F412762

General Info

Members Datasets Scaffolds Average Seq Length
336 240 332 318

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_1634557|Ga0451853_1634557_27_1079
Length 350
Sequence LDGAADIIVIRLTPRAVSTPRRKITVSDPVFAIDETKPHVLAVAQLSPFLSGPLRAAYNVHERLHETDPAAFAKIAPKVRAIAASGESKVGAALFDQLPALEIVSVMGVGYDGIDVAAAKARGAVVTHTPNVLNDDVADLALALMLATARAIPQADRWIREGQWETKGPMPLQRKMSGARVGIVGMGRIGQAIAQRALGFRMEVAYTARSEKADLPYMYFPTPQALAAETDYLVVITPGGAATRKLIDASVFEALGKNGIVINVARGSVIDEGALIDALERGVIAGAGLDVFEDEPRVPAKLTAMSNVVLTPHVGSATQQTRQAMADLAFANLDAQMKGKPLVTPVPECR

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
3 2738543013 Variovorax sp. BT01 Isolate Unclassified
4 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
5 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
81 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
84 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
89 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
152 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
153 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
154 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
157 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
158 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
159 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
160 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
161 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
162 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
163 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
166 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
176 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
177 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
178 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
179 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
182 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
226 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
227 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
228 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
229 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
230 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
231 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
232 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
233 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
234 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
235 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
236 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
237 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
238 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
239 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
240 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 0
Isolates 1.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.08
Nodule 0.89
Rhizoplane 3.87
Rhizosphere 60.12
Stem 0
Stem Tuber 0
Unclassified 8.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000055 3300002704 Bacteria 74180
2 JGI25156J39149_1000078 3300002705 Bacteria 74254
3 JGI25154J39366_1000105 3300002738 Bacteria 74254
4 JGI25157J39369_1000098 3300002741 Bacteria 74254
5 JGI25150J39212_1004541 3300002774 Bacteria 3077
6 JGI25159J45721_1000587 3300002987 Bacteria 16358
7 JGI25151J46595_10009639 3300003187 Bacteria 4556
8 JGI25151J46595_10011140 3300003187 Bacteria 4143
9 JGI25151J46595_10020787 3300003187 Bacteria 2761
10 rootH1_10023011 3300003316 Bacteria 1265
11 JGI25160J50197_1000158 3300003354 Bacteria 58363
12 JGI25161J50226_1000040 3300003374 Bacteria 124804
13 Ga0055526_1017464 3300003771 Bacteria 2737
14 Ga0055526_1021099 3300003771 Bacteria 2281
15 Ga0055537_1001181 3300003773 Bacteria 11137
16 Ga0055524_1000077 3300003775 Bacteria 121584
17 Ga0055536_1008049 3300003781 Bacteria 4607
18 Ga0055534_1002147 3300003784 Bacteria 7066
19 Ga0055534_1002249 3300003784 Bacteria 6826
20 Ga0055528_1001468 3300003790 Bacteria 14326
21 Ga0055530_10001468 3300003791 Bacteria 17168
22 Ga0055540_1000010 3300003792 Bacteria 290865
23 Ga0055531_10000405 3300003794 Bacteria 41493
24 Ga0055543_1000167 3300004625 Bacteria 54995
25 Ga0065165_1023730 3300005262 Bacteria 2074
26 Ga0065165_1037554 3300005262 Bacteria 1468
27 Ga0065165_1044837 3300005262 Bacteria 1291
28 Ga0070658_10354133 3300005327 Bacteria 1257
29 Ga0070676_10175391 3300005328 Bacteria 1390
30 Ga0070670_100019769 3300005331 Bacteria 5783
31 Ga0070670_100405081 3300005331 Bacteria 1204
32 Ga0068869_100306539 3300005334 Bacteria 1284
33 Ga0070666_10149602 3300005335 Bacteria 1628
34 Ga0070660_100353427 3300005339 Bacteria 1210
35 Ga0070661_100034407 3300005344 Bacteria 3674
36 Ga0070669_100256492 3300005353 Bacteria 1394
37 Ga0070675_100459105 3300005354 Bacteria 1143
38 Ga0070674_100044587 3300005356 Bacteria 3024
39 Ga0070674_100051674 3300005356 Bacteria 2833
40 Ga0070674_100062418 3300005356 Bacteria 2604
41 Ga0070674_100296289 3300005356 Bacteria 1288
42 Ga0070688_100166983 3300005365 Bacteria 1516
43 Ga0070659_100126126 3300005366 Bacteria 2077
44 Ga0070667_100002533 3300005367 Bacteria 15909
45 Ga0070667_100219101 3300005367 Bacteria 1694
46 Ga0070667_100307800 3300005367 Bacteria 1428
47 Ga0070663_100208876 3300005455 Bacteria 1528
48 Ga0070678_100161694 3300005456 Bacteria 1815
49 Ga0070662_100067168 3300005457 Bacteria 2633
50 Ga0068867_100048643 3300005459 Bacteria 3121
51 Ga0068867_100090149 3300005459 Bacteria 2325
52 Ga0068867_100103201 3300005459 Bacteria 2180
53 Ga0070706_100001321 3300005467 Bacteria 26375
54 Ga0070684_100358207 3300005535 Bacteria 1342
55 Ga0068853_100429013 3300005539 Bacteria 1241
56 Ga0070672_100071327 3300005543 Bacteria 2763
57 Ga0070672_100209309 3300005543 Bacteria 1633
58 Ga0070693_100030795 3300005547 Bacteria 2936
59 Ga0070665_100056460 3300005548 Bacteria 3936
60 Ga0070664_100358592 3300005564 Bacteria 1327
61 Ga0068854_100019510 3300005578 Bacteria 4571
62 Ga0068854_100124229 3300005578 Bacteria 1963
63 Ga0068854_100260697 3300005578 Bacteria 1388
64 Ga0068856_100636990 3300005614 Bacteria 1087
65 Ga0068859_100341102 3300005617 Bacteria 1592
66 Ga0068864_100040925 3300005618 Bacteria 3963
67 Ga0068851_10051938 3300005834 Bacteria 2084
68 Ga0068851_10136550 3300005834 Bacteria 1330
69 Ga0068870_10120087 3300005840 Bacteria 1513
70 Ga0068858_100185701 3300005842 Bacteria 1964
71 Ga0068860_100094614 3300005843 Bacteria 2848
72 Ga0075364_10188040 3300006051 Bacteria 1398
73 Ga0075362_10015536 3300006177 Bacteria 3098
74 Ga0075362_10030166 3300006177 Bacteria 2341
75 Ga0075367_10003437 3300006178 Bacteria 7552
76 Ga0075367_10030572 3300006178 Bacteria 3088
77 Ga0075366_10004375 3300006195 Bacteria 7579
78 Ga0075366_10094784 3300006195 Bacteria 1789
79 Ga0075366_10100165 3300006195 Bacteria 1739
80 Ga0075370_10001570 3300006353 Bacteria 10036
81 Ga0075370_10002789 3300006353 Bacteria 8190
82 Ga0075370_10003657 3300006353 Bacteria 7360
83 Ga0075370_10005520 3300006353 Bacteria 6298
84 Ga0075370_10084004 3300006353 Bacteria 1832
85 Ga0097620_100341109 3300006931 Bacteria 1592
86 Ga0079104_1018042 3300006946 Bacteria 2010
87 Ga0105240_10190246 3300009093 Bacteria 2414
88 Ga0105245_10172881 3300009098 Bacteria 2058
89 Ga0114129_10023862 3300009147 Bacteria 8668
90 Ga0105243_10070138 3300009148 Bacteria 2829
91 Ga0105243_10503466 3300009148 Bacteria 1148
92 Ga0105237_10141600 3300009545 Bacteria 2399
93 Ga0105238_10539138 3300009551 Bacteria 1171
94 Ga0105249_10224903 3300009553 Bacteria 1848
95 Ga0105249_10453950 3300009553 Bacteria 1321
96 Ga0157373_10031744 3300013100 Bacteria 3802
97 Ga0157378_10220640 3300013297 Bacteria 1802
98 Ga0163162_10025414 3300013306 Bacteria 5852
99 Ga0157372_10070993 3300013307 Bacteria 3920
100 Ga0157375_10272284 3300013308 Bacteria 1855
101 Ga0182008_10000250 3300014497 Bacteria 41652
102 Ga0182008_10005555 3300014497 Bacteria 7158
103 Ga0157379_10019214 3300014968 Bacteria 6035
104 Ga0157376_10263085 3300014969 Bacteria 1617
105 Ga0182007_10000692 3300015262 Bacteria 19235
106 Ga0183362_10001 3300015683 Bacteria 2046624
107 Ga0163161_10077251 3300017792 Bacteria 2446
108 Ga0209435_100010 3300025206 Bacteria 475373
109 Ga0209436_104348 3300025208 Bacteria 3521
110 Ga0207425_1004806 3300025245 Bacteria 3974
111 Ga0209646_1000001 3300025246 Bacteria 3092932
112 Ga0209026_1000001 3300025250 Bacteria 1228671
113 Ga0209759_1000001 3300025256 Bacteria 2799452
114 Ga0209565_1000036 3300025263 Bacteria 293334
115 Ga0209565_1000856 3300025263 Bacteria 17000
116 Ga0209673_1000008 3300025273 Bacteria 626013
117 Ga0209130_1000042 3300025284 Bacteria 257581
118 Ga0209130_1002493 3300025284 Bacteria 9120
119 Ga0209130_1002999 3300025284 Bacteria 7647
120 Ga0209675_1000106 3300025291 Bacteria 120459
121 Ga0209675_1002057 3300025291 Bacteria 10739
122 Ga0209675_1006008 3300025291 Bacteria 4966
123 Ga0209676_1000007 3300025292 Bacteria 1029371
124 Ga0209025_1005131 3300025294 Bacteria 10861
125 Ga0209025_1005855 3300025294 Bacteria 9829
126 Ga0209025_1012556 3300025294 Bacteria 5417
127 Ga0209025_1050250 3300025294 Bacteria 1669
128 Ga0209564_1000487 3300025295 Bacteria 65983
129 Ga0209564_1002397 3300025295 Bacteria 14971
130 Ga0209564_1022816 3300025295 Bacteria 2195
131 Ga0209050_1000003 3300025298 Bacteria 1609245
132 Ga0209050_1001730 3300025298 Bacteria 21724
133 Ga0209050_1005475 3300025298 Bacteria 7952
134 Ga0209050_1021418 3300025298 Bacteria 2357
135 Ga0209256_1000001 3300025299 Bacteria 2166974
136 Ga0207426_1000097 3300025302 Bacteria 265930
137 Ga0207426_1003910 3300025302 Bacteria 7652
138 Ga0209051_1000003 3300025303 Bacteria 1609245
139 Ga0209257_1000020 3300025304 Bacteria 773356
140 Ga0209257_1008351 3300025304 Bacteria 5916
141 Ga0209257_1019806 3300025304 Bacteria 2516
142 Ga0207645_10033948 3300025907 Bacteria 3278
143 Ga0207643_10079004 3300025908 Bacteria 1904
144 Ga0207684_10008620 3300025910 Bacteria 9060
145 Ga0207684_10359304 3300025910 Bacteria 1253
146 Ga0207657_10220175 3300025919 Bacteria 1521
147 Ga0207649_10217773 3300025920 Bacteria 1358
148 Ga0207687_10131906 3300025927 Bacteria 1885
149 Ga0207690_10153072 3300025932 Bacteria 1711
150 Ga0207706_10074654 3300025933 Bacteria 2981
151 Ga0207706_10117553 3300025933 Bacteria 2338
152 Ga0207669_10035229 3300025937 Bacteria 2845
153 Ga0207669_10052966 3300025937 Bacteria 2441
154 Ga0207691_10077032 3300025940 Bacteria 3005
155 Ga0207689_10039573 3300025942 Bacteria 3903
156 Ga0207679_10203809 3300025945 Bacteria 1654
157 Ga0207651_10167600 3300025960 Bacteria 1729
158 Ga0207640_10053038 3300025981 Bacteria 2645
159 Ga0207640_10068729 3300025981 Bacteria 2375
160 Ga0207658_10006262 3300025986 Bacteria 8130
161 Ga0207658_10117838 3300025986 Bacteria 2111
162 Ga0207658_10259624 3300025986 Bacteria 1480
163 Ga0207677_10081562 3300026023 Bacteria 2321
164 Ga0207639_10431083 3300026041 Bacteria 1194
165 Ga0207702_10045797 3300026078 Bacteria 3680
166 Ga0207702_10484743 3300026078 Bacteria 1204
167 Ga0207641_10116275 3300026088 Bacteria 2379
168 Ga0207648_10041550 3300026089 Bacteria 4038
169 Ga0207676_10124187 3300026095 Bacteria 2182
170 Ga0207674_10340483 3300026116 Bacteria 1450
171 Ga0207675_100028346 3300026118 Bacteria 5214
172 Ga0207683_10024463 3300026121 Bacteria 5203
173 Ga0207683_10060298 3300026121 Bacteria 3335
174 Ga0207683_10098195 3300026121 Bacteria 2613
175 Ga0207698_10236065 3300026142 Bacteria 1663
176 Ga0209281_1000472 3300027111 Bacteria 56483
177 Ga0209281_1011216 3300027111 Bacteria 2014
178 Ga0268266_10010660 3300028379 Bacteria 8011
179 Ga0268266_10015478 3300028379 Bacteria 6545
180 Ga0268266_10410431 3300028379 Bacteria 1282
181 Ga0268264_10174278 3300028381 Bacteria 1948
182 Ga0307515_10000215 3300028794 Bacteria 142594
183 Ga0307515_10141267 3300028794 Bacteria 2581
184 Ga0307515_10242880 3300028794 Bacteria 1568
185 Ga0265330_10039169 3300031235 Bacteria 2106
186 Ga0265332_10022995 3300031238 Bacteria 2750
187 Ga0265327_10035214 3300031251 Bacteria 2770
188 Ga0265316_10297085 3300031344 Bacteria 1177
189 Ga0307513_10000017 3300031456 Bacteria 282386
190 Ga0307513_10009436 3300031456 Bacteria 12342
191 Ga0307513_10038164 3300031456 Bacteria 5336
192 Ga0307513_10083513 3300031456 Bacteria 3284
193 Ga0307513_10128448 3300031456 Bacteria 2485
194 Ga0307513_10269936 3300031456 Bacteria 1485
195 Ga0307509_10144536 3300031507 Bacteria 2306
196 Ga0307509_10147784 3300031507 Bacteria 2272
197 Ga0307509_10297647 3300031507 Bacteria 1364
198 Ga0265314_10010403 3300031711 Bacteria 7763
199 Ga0307516_10022871 3300031730 Bacteria 6415
200 Ga0307405_10072634 3300031731 Bacteria 2218
201 Ga0307406_10069583 3300031901 Bacteria 2301
202 Ga0307409_100004283 3300031995 Bacteria 7978
203 Ga0307416_100004827 3300032002 Bacteria 8198
204 Ga0307415_100043488 3300032126 Bacteria 2997
205 Ga0307415_100128057 3300032126 Bacteria 1917
206 Ga0307510_10008488 3300033180 Bacteria 12242
207 Ga0307510_10060337 3300033180 Bacteria 3904
208 Ga0373937_0229580 3300036401 Bacteria 1748
209 Ga0373925_0263012 3300037068 Bacteria 1386
210 Ga0395899_0002715 3300037312 Bacteria 14263
211 Ga0395899_0107474 3300037312 Bacteria 2008
212 Ga0395900_0069392 3300037418 Bacteria 3622
213 Ga0395898_0092197 3300037466 Bacteria 2913
214 Ga0395905_0001702 3300037471 Bacteria 25905
215 Ga0395905_0073077 3300037471 Bacteria 3214
216 Ga0395905_0176828 3300037471 Bacteria 2004
217 Ga0395901_0039485 3300038443 Bacteria 4884
218 Ga0395901_0248555 3300038443 Bacteria 1853
219 Ga0439436_0000685 3300041404 Bacteria 9108
220 Ga0439436_0008039 3300041404 Bacteria 3240
221 Ga0439439_0011415 3300041406 Bacteria 2137
222 Ga0439439_0021546 3300041406 Bacteria 1606
223 Ga0439447_009632 3300041407 Bacteria 2915
224 Ga0439466_0000630 3300041411 Bacteria 13242
225 Ga0439466_0026468 3300041411 Bacteria 2016
226 Ga0451853_1634557 3300041512 Bacteria 1503
227 Ga0439431_0000219 3300041997 Bacteria 11552
228 Ga0439431_0024525 3300041997 Bacteria 1468
229 Ga0439433_0000061 3300041999 Bacteria 13396
230 Ga0439433_0013216 3300041999 Bacteria 1811
231 Ga0439433_0037488 3300041999 Bacteria 1122
232 Ga0439442_002674 3300042002 Bacteria 3499
233 Ga0439442_008615 3300042002 Bacteria 2059
234 Ga0439432_000408 3300042006 Bacteria 15957
235 Ga0439432_004211 3300042006 Bacteria 5263
236 Ga0439432_008912 3300042006 Bacteria 3507
237 Ga0439449_0001066 3300042007 Bacteria 10801
238 Ga0439449_0001614 3300042007 Bacteria 8832
239 Ga0439449_0002422 3300042007 Bacteria 7293
240 Ga0439449_0003935 3300042007 Bacteria 5757
241 Ga0439457_003072 3300042014 Bacteria 4621
242 Ga0439458_0008411 3300042157 Bacteria 2298
243 Ga0450908_013180 3300042184 Bacteria 1492
244 Ga0439434_0027059 3300042435 Bacteria 1733
245 Ga0439464_0051200 3300042439 Bacteria 1194
246 Ga0450893_0020927 3300042532 Bacteria 1127
247 Ga0451577_0014762 3300042876 Bacteria 7279
248 Ga0451577_0116895 3300042876 Bacteria 2389
249 Ga0466969_0015345 3300044656 Bacteria 4015
250 Ga0466965_0060534 3300044683 Bacteria 1891
251 Ga0466966_0161598 3300044684 Bacteria 1363
252 Ga0453684_0020682 3300044712 Bacteria 9903
253 Ga0466971_0133038 3300044719 Bacteria 1155
254 Ga0451576_0007262 3300045051 Bacteria 13313
255 Ga0451576_0258473 3300045051 Bacteria 1820
256 Ga0495638_0134246 3300046460 Bacteria 1451
257 Ga0495650_0001042 3300046471 Bacteria 30968
258 Ga0495605_0142142 3300046474 Bacteria 1076
259 Ga0495610_0037837 3300046512 Bacteria 2452
260 Ga0495620_0024270 3300046515 Bacteria 2887
261 Ga0495632_0026101 3300046519 Bacteria 3079
262 Ga0495643_0026601 3300046522 Bacteria 3262
263 Ga0495642_0074873 3300046528 Bacteria 1420
264 Ga0495654_0000133 3300046530 Bacteria 78489
265 Ga0495586_0146515 3300046535 Bacteria 1327
266 Ga0495621_0007095 3300046539 Bacteria 3304
267 Ga0495656_0002517 3300046615 Bacteria 6097
268 Ga0495668_0028733 3300046616 Bacteria 3144
269 Ga0495588_0019957 3300046674 Bacteria 3288
270 Ga0495657_0189197 3300046675 Bacteria 1259
271 Ga0495649_0014561 3300046694 Bacteria 4504
272 Ga0495660_0058814 3300046810 Bacteria 2069
273 Ga0495687_001446 3300047443 Bacteria 21795
274 Ga0495686_0005497 3300047472 Bacteria 9970
275 Ga0495593_0056799 3300047673 Bacteria 2057
276 Ga0495615_0004043 3300048090 Bacteria 2521
277 Ga0496100_0016573 3300048903 Bacteria 4330
278 Ga0496102_0094357 3300048905 Bacteria 2772
279 Ga0496103_0061748 3300048906 Bacteria 2331
280 Ga0496104_0012374 3300048907 Bacteria 7671
281 Ga0496105_0007795 3300048908 Bacteria 8310
282 Ga0496106_0068625 3300048909 Bacteria 2704
283 Ga0496107_0068676 3300048910 Bacteria 2572
284 Ga0496108_0204499 3300048911 Bacteria 1713
285 Ga0496109_0217499 3300048912 Bacteria 1797
286 Ga0496110_0109103 3300048913 Bacteria 2485
287 Ga0496110_0204033 3300048913 Bacteria 1796
288 Ga0496112_0236343 3300048915 Bacteria 1781
289 Ga0496113_0042767 3300048916 Bacteria 3349
290 Ga0501038_0201686 3300049574 Bacteria 1596
291 Ga0501042_0082218 3300049578 Bacteria 2309
292 Ga0501047_0029009 3300049581 Bacteria 5338
293 Ga0501048_0045602 3300049582 Bacteria 3131
294 Ga0501068_0106201 3300049584 Bacteria 1743
295 Ga0501071_0004598 3300049587 Bacteria 8754
296 Ga0501072_0002446 3300049588 Bacteria 13911
297 Ga0501075_0001957 3300049591 Bacteria 13597
298 Ga0501076_0030969 3300049592 Bacteria 4169
299 Ga0501077_0058635 3300049593 Bacteria 2444
300 Ga0501079_0000812 3300049741 Bacteria 21278
301 Ga0501080_0005249 3300049742 Bacteria 11541
302 Ga0501080_0019733 3300049742 Bacteria 6242
303 Ga0501081_0031701 3300049743 Bacteria 3582
304 Ga0501045_0000399 3300049824 Bacteria 26386
305 nmdc:mga03683_37981_c1 3300050489 Bacteria 1965
306 nmdc:mga0k408_13524_c1 3300050493 Bacteria 4479
307 nmdc:mga0k408_27509_c1 3300050493 Bacteria 3230
308 nmdc:mga0k408_4334_c1 3300050493 Bacteria 7534
309 nmdc:mga0k408_84239_c1 3300050493 Bacteria 1865
310 nmdc:mga0k408_9335_c1 3300050493 Bacteria 5287
311 nmdc:mga07m45_171289_c1 3300050496 Bacteria 1262
312 nmdc:mga07m45_334_c1 3300050496 Bacteria 19102
313 nmdc:mga07m45_7030_c1 3300050496 Bacteria 5727
314 nmdc:mga05p37_21637_c1 3300050507 Bacteria 7791
315 nmdc:mga0sz30_124974_c1 3300050516 Bacteria 1132
316 Ga0500644_0000790 3300053088 Bacteria 10787
317 Ga0500644_0011511 3300053088 Bacteria 2419
318 Ga0500644_0011644 3300053088 Bacteria 2410
319 Ga0500650_0058325 3300053098 Bacteria 1800
320 Ga0500562_011485 3300053108 Bacteria 2248
321 Ga0500572_018286 3300053111 Bacteria 1813
322 Ga0500593_047775 3300053117 Bacteria 1904
323 Ga0500618_000008 3300053125 Bacteria 214678
324 Ga0500655_004602 3300053133 Bacteria 2480
325 Ga0500658_0021597 3300053134 Bacteria 2440
326 Ga0500559_0000014 3300053136 Bacteria 160139
327 Ga0500568_0056548 3300053139 Bacteria 1529
328 Ga0500586_021542 3300053145 Bacteria 2035
329 Ga0500622_0003748 3300053156 Bacteria 9934
330 Ga0500636_0079833 3300053177 Bacteria 1886
331 Ga0500661_002673 3300055283 Bacteria 3371
332 Ga0466962_0041040 3300061719 Bacteria 2214

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003784 Ga0055534_1002249 Ga0055534_10022496 280
2 3300005262 Ga0065165_1023730 Ga0065165_10237302 280
3 3300025284 Ga0209130_1002999 Ga0209130_10029992 280
4 3300025291 Ga0209675_1006008 Ga0209675_10060084 280
5 3300025294 Ga0209025_1050250 Ga0209025_10502502 280
6 3300025298 Ga0209050_1021418 Ga0209050_10214182 280
7 3300025304 Ga0209257_1008351 Ga0209257_10083512 280
8 3300009098 Ga0105245_10172881 Ga0105245_101728812 291
9 3300044719 Ga0466971_0133038 Ga0466971_0133038_265_1143 292
10 3300041999 Ga0439433_0037488 Ga0439433_0037488_202_1107 300
11 3300041404 Ga0439436_0008039 Ga0439436_0008039_2298_3203 301
12 3300036401 Ga0373937_0229580 Ga0373937_0229580_624_1583 303
13 3300014969 Ga0157376_10263085 Ga0157376_102630852 305
14 3300031995 Ga0307409_100004283 Ga0307409_1000042837 305
15 3300032002 Ga0307416_100004827 Ga0307416_1000048272 305
16 3300032126 Ga0307415_100043488 Ga0307415_1000434882 305
17 3300031235 Ga0265330_10039169 Ga0265330_100391692 306
18 3300031238 Ga0265332_10022995 Ga0265332_100229952 306
19 3300031344 Ga0265316_10297085 Ga0265316_102970852 306
20 3300031711 Ga0265314_10010403 Ga0265314_100104033 306
21 3300049581 Ga0501047_0029009 Ga0501047_0029009_258_1181 306
22 3300046471 Ga0495650_0001042 Ga0495650_0001042_17321_18244 307
23 iso_pu_bacteria 2738543013 2739248549 309
24 3300005365 Ga0070688_100166983 Ga0070688_1001669831 311
25 3300049574 Ga0501038_0201686 Ga0501038_0201686_195_1133 311
26 3300049578 Ga0501042_0082218 Ga0501042_0082218_1090_2028 311
27 3300049582 Ga0501048_0045602 Ga0501048_0045602_1338_2276 311
28 3300049584 Ga0501068_0106201 Ga0501068_0106201_510_1448 311
29 3300049587 Ga0501071_0004598 Ga0501071_0004598_2742_3680 311
30 3300049588 Ga0501072_0002446 Ga0501072_0002446_1125_2063 311
31 3300049591 Ga0501075_0001957 Ga0501075_0001957_133_1071 311
32 3300049592 Ga0501076_0030969 Ga0501076_0030969_2578_3516 311
33 3300049593 Ga0501077_0058635 Ga0501077_0058635_748_1686 311
34 3300049741 Ga0501079_0000812 Ga0501079_0000812_13791_14729 311
35 3300049742 Ga0501080_0005249 Ga0501080_0005249_4666_5604 311
36 3300049742 Ga0501080_0019733 Ga0501080_0019733_1896_2843 311
37 3300049743 Ga0501081_0031701 Ga0501081_0031701_2434_3372 311
38 3300049824 Ga0501045_0000399 Ga0501045_0000399_3162_4100 311
39 iso_pu_bacteria 2643221654 2644302437 311
40 iso_pu_bacteria 2885192300 2885195956 311
41 3300032126 Ga0307415_100128057 Ga0307415_1001280572 312
42 3300042439 Ga0439464_0051200 Ga0439464_0051200_33_995 312
43 3300005327 Ga0070658_10354133 Ga0070658_103541332 313
44 3300005328 Ga0070676_10175391 Ga0070676_101753912 313
45 3300005331 Ga0070670_100405081 Ga0070670_1004050812 313
46 3300005339 Ga0070660_100353427 Ga0070660_1003534272 313
47 3300005344 Ga0070661_100034407 Ga0070661_1000344072 313
48 3300005356 Ga0070674_100296289 Ga0070674_1002962892 313
49 3300005366 Ga0070659_100126126 Ga0070659_1001261262 313
50 3300005367 Ga0070667_100307800 Ga0070667_1003078002 313
51 3300005459 Ga0068867_100090149 Ga0068867_1000901492 313
52 3300005535 Ga0070684_100358207 Ga0070684_1003582072 313
53 3300005543 Ga0070672_100071327 Ga0070672_1000713272 313
54 3300005543 Ga0070672_100209309 Ga0070672_1002093092 313
55 3300005547 Ga0070693_100030795 Ga0070693_1000307952 313
56 3300005564 Ga0070664_100358592 Ga0070664_1003585922 313
57 3300005578 Ga0068854_100019510 Ga0068854_1000195102 313
58 3300005578 Ga0068854_100124229 Ga0068854_1001242292 313
59 3300005578 Ga0068854_100260697 Ga0068854_1002606972 313
60 3300005834 Ga0068851_10051938 Ga0068851_100519382 313
61 3300005840 Ga0068870_10120087 Ga0068870_101200872 313
62 3300009148 Ga0105243_10070138 Ga0105243_100701383 313
63 3300009553 Ga0105249_10224903 Ga0105249_102249032 313
64 3300013100 Ga0157373_10031744 Ga0157373_100317442 313
65 3300013307 Ga0157372_10070993 Ga0157372_100709934 313
66 3300025908 Ga0207643_10079004 Ga0207643_100790042 313
67 3300025919 Ga0207657_10220175 Ga0207657_102201752 313
68 3300025920 Ga0207649_10217773 Ga0207649_102177732 313
69 3300025932 Ga0207690_10153072 Ga0207690_101530722 313
70 3300025933 Ga0207706_10117553 Ga0207706_101175532 313
71 3300025945 Ga0207679_10203809 Ga0207679_102038092 313
72 3300025981 Ga0207640_10053038 Ga0207640_100530382 313
73 3300025986 Ga0207658_10259624 Ga0207658_102596242 313
74 3300026078 Ga0207702_10045797 Ga0207702_100457972 313
75 3300026118 Ga0207675_100028346 Ga0207675_1000283464 313
76 3300026121 Ga0207683_10060298 Ga0207683_100602984 313
77 3300026142 Ga0207698_10236065 Ga0207698_102360652 313
78 3300037471 Ga0395905_0001702 Ga0395905_0001702_2445_3416 313
79 3300041997 Ga0439431_0024525 Ga0439431_0024525_264_1205 313
80 3300048912 Ga0496109_0217499 Ga0496109_0217499_285_1226 313
81 3300005331 Ga0070670_100019769 Ga0070670_1000197693 314
82 3300005356 Ga0070674_100044587 Ga0070674_1000445872 314
83 3300005456 Ga0070678_100161694 Ga0070678_1001616942 314
84 3300005459 Ga0068867_100048643 Ga0068867_1000486432 314
85 3300013297 Ga0157378_10220640 Ga0157378_102206402 314
86 3300025907 Ga0207645_10033948 Ga0207645_100339483 314
87 3300025937 Ga0207669_10035229 Ga0207669_100352292 314
88 3300026089 Ga0207648_10041550 Ga0207648_100415503 314
89 3300026121 Ga0207683_10098195 Ga0207683_100981953 314
90 3300027111 Ga0209281_1000472 Ga0209281_100047227 314
91 3300028379 Ga0268266_10410431 Ga0268266_104104312 314
92 3300031456 Ga0307513_10269936 Ga0307513_102699362 314
93 3300037312 Ga0395899_0002715 Ga0395899_0002715_3736_4683 314
94 3300037312 Ga0395899_0107474 Ga0395899_0107474_364_1311 314
95 3300037418 Ga0395900_0069392 Ga0395900_0069392_2334_3281 314
96 3300037466 Ga0395898_0092197 Ga0395898_0092197_581_1528 314
97 3300037471 Ga0395905_0073077 Ga0395905_0073077_140_1087 314
98 3300037471 Ga0395905_0176828 Ga0395905_0176828_787_1734 314
99 3300038443 Ga0395901_0039485 Ga0395901_0039485_1818_2765 314
100 3300038443 Ga0395901_0248555 Ga0395901_0248555_144_1091 314
101 3300046530 Ga0495654_0000133 Ga0495654_0000133_54566_55519 314
102 3300053088 Ga0500644_0011644 Ga0500644_0011644_1116_2060 314
103 3300053108 Ga0500562_011485 Ga0500562_011485_972_1916 314
104 3300053111 Ga0500572_018286 Ga0500572_018286_164_1117 314
105 3300053145 Ga0500586_021542 Ga0500586_021542_331_1275 314
106 3300005356 Ga0070674_100062418 Ga0070674_1000624182 315
107 3300005367 Ga0070667_100002533 Ga0070667_10000253317 315
108 3300005548 Ga0070665_100056460 Ga0070665_1000564602 315
109 3300005614 Ga0068856_100636990 Ga0068856_1006369901 315
110 3300005617 Ga0068859_100341102 Ga0068859_1003411022 315
111 3300005618 Ga0068864_100040925 Ga0068864_1000409254 315
112 3300005842 Ga0068858_100185701 Ga0068858_1001857012 315
113 3300005843 Ga0068860_100094614 Ga0068860_1000946142 315
114 3300006195 Ga0075366_10004375 Ga0075366_100043759 315
115 3300006931 Ga0097620_100341109 Ga0097620_1003411092 315
116 3300009147 Ga0114129_10023862 Ga0114129_100238621 315
117 3300013308 Ga0157375_10272284 Ga0157375_102722842 315
118 3300014497 Ga0182008_10000250 Ga0182008_100002503 315
119 3300014968 Ga0157379_10019214 Ga0157379_100192142 315
120 3300025910 Ga0207684_10359304 Ga0207684_103593042 315
121 3300025927 Ga0207687_10131906 Ga0207687_101319062 315
122 3300025937 Ga0207669_10052966 Ga0207669_100529663 315
123 3300025986 Ga0207658_10006262 Ga0207658_100062629 315
124 3300026023 Ga0207677_10081562 Ga0207677_100815622 315
125 3300026078 Ga0207702_10484743 Ga0207702_104847432 315
126 3300026088 Ga0207641_10116275 Ga0207641_101162752 315
127 3300026095 Ga0207676_10124187 Ga0207676_101241872 315
128 3300026121 Ga0207683_10024463 Ga0207683_100244633 315
129 3300028379 Ga0268266_10010660 Ga0268266_100106603 315
130 3300028379 Ga0268266_10015478 Ga0268266_100154782 315
131 3300028381 Ga0268264_10174278 Ga0268264_101742782 315
132 3300028794 Ga0307515_10000215 Ga0307515_10000215102 315
133 3300028794 Ga0307515_10141267 Ga0307515_101412672 315
134 3300028794 Ga0307515_10242880 Ga0307515_102428802 315
135 3300031456 Ga0307513_10000017 Ga0307513_1000001719 315
136 3300031456 Ga0307513_10009436 Ga0307513_100094364 315
137 3300031456 Ga0307513_10038164 Ga0307513_100381645 315
138 3300031456 Ga0307513_10128448 Ga0307513_101284482 315
139 3300031507 Ga0307509_10144536 Ga0307509_101445362 315
140 3300031507 Ga0307509_10147784 Ga0307509_101477842 315
141 3300031507 Ga0307509_10297647 Ga0307509_102976471 315
142 3300031731 Ga0307405_10072634 Ga0307405_100726342 315
143 3300033180 Ga0307510_10008488 Ga0307510_100084883 315
144 3300033180 Ga0307510_10060337 Ga0307510_100603373 315
145 3300037068 Ga0373925_0263012 Ga0373925_0263012_242_1189 315
146 3300041404 Ga0439436_0000685 Ga0439436_0000685_6722_7747 315
147 3300041406 Ga0439439_0011415 Ga0439439_0011415_777_1724 315
148 3300041406 Ga0439439_0021546 Ga0439439_0021546_80_1105 315
149 3300041407 Ga0439447_009632 Ga0439447_009632_758_1705 315
150 3300041411 Ga0439466_0000630 Ga0439466_0000630_4587_5612 315
151 3300041411 Ga0439466_0026468 Ga0439466_0026468_415_1362 315
152 3300041997 Ga0439431_0000219 Ga0439431_0000219_271_1296 315
153 3300041999 Ga0439433_0000061 Ga0439433_0000061_2010_3035 315
154 3300041999 Ga0439433_0013216 Ga0439433_0013216_622_1569 315
155 3300042002 Ga0439442_002674 Ga0439442_002674_279_1304 315
156 3300042002 Ga0439442_008615 Ga0439442_008615_1062_2009 315
157 3300042006 Ga0439432_000408 Ga0439432_000408_5410_6435 315
158 3300042006 Ga0439432_004211 Ga0439432_004211_2879_3826 315
159 3300042006 Ga0439432_008912 Ga0439432_008912_2133_3080 315
160 3300042007 Ga0439449_0001066 Ga0439449_0001066_4587_5612 315
161 3300042007 Ga0439449_0001614 Ga0439449_0001614_311_1258 315
162 3300042007 Ga0439449_0002422 Ga0439449_0002422_3117_4064 315
163 3300042014 Ga0439457_003072 Ga0439457_003072_1515_2540 315
164 3300042157 Ga0439458_0008411 Ga0439458_0008411_1066_2016 315
165 3300042184 Ga0450908_013180 Ga0450908_013180_487_1434 315
166 3300042435 Ga0439434_0027059 Ga0439434_0027059_378_1325 315
167 3300042876 Ga0451577_0014762 Ga0451577_0014762_4601_5548 315
168 3300044712 Ga0453684_0020682 Ga0453684_0020682_881_1828 315
169 3300046460 Ga0495638_0134246 Ga0495638_0134246_468_1424 315
170 3300046515 Ga0495620_0024270 Ga0495620_0024270_71_1039 315
171 3300046616 Ga0495668_0028733 Ga0495668_0028733_729_1685 315
172 3300047472 Ga0495686_0005497 Ga0495686_0005497_3639_4586 315
173 3300050493 nmdc:mga0k408_27509_c1 nmdc:mga0k408_27509_c1_1197_2144 315
174 3300050507 nmdc:mga05p37_21637_c1 nmdc:mga05p37_21637_c1_148_1125 315
175 3300053088 Ga0500644_0000790 Ga0500644_0000790_6608_7564 315
176 3300053125 Ga0500618_000008 Ga0500618_000008_181159_182115 315
177 3300053133 Ga0500655_004602 Ga0500655_004602_43_999 315
178 3300053136 Ga0500559_0000014 Ga0500559_0000014_157560_158516 315
179 3300053156 Ga0500622_0003748 Ga0500622_0003748_2348_3304 315
180 3300053177 Ga0500636_0079833 Ga0500636_0079833_223_1179 315
181 3300003316 rootH1_10023011 rootH1_100230111 316
182 3300005334 Ga0068869_100306539 Ga0068869_1003065392 316
183 3300005335 Ga0070666_10149602 Ga0070666_101496022 316
184 3300005367 Ga0070667_100219101 Ga0070667_1002191012 316
185 3300005455 Ga0070663_100208876 Ga0070663_1002088762 316
186 3300005457 Ga0070662_100067168 Ga0070662_1000671682 316
187 3300005459 Ga0068867_100103201 Ga0068867_1001032012 316
188 3300005467 Ga0070706_100001321 Ga0070706_10000132118 316
189 3300005539 Ga0068853_100429013 Ga0068853_1004290131 316
190 3300006177 Ga0075362_10015536 Ga0075362_100155361 316
191 3300006177 Ga0075362_10030166 Ga0075362_100301662 316
192 3300006178 Ga0075367_10003437 Ga0075367_100034374 316
193 3300006178 Ga0075367_10030572 Ga0075367_100305721 316
194 3300006195 Ga0075366_10094784 Ga0075366_100947842 316
195 3300006195 Ga0075366_10100165 Ga0075366_101001652 316
196 3300006353 Ga0075370_10001570 Ga0075370_100015706 316
197 3300006353 Ga0075370_10002789 Ga0075370_100027891 316
198 3300006353 Ga0075370_10003657 Ga0075370_100036577 316
199 3300006353 Ga0075370_10005520 Ga0075370_100055202 316
200 3300006353 Ga0075370_10084004 Ga0075370_100840042 316
201 3300009093 Ga0105240_10190246 Ga0105240_101902462 316
202 3300009148 Ga0105243_10503466 Ga0105243_105034662 316
203 3300009545 Ga0105237_10141600 Ga0105237_101416002 316
204 3300009551 Ga0105238_10539138 Ga0105238_105391381 316
205 3300009553 Ga0105249_10453950 Ga0105249_104539501 316
206 3300014497 Ga0182008_10005555 Ga0182008_100055555 316
207 3300015262 Ga0182007_10000692 Ga0182007_1000069217 316
208 3300025910 Ga0207684_10008620 Ga0207684_100086203 316
209 3300025933 Ga0207706_10074654 Ga0207706_100746542 316
210 3300025942 Ga0207689_10039573 Ga0207689_100395733 316
211 3300025981 Ga0207640_10068729 Ga0207640_100687292 316
212 3300026041 Ga0207639_10431083 Ga0207639_104310832 316
213 3300026116 Ga0207674_10340483 Ga0207674_103404831 316
214 3300031251 Ga0265327_10035214 Ga0265327_100352143 316
215 3300031456 Ga0307513_10083513 Ga0307513_100835132 316
216 3300031730 Ga0307516_10022871 Ga0307516_100228719 316
217 3300042007 Ga0439449_0003935 Ga0439449_0003935_1122_2075 316
218 3300042532 Ga0450893_0020927 Ga0450893_0020927_20_970 316
219 3300045051 Ga0451576_0007262 Ga0451576_0007262_7779_8729 316
220 3300046474 Ga0495605_0142142 Ga0495605_0142142_61_1032 316
221 3300046512 Ga0495610_0037837 Ga0495610_0037837_1289_2260 316
222 3300046519 Ga0495632_0026101 Ga0495632_0026101_1911_2882 316
223 3300046522 Ga0495643_0026601 Ga0495643_0026601_1802_2752 316
224 3300046528 Ga0495642_0074873 Ga0495642_0074873_354_1325 316
225 3300046694 Ga0495649_0014561 Ga0495649_0014561_3397_4368 316
226 3300046810 Ga0495660_0058814 Ga0495660_0058814_50_1024 316
227 3300047443 Ga0495687_001446 Ga0495687_001446_19448_20419 316
228 3300048913 Ga0496110_0109103 Ga0496110_0109103_1353_2315 316
229 3300050489 nmdc:mga03683_37981_c1 nmdc:mga03683_37981_c1_541_1491 316
230 3300050493 nmdc:mga0k408_13524_c1 nmdc:mga0k408_13524_c1_3446_4420 316
231 3300050493 nmdc:mga0k408_4334_c1 nmdc:mga0k408_4334_c1_1555_2505 316
232 3300050493 nmdc:mga0k408_84239_c1 nmdc:mga0k408_84239_c1_586_1593 316
233 3300050493 nmdc:mga0k408_9335_c1 nmdc:mga0k408_9335_c1_2119_3090 316
234 3300050496 nmdc:mga07m45_171289_c1 nmdc:mga07m45_171289_c1_60_1034 316
235 3300050496 nmdc:mga07m45_334_c1 nmdc:mga07m45_334_c1_13303_14334 316
236 3300050496 nmdc:mga07m45_7030_c1 nmdc:mga07m45_7030_c1_3598_4554 316
237 3300050516 nmdc:mga0sz30_124974_c1 nmdc:mga0sz30_124974_c1_56_1030 316
238 3300053134 Ga0500658_0021597 Ga0500658_0021597_1342_2313 316
239 3300053139 Ga0500568_0056548 Ga0500568_0056548_446_1417 316
240 iso_pu_bacteria 2511231002 2511244772 316
241 3300005354 Ga0070675_100459105 Ga0070675_1004591051 317
242 3300005356 Ga0070674_100051674 Ga0070674_1000516742 317
243 3300013306 Ga0163162_10025414 Ga0163162_100254143 317
244 3300015683 Ga0183362_10001 Ga0183362_10001492 317
245 3300017792 Ga0163161_10077251 Ga0163161_100772512 317
246 3300025940 Ga0207691_10077032 Ga0207691_100770323 317
247 3300025960 Ga0207651_10167600 Ga0207651_101676002 317
248 3300025986 Ga0207658_10117838 Ga0207658_101178383 317
249 3300046535 Ga0495586_0146515 Ga0495586_0146515_43_1008 317
250 3300046539 Ga0495621_0007095 Ga0495621_0007095_1449_2408 317
251 3300046615 Ga0495656_0002517 Ga0495656_0002517_5020_5979 317
252 3300046674 Ga0495588_0019957 Ga0495588_0019957_1387_2352 317
253 3300046675 Ga0495657_0189197 Ga0495657_0189197_221_1192 317
254 3300047673 Ga0495593_0056799 Ga0495593_0056799_285_1250 317
255 3300048090 Ga0495615_0004043 Ga0495615_0004043_236_1195 317
256 3300048903 Ga0496100_0016573 Ga0496100_0016573_1133_2098 317
257 3300048905 Ga0496102_0094357 Ga0496102_0094357_1003_1968 317
258 3300048906 Ga0496103_0061748 Ga0496103_0061748_833_1798 317
259 3300048907 Ga0496104_0012374 Ga0496104_0012374_6097_7062 317
260 3300048908 Ga0496105_0007795 Ga0496105_0007795_2977_3942 317
261 3300048909 Ga0496106_0068625 Ga0496106_0068625_1269_2234 317
262 3300048910 Ga0496107_0068676 Ga0496107_0068676_719_1684 317
263 3300048911 Ga0496108_0204499 Ga0496108_0204499_617_1582 317
264 3300048913 Ga0496110_0204033 Ga0496110_0204033_170_1135 317
265 3300048915 Ga0496112_0236343 Ga0496112_0236343_305_1270 317
266 3300048916 Ga0496113_0042767 Ga0496113_0042767_1418_2383 317
267 3300044656 Ga0466969_0015345 Ga0466969_0015345_1110_2096 318
268 3300044683 Ga0466965_0060534 Ga0466965_0060534_32_1018 318
269 3300044684 Ga0466966_0161598 Ga0466966_0161598_38_1024 318
270 3300061719 Ga0466962_0041040 Ga0466962_0041040_973_1959 318
271 3300005353 Ga0070669_100256492 Ga0070669_1002564921 319
272 3300041512 Ga0451853_1634557 Ga0451853_1634557_27_1079 319
273 3300042876 Ga0451577_0116895 Ga0451577_0116895_246_1232 319
274 3300045051 Ga0451576_0258473 Ga0451576_0258473_706_1692 319
275 3300002704 JGI25155J39150_1000055 JGI25155J39150_10000556 320
276 3300002705 JGI25156J39149_1000078 JGI25156J39149_100007875 320
277 3300002738 JGI25154J39366_1000105 JGI25154J39366_10001056 320
278 3300002741 JGI25157J39369_1000098 JGI25157J39369_10000986 320
279 3300002774 JGI25150J39212_1004541 JGI25150J39212_10045411 320
280 3300002987 JGI25159J45721_1000587 JGI25159J45721_100058710 320
281 3300003187 JGI25151J46595_10009639 JGI25151J46595_100096392 320
282 3300003187 JGI25151J46595_10011140 JGI25151J46595_100111402 320
283 3300003187 JGI25151J46595_10020787 JGI25151J46595_100207872 320
284 3300003354 JGI25160J50197_1000158 JGI25160J50197_100015822 320
285 3300003374 JGI25161J50226_1000040 JGI25161J50226_100004065 320
286 3300003771 Ga0055526_1017464 Ga0055526_10174642 320
287 3300003771 Ga0055526_1021099 Ga0055526_10210992 320
288 3300003773 Ga0055537_1001181 Ga0055537_100118110 320
289 3300003775 Ga0055524_1000077 Ga0055524_100007752 320
290 3300003781 Ga0055536_1008049 Ga0055536_10080493 320
291 3300003784 Ga0055534_1002147 Ga0055534_10021472 320
292 3300003790 Ga0055528_1001468 Ga0055528_10014686 320
293 3300003791 Ga0055530_10001468 Ga0055530_100014686 320
294 3300003792 Ga0055540_1000010 Ga0055540_1000010164 320
295 3300003794 Ga0055531_10000405 Ga0055531_1000040536 320
296 3300004625 Ga0055543_1000167 Ga0055543_100016713 320
297 3300005262 Ga0065165_1037554 Ga0065165_10375542 320
298 3300005262 Ga0065165_1044837 Ga0065165_10448371 320
299 3300005834 Ga0068851_10136550 Ga0068851_101365502 320
300 3300006051 Ga0075364_10188040 Ga0075364_101880401 320
301 3300006946 Ga0079104_1018042 Ga0079104_10180422 320
302 3300025206 Ga0209435_100010 Ga0209435_100010307 320
303 3300025208 Ga0209436_104348 Ga0209436_1043482 320
304 3300025245 Ga0207425_1004806 Ga0207425_10048063 320
305 3300025246 Ga0209646_1000001 Ga0209646_10000011835 320
306 3300025250 Ga0209026_1000001 Ga0209026_1000001489 320
307 3300025256 Ga0209759_1000001 Ga0209759_10000011466 320
308 3300025263 Ga0209565_1000036 Ga0209565_1000036193 320
309 3300025263 Ga0209565_1000856 Ga0209565_10008569 320
310 3300025273 Ga0209673_1000008 Ga0209673_1000008581 320
311 3300025284 Ga0209130_1000042 Ga0209130_100004255 320
312 3300025284 Ga0209130_1002493 Ga0209130_10024936 320
313 3300025291 Ga0209675_1000106 Ga0209675_100010636 320
314 3300025291 Ga0209675_1002057 Ga0209675_10020572 320
315 3300025292 Ga0209676_1000007 Ga0209676_1000007190 320
316 3300025294 Ga0209025_1005131 Ga0209025_10051312 320
317 3300025294 Ga0209025_1005855 Ga0209025_10058551 320
318 3300025294 Ga0209025_1012556 Ga0209025_10125564 320
319 3300025295 Ga0209564_1000487 Ga0209564_100048754 320
320 3300025295 Ga0209564_1002397 Ga0209564_100239710 320
321 3300025295 Ga0209564_1022816 Ga0209564_10228162 320
322 3300025298 Ga0209050_1000003 Ga0209050_10000031318 320
323 3300025298 Ga0209050_1001730 Ga0209050_100173010 320
324 3300025298 Ga0209050_1005475 Ga0209050_10054752 320
325 3300025299 Ga0209256_1000001 Ga0209256_10000011320 320
326 3300025302 Ga0207426_1000097 Ga0207426_100009761 320
327 3300025302 Ga0207426_1003910 Ga0207426_10039106 320
328 3300025303 Ga0209051_1000003 Ga0209051_10000031318 320
329 3300025304 Ga0209257_1000020 Ga0209257_1000020190 320
330 3300025304 Ga0209257_1019806 Ga0209257_10198061 320
331 3300027111 Ga0209281_1011216 Ga0209281_10112161 320
332 3300031901 Ga0307406_10069583 Ga0307406_100695832 320
333 3300053088 Ga0500644_0011511 Ga0500644_0011511_864_1847 320
334 3300053098 Ga0500650_0058325 Ga0500650_0058325_405_1367 320
335 3300053117 Ga0500593_047775 Ga0500593_047775_590_1573 320
336 3300055283 Ga0500661_002673 Ga0500661_002673_31_993 320

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00389

2-Hacid_dh

D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain

40

347

0.96

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

142

315

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lsw-assembly1.cif.gz_A crystallization and structural analysis of 2-hydroxyacid dehydrogenase from ketogulonicigenium vulgare y25 0.9608 7 316
5v72-assembly2.cif.gz_D crystal structure of nadph-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with citrate 0.9543 7 319
5v72-assembly1.cif.gz_A crystal structure of nadph-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with citrate 0.9472 6 319
3ba1-assembly1.cif.gz_A structure of hydroxyphenylpyruvate reductase from coleus blumei 0.9456 6 316
3ba1-assembly1.cif.gz_A structure of hydroxyphenylpyruvate reductase from coleus blumei 0.9398 6 316
ID Description Score Start End Superfamily
af_Q9LE33_108_292_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9868 105 288 3.40.50.720
af_Q7XRA3_150_294_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9854 145 288 3.40.50.720
af_K7L0E3_188_326_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9802 174 311 3.40.50.720
af_A0A0R0KIU5_101_193_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9782 197 288 3.40.50.720
af_Q9LE33_108_292_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9763 105 288 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A381P5B8-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein 0.9881 94 316 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A7N0VHN0-F1-model_v4 Hydroxyphenylpyruvate reductase 0.9879 93 316 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A2G2VGW9-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein 0.9878 140 316 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A5K1GTK6-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein 0.9874 147 292 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A7J0FLL7-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase family protein 0.9869 146 285 GO:0005829
GO:0016618
GO:0030267
GO:0051287

Feature Viewer

pLDDT pTM Quality
94.5 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map