265338_10031083
406 Ga0265338_10056401
407 Ga0265338_10142706
408 Ga0265338_10406646
409 Ga0265324_10004263
410 Ga0265324_10007175
411 Ga0265324_10009180
412 Ga0265324_10070666
413 Ga0265332_10011122
414 Ga0265332_10055368
415 Ga0265332_10203311
416 Ga0265328_10062595
417 Ga0265320_10000367
418 Ga0265320_10001362
419 Ga0265320_10001983
420 Ga0265320_10005693
421 Ga0265320_10015743
422 Ga0265320_10053116
423 Ga0265320_10088373
424 Ga0265320_10126792
425 Ga0265320_10128963
426 Ga0265325_10005882
427 Ga0265325_10017957
428 Ga0265325_10020855
429 Ga0265325_10144613
430 Ga0265329_10034555
431 Ga0265340_10001343
432 Ga0265340_10031209
433 Ga0265340_10120008
434 Ga0265339_10005735
435 Ga0265339_10009212
436 Ga0265339_10062363
437 Ga0265339_10128563
438 Ga0265339_10207227
439 Ga0265339_10455675
440 Ga0265331_10045511
441 Ga0265331_10094557
442 Ga0265327_10000092
443 Ga0265327_10000966
444 Ga0265327_10001868
445 Ga0265316_10041939
446 Ga0265316_10104468
447 Ga0265316_10117383
448 Ga0265316_10163542
449 Ga0265316_10263619
450 Ga0265316_10279268
451 Ga0265316_10284232
452 Ga0265316_10351219
453 Ga0265316_10430303
454 Ga0265316_10606108
455 Ga0265313_10004583
456 Ga0265313_10008236
457 Ga0265313_10015634
458 Ga0265313_10019845
459 Ga0316575_10006847
460 Ga0316575_10036673
461 Ga0316575_10109516
462 Ga0316579_10000467
463 Ga0316579_10002202
464 Ga0316579_10009209
465 Ga0316579_10038426
466 Ga0316579_10099145
467 Ga0265314_10001931
468 Ga0265314_10002132
469 Ga0265314_10077002
470 Ga0265314_10088561
471 Ga0265314_10153542
472 Ga0265342_10013266
473 Ga0265342_10097287
474 Ga0265342_10161209
475 Ga0316576_10000271
476 Ga0316576_10003571
477 Ga0316576_10021484
478 Ga0316576_10025227
479 Ga0316576_10038989
480 Ga0316576_10046361
481 Ga0316576_10050622
482 Ga0316576_10066263
483 Ga0316576_10104621
484 Ga0316576_10177195
485 Ga0316576_10237369
486 Ga0316576_10345315
487 Ga0316578_10000044
488 Ga0316578_10003377
489 Ga0316578_10016683
490 Ga0316578_10022055
491 Ga0316578_10038380
492 Ga0316578_10046512
493 Ga0316578_10071441
494 Ga0316578_10146866
495 Ga0316577_10000086
496 Ga0316577_10000839
497 Ga0316577_10011359
498 Ga0316577_10018915
499 Ga0316577_10212698
500 Ga0316577_10263357
501 Ga0316577_10381623
502 Ga0316577_10476061
503 Ga0316583_10028220
504 Ga0316583_10037842
505 Ga0316583_10244423
506 Ga0316585_10000011
507 Ga0316585_10035764
508 Ga0316585_10037185
509 Ga0316585_10039954
510 Ga0316585_10063183
511 Ga0316585_10074157
512 Ga0316580_10000021
513 Ga0316580_10021832
514 Ga0316580_10022774
515 Ga0316580_10040441
516 Ga0316580_10059480
517 Ga0316580_10084355
518 Ga0316593_10012255
519 Ga0316593_10027383
520 Ga0316593_10077348
521 Ga0316593_10206234
522 Ga0316592_1000605
523 Ga0316592_1005280
524 Ga0316592_1023756
525 Ga0316586_1003875
526 Ga0316588_1001056
527 Ga0316588_1005408
528 Ga0316588_1011050
529 Ga0316587_1012511
530 Ga0316587_1012893
531 Ga0316587_1084080
532 Ga0316596_1010105
533 Ga0316596_1015753
534 Ga0316596_1018172
535 Ga0316596_1023235
536 Ga0316596_1113858
537 Ga0373926_0019723
538 Ga0373926_0037904
539 Ga0373934_0189028
540 Ga0373944_0137591
541 Ga0373956_0160889
542 Ga0373943_0020992
543 Ga0373955_0145679
544 Ga0316574_0000004
545 Ga0316574_0060545
546 Ga0316574_0092690
547 Ga0316574_0106140
548 Ga0316574_0145306
549 Ga0316574_0196124
550 Ga0316574_0439286
551 Ga0316574_0715326
552 Ga0373927_0007273
553 Ga0373927_0478632
554 Ga0373947_0301549
555 Ga0373947_0745923
556 Ga0373947_0805948
557 Ga0373937_0226120
558 Ga0373937_0790421
559 Ga0316582_0000357
560 Ga0316582_0011703
561 Ga0316582_0142888
562 Ga0316582_0151543
563 Ga0316582_0255277
564 Ga0316582_0289043
565 Ga0316582_0319921
566 Ga0316584_0001240
567 Ga0316584_0003867
568 Ga0316584_0016375
569 Ga0316584_0021235
570 Ga0316584_0030504
571 Ga0316584_0038098
572 Ga0316584_0038110
573 Ga0316584_0055264
574 Ga0316584_0073627
575 Ga0316584_0147070
576 Ga0316584_0274500
577 Ga0316584_0338904
578 Ga0316584_0555923
579 Ga0316584_0692099
580 Ga0373925_0009994
581 Ga0373925_0341547
582 Ga0316581_0027319
583 Ga0316581_0137165
584 Ga0436360_0394766
585 Ga0436360_1130985
586 Ga0436361_0407823
587 Ga0436361_0742006
588 Ga0436361_0866738
589 Ga0436361_0906768
590 Ga0436361_1172994
591 Ga0436361_1220732
592 Ga0436362_0505069
593 Ga0451807_1779121
594 Ga0451577_0025440
595 Ga0451577_0025803
596 Ga0451577_0211654
597 Ga0451577_0399007
598 Ga0451577_0538535
599 Ga0451577_0607074
600 Ga0453683_0000527
601 Ga0453683_0067439
602 Ga0453683_0102274
603 Ga0453683_0192575
604 Ga0453684_0000068
605 Ga0453684_0002669
606 Ga0453684_0012641
607 Ga0453684_0024853
608 Ga0453684_0043724
609 Ga0453684_0064111
610 Ga0453684_0180912
611 Ga0453684_0285416
612 Ga0453684_0429613
613 Ga0453684_0449394
614 Ga0453684_0684760
615 Ga0451576_0025192
616 Ga0451576_0108470
617 Ga0451576_0262593
618 Ga0451576_0326397
619 Ga0451576_0809976
620 Ga0451576_1780091
621 Ga0451576_1963740
622 Ga0495629_0204373
623 Ga0495651_0160356
624 Ga0495653_0702177
625 Ga0495580_0401819
626 Ga0495662_0020026
627 Ga0495664_0018477
628 Ga0495608_0180107
629 Ga0495618_0006965
630 Ga0495630_0000049
631 Ga0495630_0118700
632 Ga0495630_0174837
633 Ga0495630_0188957
634 Ga0495630_1227846
635 Ga0495666_0002667
636 Ga0495666_0116149
637 Ga0495665_0125005
638 Ga0495665_0182188
639 Ga0495640_0178124
640 Ga0495586_0000185
641 Ga0495586_0004030
642 Ga0495587_0057428
643 Ga0495645_0823824
644 Ga0495622_0222238
645 Ga0495667_0158352
646 Ga0495634_0001149
647 Ga0495634_0053923
648 Ga0495634_0100815
649 Ga0495635_0041617
650 Ga0495599_0068929
651 Ga0495647_0107559
652 Ga0495658_0401495
653 Ga0495658_0708484
654 Ga0495613_0007466
655 Ga0495613_0152757
656 Ga0495613_0216959
657 Ga0495600_0411486
658 Ga0495581_0060647
659 Ga0495674_0002484
660 Ga0495674_0077107
661 Ga0495676_0104476
662 Ga0495680_0383910
663 Ga0495675_0059191
664 Ga0495684_0142288
665 Ga0501036_0526449
666 Ga0501043_0113086
667 Ga0501047_0293628
668 nmdc:mga09592_1205392_c1
669 nmdc:mga0qj67_8987_c1
670 nmdc:mga06r32_7072_c1
671 nmdc:mga08x19_333621_c1
672 Ga0495619_0502478

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

47

191

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j4z-assembly1.cif.gz_E architecture of tight respirasome 0.8284 92 175
7p8n-assembly1.cif.gz_a tmhydabc- t. maritima hydrogenase with bridge closed 0.7752 92 169
2b5a-assembly1.cif.gz_A c.bcli, control element of the bcli restriction-modification system 0.7658 57 78
7p92-assembly1.cif.gz_B tmhydabc- t. maritima bifurcating hydrogenase with bridge domain up 0.7449 87 171
8bew-assembly1.cif.gz_B cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the oxidised state 0.7425 89 174
ID Description Score Start End Superfamily
af_P9WIV5_106_200_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9063 92 174 3.40.30.10
af_Q9D6J6_126_223_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8978 92 174 3.40.30.10
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8882 90 171 3.40.30.10
af_A4HX94_128_234_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8687 92 174 3.40.30.10
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8687 90 171 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7V5QAJ9-F1-model_v4 NADH-quinone oxidoreductase subunit E 0.6119 43 174 GO:0016491
GO:0046872
GO:0051537
AF-A0A1G3UMG9-F1-model_v4 Hydrogenase 0.6093 40 174 GO:0016491
GO:0046872
GO:0051537
AF-A0A0D6PTH8-F1-model_v4 deleted 0.6058 40 175
AF-A0A7Z9LZ55-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.6037 40 174 GO:0003954
GO:0046872
GO:0051537
AF-A0A2E4EZY1-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.6029 43 174 GO:0046872
GO:0051536

Map