F412802

General Info

Members Datasets Scaffolds Average Seq Length
336 210 672 166

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0000023|Ga0495668_0000023_339784_340368
Length 194
Sequence MLKNGSTRYKKNYNHPGKIENFLMSLIFDALEPKENVFKAVEKFIEKKGLTISSMDKSRPWGGFFVIDENDAEKFIAEFFHHLSKDELSISGKLSPKILVVAPDKRLSWQYHHRRAEIWKLIGNEAAVTTSDTDQEKETQTLKEGDIIELKQGERHRLIGLDGWGIVAEIWRHTDAANPSDEDDIVRVQDDFGR

Samples

Sample ID Description Type Environment
1 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
60 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
61 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
65 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
96 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
97 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
112 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
113 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
114 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
119 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
120 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
121 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
122 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
128 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
129 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
130 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
138 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
145 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
146 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
147 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
148 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
149 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
150 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
151 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
152 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
153 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
154 3300060244 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 2R_CW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
156 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
157 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
158 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
159 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
160 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
161 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
162 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
163 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
164 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
165 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
166 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
167 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
168 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
169 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
170 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
171 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
172 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
173 2738541283 Pedobacter sp. OK701 Isolate Unclassified
174 2738541284 Pedobacter sp. YR016 Isolate Unclassified
175 2738541302 Pedobacter sp. CF074 Isolate Unclassified
176 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
177 2738543023 Pedobacter sp. OK628 Isolate Unclassified
178 2739367651 Pedobacter sp. OK291 Isolate Unclassified
179 2739367656 Pedobacter sp. CF523 Isolate Unclassified
180 2739367663 Pedobacter sp. YR510 Isolate Unclassified
181 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
182 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
183 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
184 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
185 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
186 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
187 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
188 2818991437 Pedobacter terrae 518 Isolate Unclassified
189 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
190 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
191 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
192 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
193 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
194 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
195 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
196 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
197 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
198 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
199 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
200 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
201 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
202 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
203 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
204 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
205 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
206 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
207 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
208 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
209 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
210 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.74
Metatranscriptomes 0.6
Isolates 16.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.52
Nodule 0.3
Rhizoplane 1.79
Rhizosphere 72.02
Stem 0
Stem Tuber 0
Unclassified 2.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495668_0000023 3300046616 Bacteria 363848
2 SwRhRL2b_contig_2842574 2162886007 Bacteria 9054
3 JGI25150J39212_1000015 3300002774 Bacteria 170613
4 JGI25151J46595_10000043 3300003187 Bacteria 170613
5 JGI25153J46596_10000009 3300003215 Bacteria 340925
6 rootH2_10086047 3300003320 Bacteria 3445
7 Ga0006562J51391_1018852 3300003578 Bacteria 1767
8 Ga0055536_1000036 3300003781 Bacteria 141730
9 Ga0055534_1014355 3300003784 Bacteria 1487
10 Ga0055530_10002778 3300003791 Bacteria 10814
11 Ga0065165_1000185 3300005262 Bacteria 108984
12 Ga0065714_10002990 3300005288 Bacteria 16592
13 Ga0065714_10003594 3300005288 Bacteria 8363
14 Ga0065714_10003882 3300005288 Bacteria 12468
15 Ga0065714_10005282 3300005288 Bacteria 8595
16 Ga0065714_10064423 3300005288 Bacteria 257266
17 Ga0065714_10073103 3300005288 Bacteria 3243
18 Ga0065714_10139112 3300005288 Bacteria 1185
19 Ga0065704_10000274 3300005289 Bacteria 54883
20 Ga0065704_10076601 3300005289 Bacteria 5046
21 Ga0065704_10081688 3300005289 Bacteria 3718
22 Ga0065704_10283658 3300005289 Bacteria 917
23 Ga0065704_10357055 3300005289 Bacteria 784
24 Ga0065704_10391369 3300005289 Bacteria 762
25 Ga0065707_10294380 3300005295 Unclassified 1018
26 Ga0070666_10822614 3300005335 Bacteria 685
27 Ga0070682_100000055 3300005337 Bacteria 112566
28 Ga0070668_100323348 3300005347 Bacteria 1299
29 Ga0070669_100290598 3300005353 Bacteria 1312
30 Ga0070669_100936764 3300005353 Bacteria 741
31 Ga0070671_101051281 3300005355 Bacteria 714
32 Ga0070673_100419867 3300005364 Bacteria 1199
33 Ga0070673_100876574 3300005364 Bacteria 831
34 Ga0070663_100060088 3300005455 Bacteria 2733
35 Ga0068867_100821793 3300005459 Bacteria 830
36 Ga0070684_100960310 3300005535 Unclassified 802
37 Ga0068853_100005104 3300005539 Bacteria 10254
38 Ga0068853_100068115 3300005539 Bacteria 3093
39 Ga0070693_100105760 3300005547 Bacteria 1722
40 Ga0068855_100079183 3300005563 Bacteria 3811
41 Ga0068855_100717589 3300005563 Bacteria 1068
42 Ga0068852_101186446 3300005616 Bacteria 784
43 Ga0068859_100001207 3300005617 Bacteria 26381
44 Ga0068859_100899138 3300005617 Bacteria 970
45 Ga0068861_100218244 3300005719 Bacteria 1610
46 Ga0068860_100333909 3300005843 Bacteria 1489
47 Ga0068862_100270346 3300005844 Bacteria 1554
48 Ga0075364_10412113 3300006051 Bacteria 922
49 Ga0097621_100003569 3300006237 Bacteria 10751
50 Ga0097621_100977507 3300006237 Bacteria 791
51 Ga0068871_100005675 3300006358 Bacteria 8756
52 Ga0068871_100069667 3300006358 Bacteria 2889
53 Ga0075428_100011211 3300006844 Bacteria 9975
54 Ga0075430_100015311 3300006846 Bacteria 6530
55 Ga0075429_101338397 3300006880 Unclassified 624
56 Ga0097620_100001207 3300006931 Bacteria 26381
57 Ga0097620_100899420 3300006931 Bacteria 970
58 Ga0105244_10000005 3300009036 Bacteria 481412
59 Ga0105240_10097028 3300009093 Bacteria 3591
60 Ga0111539_10004611 3300009094 Bacteria 18003
61 Ga0105247_10046390 3300009101 Bacteria 2667
62 Ga0114129_10094303 3300009147 Bacteria 4145
63 Ga0105243_10000021 3300009148 Bacteria 213782
64 Ga0105243_10000036 3300009148 Bacteria 176192
65 Ga0105243_10040961 3300009148 Bacteria 3621
66 Ga0105242_10199014 3300009176 Bacteria 1778
67 Ga0105237_10000610 3300009545 Bacteria 49972
68 Ga0105237_11183138 3300009545 Bacteria 771
69 Ga0105249_10001594 3300009553 Bacteria 19871
70 Ga0105249_10089361 3300009553 Bacteria 2879
71 Ga0157373_10007168 3300013100 Bacteria 8318
72 Ga0157373_10007912 3300013100 Bacteria 7911
73 Ga0157373_10303301 3300013100 Bacteria 1134
74 Ga0157373_10383481 3300013100 Bacteria 1006
75 Ga0157373_10890359 3300013100 Bacteria 660
76 Ga0157371_10000593 3300013102 Bacteria 43082
77 Ga0157371_10000676 3300013102 Bacteria 40442
78 Ga0157371_10007937 3300013102 Bacteria 8517
79 Ga0157371_10228807 3300013102 Unclassified 1336
80 Ga0157370_10001475 3300013104 Bacteria 29107
81 Ga0157370_10002146 3300013104 Bacteria 24107
82 Ga0157370_10010299 3300013104 Bacteria 9864
83 Ga0157370_10044041 3300013104 Bacteria 4293
84 Ga0157370_10052241 3300013104 Bacteria 3902
85 Ga0157370_10054638 3300013104 Bacteria 3807
86 Ga0157370_10084189 3300013104 Bacteria 2989
87 Ga0157370_10182405 3300013104 Bacteria 1950
88 Ga0157370_10271615 3300013104 Bacteria 1566
89 Ga0157370_10432204 3300013104 Bacteria 1211
90 Ga0157370_10770734 3300013104 Bacteria 876
91 Ga0157369_10000007 3300013105 Bacteria 402562
92 Ga0157369_10208985 3300013105 Bacteria 2046
93 Ga0157369_11497288 3300013105 Bacteria 686
94 Ga0157378_10042092 3300013297 Bacteria 4053
95 Ga0157378_10347370 3300013297 Bacteria 1448
96 Ga0163162_10000063 3300013306 Bacteria 104222
97 Ga0157375_10074820 3300013308 Bacteria 3409
98 Ga0157375_10118392 3300013308 Bacteria 2755
99 Ga0157375_11489728 3300013308 Bacteria 798
100 Ga0157375_11807426 3300013308 Bacteria 725
101 Ga0157375_12903898 3300013308 Bacteria 573
102 Ga0157380_10050255 3300014326 Bacteria 3292
103 Ga0157380_10140072 3300014326 Bacteria 2077
104 Ga0157380_10607018 3300014326 Bacteria 1083
105 Ga0182008_10000014 3300014497 Bacteria 263844
106 Ga0182008_10000067 3300014497 Bacteria 87826
107 Ga0182008_10001905 3300014497 Bacteria 13497
108 Ga0182008_10010738 3300014497 Bacteria 4893
109 Ga0182008_10020756 3300014497 Bacteria 3379
110 Ga0182008_10040931 3300014497 Bacteria 2312
111 Ga0157379_11623690 3300014968 Bacteria 632
112 Ga0157376_10927861 3300014969 Bacteria 890
113 Ga0182006_1000001 3300015261 Bacteria 1091090
114 Ga0182006_1000130 3300015261 Bacteria 80841
115 Ga0182006_1000451 3300015261 Bacteria 32513
116 Ga0182006_1000560 3300015261 Bacteria 27890
117 Ga0182006_1005775 3300015261 Bacteria 5837
118 Ga0182006_1011750 3300015261 Bacteria 3842
119 Ga0182007_10000007 3300015262 Bacteria 376596
120 Ga0182007_10007181 3300015262 Bacteria 4699
121 Ga0182007_10035764 3300015262 Bacteria 1673
122 Ga0182007_10054977 3300015262 Bacteria 1309
123 Ga0183373_1001 3300015682 Bacteria 1410374
124 Ga0163161_10000045 3300017792 Bacteria 130284
125 Ga0163161_10000459 3300017792 Bacteria 33784
126 Ga0163161_10019820 3300017792 Bacteria 4719
127 Ga0163161_10027773 3300017792 Bacteria 4015
128 Ga0163161_10078982 3300017792 Unclassified 2419
129 Ga0163161_10388743 3300017792 Bacteria 1116
130 Ga0163161_11575695 3300017792 Bacteria 579
131 Ga0207425_1000023 3300025245 Bacteria 341339
132 Ga0209129_1000032 3300025258 Bacteria 341150
133 Ga0209675_1000066 3300025291 Bacteria 171883
134 Ga0209676_1000008 3300025292 Bacteria 991778
135 Ga0209676_1000810 3300025292 Bacteria 40868
136 Ga0209025_1000047 3300025294 Bacteria 341150
137 Ga0209758_1000144 3300025297 Bacteria 170724
138 Ga0209050_1000180 3300025298 Bacteria 142987
139 Ga0209050_1002517 3300025298 Bacteria 15414
140 Ga0209050_1050130 3300025298 Bacteria 1064
141 Ga0207426_1095198 3300025302 Bacteria 780
142 Ga0209051_1094044 3300025303 Bacteria 825
143 Ga0207655_1000016 3300025728 Bacteria 551476
144 Ga0207680_10438394 3300025903 Bacteria 926
145 Ga0207695_10197386 3300025913 Bacteria 1928
146 Ga0207671_10009308 3300025914 Bacteria 8224
147 Ga0207671_10886960 3300025914 Bacteria 705
148 Ga0207657_10004066 3300025919 Bacteria 15521
149 Ga0207681_10129570 3300025923 Bacteria 1863
150 Ga0207681_10692142 3300025923 Bacteria 847
151 Ga0207659_10173857 3300025926 Bacteria 1701
152 Ga0207644_11068801 3300025931 Bacteria 678
153 Ga0207709_10000007 3300025935 Bacteria 752025
154 Ga0207709_10000120 3300025935 Bacteria 119178
155 Ga0207709_10039797 3300025935 Bacteria 2810
156 Ga0207712_10004147 3300025961 Bacteria 9152
157 Ga0207712_10153436 3300025961 Bacteria 1781
158 Ga0207668_10016037 3300025972 Bacteria 4667
159 Ga0207640_10171962 3300025981 Bacteria 1615
160 Ga0207658_10164137 3300025986 Bacteria 1823
161 Ga0207677_10853076 3300026023 Bacteria 818
162 Ga0207639_10192455 3300026041 Bacteria 1743
163 Ga0207678_10158821 3300026067 Bacteria 1931
164 Ga0207641_10167212 3300026088 Bacteria 2004
165 Ga0207648_10236982 3300026089 Bacteria 1624
166 Ga0207648_10561724 3300026089 Bacteria 1049
167 Ga0207675_100013848 3300026118 Bacteria 7520
168 Ga0207698_10422185 3300026142 Bacteria 1280
169 Ga0207428_10202711 3300027907 Bacteria 1492
170 Ga0268264_10200391 3300028381 Bacteria 1826
171 Ga0268264_10291375 3300028381 Bacteria 1533
172 Ga0307515_10000001 3300028794 Bacteria 4259510
173 Ga0307515_10100534 3300028794 Bacteria 3500
174 Ga0316176_1183762 3300030732 Bacteria 11557
175 Ga0316183_1025240 3300030742 Bacteria 70534
176 Ga0316181_1138579 3300030744 Bacteria 997
177 Ga0316181_1244711 3300030744 Bacteria 1863
178 Ga0316181_1268099 3300030744 Unclassified 781
179 Ga0265327_10000024 3300031251 Bacteria 382499
180 Ga0307513_10084339 3300031456 Bacteria 3264
181 Ga0307513_10606064 3300031456 Unclassified 804
182 Ga0307408_100127197 3300031548 Bacteria 1983
183 Ga0307408_101917589 3300031548 Bacteria 568
184 Ga0307405_10000003 3300031731 Bacteria 569064
185 Ga0307405_10048310 3300031731 Bacteria 2623
186 Ga0307405_10424781 3300031731 Bacteria 1047
187 Ga0307406_10775837 3300031901 Bacteria 807
188 Ga0307407_10000025 3300031903 Bacteria 112811
189 Ga0307412_10000027 3300031911 Bacteria 214663
190 Ga0307412_10000068 3300031911 Bacteria 113739
191 Ga0307412_10037609 3300031911 Bacteria 3111
192 Ga0307412_10087314 3300031911 Bacteria 2173
193 Ga0307412_10390443 3300031911 Bacteria 1130
194 Ga0307412_10399274 3300031911 Bacteria 1119
195 Ga0307412_11645955 3300031911 Bacteria 587
196 Ga0307412_11734632 3300031911 Bacteria 573
197 Ga0307409_100403619 3300031995 Bacteria 1306
198 Ga0307416_100000080 3300032002 Bacteria 70510
199 Ga0307414_10002590 3300032004 Bacteria 9514
200 Ga0307414_10003976 3300032004 Bacteria 7975
201 Ga0307414_10006461 3300032004 Bacteria 6538
202 Ga0307414_10012765 3300032004 Bacteria 4982
203 Ga0307414_10023778 3300032004 Bacteria 3893
204 Ga0307414_10061905 3300032004 Bacteria 2653
205 Ga0307414_10086819 3300032004 Bacteria 2309
206 Ga0307414_10090635 3300032004 Bacteria 2270
207 Ga0307414_10131605 3300032004 Bacteria 1943
208 Ga0307414_10413213 3300032004 Bacteria 1175
209 Ga0307414_10550117 3300032004 Bacteria 1028
210 Ga0307414_10617764 3300032004 Bacteria 974
211 Ga0307414_10739239 3300032004 Bacteria 893
212 Ga0307411_10224829 3300032005 Bacteria 1459
213 Ga0373927_0031345 3300035695 Bacteria 3466
214 Ga0395900_0239085 3300037418 Unclassified 1823
215 Ga0451791_0080126 3300041451 Unclassified 594
216 Ga0451802_0377417 3300041460 Bacteria 768
217 Ga0451841_0478575 3300041498 Bacteria 646
218 Ga0495627_046640 3300046453 Bacteria 1316
219 Ga0495592_0524705 3300046454 Bacteria 732
220 Ga0495596_0003431 3300046500 Bacteria 8020
221 Ga0495606_0009950 3300046507 Bacteria 7955
222 Ga0495610_0000005 3300046512 Bacteria 924111
223 Ga0495610_0000245 3300046512 Bacteria 57208
224 Ga0495610_0003845 3300046512 Bacteria 11414
225 Ga0495663_0000323 3300046525 Bacteria 17905
226 Ga0495663_0131326 3300046525 Bacteria 845
227 Ga0495598_0168910 3300046537 Bacteria 774
228 Ga0495621_0112689 3300046539 Bacteria 1044
229 Ga0495633_0121484 3300046558 Bacteria 1210
230 Ga0495686_0206841 3300047472 Bacteria 1123
231 Ga0496102_0139066 3300048905 Bacteria 2276
232 Ga0496113_0016131 3300048916 Bacteria 5156
233 Ga0496115_0223181 3300048918 Bacteria 1555
234 Ga0496115_0644587 3300048918 Bacteria 838
235 Ga0496116_0000029 3300048919 Bacteria 422187
236 Ga0496116_0002245 3300048919 Bacteria 20539
237 Ga0496116_0390557 3300048919 Bacteria 620
238 Ga0496117_0000007 3300048920 Bacteria 720505
239 Ga0496117_0002421 3300048920 Bacteria 23637
240 Ga0496118_0000104 3300048921 Bacteria 157435
241 Ga0496119_0000007 3300048922 Bacteria 475920
242 Ga0496121_0572240 3300048924 Bacteria 703
243 Ga0496122_0000089 3300048925 Bacteria 206107
244 Ga0496122_0000151 3300048925 Bacteria 162224
245 Ga0496122_0000153 3300048925 Bacteria 161087
246 Ga0496122_0001684 3300048925 Bacteria 34265
247 Ga0496122_0003333 3300048925 Bacteria 21205
248 Ga0496122_0007170 3300048925 Bacteria 12488
249 Ga0496122_0024728 3300048925 Bacteria 5246
250 Ga0496123_0001269 3300048926 Bacteria 36177
251 Ga0496123_0003573 3300048926 Bacteria 17243
252 Ga0496123_0006426 3300048926 Bacteria 11391
253 Ga0496123_0026755 3300048926 Bacteria 4313
254 Ga0496124_0001030 3300048927 Bacteria 44126
255 Ga0496125_0002635 3300048928 Bacteria 22978
256 Ga0496125_0014052 3300048928 Bacteria 7825
257 Ga0496125_0047298 3300048928 Bacteria 3600
258 Ga0496125_0079095 3300048928 Bacteria 2524
259 Ga0496126_0002751 3300048929 Bacteria 23221
260 Ga0496126_0381744 3300048929 Bacteria 1147
261 Ga0501217_163404 3300049661 Bacteria 673
262 Ga0501241_000466 3300049758 Bacteria 8785
263 Ga0501241_079791 3300049758 Bacteria 680
264 nmdc:mga00v17_377933_c1 3300050491 Bacteria 921
265 nmdc:mga05p37_99505_c1 3300050507 Bacteria 3581
266 nmdc:mga0qj67_214318_c1 3300050509 Bacteria 1564
267 nmdc:mga06r32_333521_c1 3300050510 Bacteria 1502
268 nmdc:mga08y16_10696_c1 3300050511 Bacteria 9628
269 Ga0500651_0000210 3300053093 Bacteria 36797
270 Ga0500641_0146683 3300053096 Bacteria 1019
271 Ga0500562_011619 3300053108 Bacteria 2235
272 Ga0500618_005531 3300053125 Bacteria 3824
273 Ga0500628_110160 3300053129 Bacteria 738
274 Ga0500655_003914 3300053133 Unclassified 2687
275 Ga0500658_0375383 3300053134 Bacteria 652
276 Ga0500604_0000199 3300053151 Bacteria 17062
277 Ga0500622_0000032 3300053156 Bacteria 205634
278 Ga0500622_0000036 3300053156 Bacteria 181221
279 Ga0500627_0050487 3300053158 Bacteria 1812
280 Ga0587061_01413 3300060244 Bacteria 946
281 2511231356 2511231000 Bacteria 4488346
282 2522552752 2522125168 Bacteria 7376607
283 2585141091 2582581278 Bacteria 5296881
284 2585157376 2582581281 Bacteria 4487904
285 2585161645 2582581282 Bacteria 4495830
286 2586208155 2585427687 Bacteria 5544917
287 2587677021 2585428045 Bacteria 5203023
288 2587746453 2585428060 Bacteria 5304711
289 2588211284 2585428182 Bacteria 5007281
290 2588215655 2585428183 Bacteria 5166119
291 2588219065 2585428184 Bacteria 4978681
292 2588224560 2585428185 Bacteria 4969476
293 2588447345 2588253712 Bacteria 5403181
294 2590602982 2588254255 Bacteria 5014294
295 2590609985 2588254257 Bacteria 5436094
296 2722730499 2721755487 Bacteria 6357185
297 2729201017 2728369107 Bacteria 5082720
298 2738699686 2738541273 Bacteria 4048577
299 2738756828 2738541283 Bacteria 7222293
300 2738760073 2738541284 Bacteria 5199923
301 2738855301 2738541302 Bacteria 5944758
302 2739253435 2738543014 Bacteria 4048139
303 2739305199 2738543023 Bacteria 6767879
304 2739589280 2739367651 Bacteria 6359826
305 2739614076 2739367656 Bacteria 5152243
306 2739647018 2739367663 Bacteria 5040914
307 2740034443 2739367866 Bacteria 4215900
308 2740060217 2739367874 Bacteria 4872888
309 2753674005 2751185877 Bacteria 4921427
310 2765575469 2765235839 Bacteria 5314748
311 2772604956 2772190705 Bacteria 4666226
312 2776612051 2775506987 Bacteria 5373360
313 2816875313 2816332188 Bacteria 5133218
314 2819546751 2818991437 Bacteria 5805520
315 2842087168 2842083920 Bacteria 4857652
316 2842725495 2842722452 Bacteria 6263924
317 2842904741 2842903701 Bacteria 6986368
318 2842914638 2842909656 Bacteria 6185908
319 2849282067 2849281842 Bacteria 6065644
320 2852631765 2852627209 Bacteria 5896285
321 2857629422 2857627736 Bacteria 5625397
322 2871722655 2871720351 Bacteria 4862476
323 2889294024 2889290771 Bacteria 5530962
324 2896345517 2896344016 Bacteria 3811746
325 2902052501 2902048731 Bacteria 4976191
326 2904446923 2904445276 Bacteria 5310396
327 2904785508 2904780799 Bacteria 5840761
328 2905999203 2905999023 Bacteria 4591259
329 2919182055 2919177583 Bacteria 5641607
330 2919191383 2919186247 Bacteria 6244071
331 2919401469 2919399522 Bacteria 5164947
332 2939669698 2939664404 Bacteria 6364494
333 2946002479 2945997725 Bacteria 6404843
334 2954019353 2954016120 Bacteria 6446024
335 3003235757 3003233435 Bacteria 4458031
336 8055589994 8055588893 Bacteria 3619545
337 Ga0495668_0000023
338 SwRhRL2b_contig_2842574
339 JGI25150J39212_1000015
340 JGI25151J46595_10000043
341 JGI25153J46596_10000009
342 rootH2_10086047
343 Ga0006562J51391_1018852
344 Ga0055536_1000036
345 Ga0055534_1014355
346 Ga0055530_10002778
347 Ga0065165_1000185
348 Ga0065714_10002990
349 Ga0065714_10003594
350 Ga0065714_10003882
351 Ga0065714_10005282
352 Ga0065714_10064423
353 Ga0065714_10073103
354 Ga0065714_10139112
355 Ga0065704_10000274
356 Ga0065704_10076601
357 Ga0065704_10081688
358 Ga0065704_10283658
359 Ga0065704_10357055
360 Ga0065704_10391369
361 Ga0065707_10294380
362 Ga0070666_10822614
363 Ga0070682_100000055
364 Ga0070668_100323348
365 Ga0070669_100290598
366 Ga0070669_100936764
367 Ga0070671_101051281
368 Ga0070673_100419867
369 Ga0070673_100876574
370 Ga0070663_100060088
371 Ga0068867_100821793
372 Ga0070684_100960310
373 Ga0068853_100005104
374 Ga0068853_100068115
375 Ga0070693_100105760
376 Ga0068855_100079183
377 Ga0068855_100717589
378 Ga0068852_101186446
379 Ga0068859_100001207
380 Ga0068859_100899138
381 Ga0068861_100218244
382 Ga0068860_100333909
383 Ga0068862_100270346
384 Ga0075364_10412113
385 Ga0097621_100003569
386 Ga0097621_100977507
387 Ga0068871_100005675
388 Ga0068871_100069667
389 Ga0075428_100011211
390 Ga0075430_100015311
391 Ga0075429_101338397
392 Ga0097620_100001207
393 Ga0097620_100899420
394 Ga0105244_10000005
395 Ga0105240_10097028
396 Ga0111539_10004611
397 Ga0105247_10046390
398 Ga0114129_10094303
399 Ga0105243_10000021
400 Ga0105243_10000036
401 Ga0105243_10040961
402 Ga0105242_10199014
403 Ga0105237_10000610
404 Ga0105237_11183138
405 Ga0105249_10001594
406 Ga0105249_10089361
407 Ga0157373_10007168
408 Ga0157373_10007912
409 Ga0157373_10303301
410 Ga0157373_10383481
411 Ga0157373_10890359
412 Ga0157371_10000593
413 Ga0157371_10000676
414 Ga0157371_10007937
415 Ga0157371_10228807
416 Ga0157370_10001475
417 Ga0157370_10002146
418 Ga0157370_10010299
419 Ga0157370_10044041
420 Ga0157370_10052241
421 Ga0157370_10054638
422 Ga0157370_10084189
423 Ga0157370_10182405
424 Ga0157370_10271615
425 Ga0157370_10432204
426 Ga0157370_10770734
427 Ga0157369_10000007
428 Ga0157369_10208985
429 Ga0157369_11497288
430 Ga0157378_10042092
431 Ga0157378_10347370
432 Ga0163162_10000063
433 Ga0157375_10074820
434 Ga0157375_10118392
435 Ga0157375_11489728
436 Ga0157375_11807426
437 Ga0157375_12903898
438 Ga0157380_10050255
439 Ga0157380_10140072
440 Ga0157380_10607018
441 Ga0182008_10000014
442 Ga0182008_10000067
443 Ga0182008_10001905
444 Ga0182008_10010738
445 Ga0182008_10020756
446 Ga0182008_10040931
447 Ga0157379_11623690
448 Ga0157376_10927861
449 Ga0182006_1000001
450 Ga0182006_1000130
451 Ga0182006_1000451
452 Ga0182006_1000560
453 Ga0182006_1005775
454 Ga0182006_1011750
455 Ga0182007_10000007
456 Ga0182007_10007181
457 Ga0182007_10035764
458 Ga0182007_10054977
459 Ga0183373_1001
460 Ga0163161_10000045
461 Ga0163161_10000459
462 Ga0163161_10019820
463 Ga0163161_10027773
464 Ga0163161_10078982
465 Ga0163161_10388743
466 Ga0163161_11575695
467 Ga0207425_1000023
468 Ga0209129_1000032
469 Ga0209675_1000066
470 Ga0209676_1000008
471 Ga0209676_1000810
472 Ga0209025_1000047
473 Ga0209758_1000144
474 Ga0209050_1000180
475 Ga0209050_1002517
476 Ga0209050_1050130
477 Ga0207426_1095198
478 Ga0209051_1094044
479 Ga0207655_1000016
480 Ga0207680_10438394
481 Ga0207695_10197386
482 Ga0207671_10009308
483 Ga0207671_10886960
484 Ga0207657_10004066
485 Ga0207681_10129570
486 Ga0207681_10692142
487 Ga0207659_10173857
488 Ga0207644_11068801
489 Ga0207709_10000007
490 Ga0207709_10000120
491 Ga0207709_10039797
492 Ga0207712_10004147
493 Ga0207712_10153436
494 Ga0207668_10016037
495 Ga0207640_10171962
496 Ga0207658_10164137
497 Ga0207677_10853076
498 Ga0207639_10192455
499 Ga0207678_10158821
500 Ga0207641_10167212
501 Ga0207648_10236982
502 Ga0207648_10561724
503 Ga0207675_100013848
504 Ga0207698_10422185
505 Ga0207428_10202711
506 Ga0268264_10200391
507 Ga0268264_10291375
508 Ga0307515_10000001
509 Ga0307515_10100534
510 Ga0316176_1183762
511 Ga0316183_1025240
512 Ga0316181_1138579
513 Ga0316181_1244711
514 Ga0316181_1268099
515 Ga0265327_10000024
516 Ga0307513_10084339
517 Ga0307513_10606064
518 Ga0307408_100127197
519 Ga0307408_101917589
520 Ga0307405_10000003
521 Ga0307405_10048310
522 Ga0307405_10424781
523 Ga0307406_10775837
524 Ga0307407_10000025
525 Ga0307412_10000027
526 Ga0307412_10000068
527 Ga0307412_10037609
528 Ga0307412_10087314
529 Ga0307412_10390443
530 Ga0307412_10399274
531 Ga0307412_11645955
532 Ga0307412_11734632
533 Ga0307409_100403619
534 Ga0307416_100000080
535 Ga0307414_10002590
536 Ga0307414_10003976
537 Ga0307414_10006461
538 Ga0307414_10012765
539 Ga0307414_10023778
540 Ga0307414_10061905
541 Ga0307414_10086819
542 Ga0307414_10090635
543 Ga0307414_10131605
544 Ga0307414_10413213
545 Ga0307414_10550117
546 Ga0307414_10617764
547 Ga0307414_10739239
548 Ga0307411_10224829
549 Ga0373927_0031345
550 Ga0395900_0239085
551 Ga0451791_0080126
552 Ga0451802_0377417
553 Ga0451841_0478575
554 Ga0495627_046640
555 Ga0495592_0524705
556 Ga0495596_0003431
557 Ga0495606_0009950
558 Ga0495610_0000005
559 Ga0495610_0000245
560 Ga0495610_0003845
561 Ga0495663_0000323
562 Ga0495663_0131326
563 Ga0495598_0168910
564 Ga0495621_0112689
565 Ga0495633_0121484
566 Ga0495686_0206841
567 Ga0496102_0139066
568 Ga0496113_0016131
569 Ga0496115_0223181
570 Ga0496115_0644587
571 Ga0496116_0000029
572 Ga0496116_0002245
573 Ga0496116_0390557
574 Ga0496117_0000007
575 Ga0496117_0002421
576 Ga0496118_0000104
577 Ga0496119_0000007
578 Ga0496121_0572240
579 Ga0496122_0000089
580 Ga0496122_0000151
581 Ga0496122_0000153
582 Ga0496122_0001684
583 Ga0496122_0003333
584 Ga0496122_0007170
585 Ga0496122_0024728
586 Ga0496123_0001269
587 Ga0496123_0003573
588 Ga0496123_0006426
589 Ga0496123_0026755
590 Ga0496124_0001030
591 Ga0496125_0002635
592 Ga0496125_0014052
593 Ga0496125_0047298
594 Ga0496125_0079095
595 Ga0496126_0002751
596 Ga0496126_0381744
597 Ga0501217_163404
598 Ga0501241_000466
599 Ga0501241_079791
600 nmdc:mga00v17_377933_c1
601 nmdc:mga05p37_99505_c1
602 nmdc:mga0qj67_214318_c1
603 nmdc:mga06r32_333521_c1
604 nmdc:mga08y16_10696_c1
605 Ga0500651_0000210
606 Ga0500641_0146683
607 Ga0500562_011619
608 Ga0500618_005531
609 Ga0500628_110160
610 Ga0500655_003914
611 Ga0500658_0375383
612 Ga0500604_0000199
613 Ga0500622_0000032
614 Ga0500622_0000036
615 Ga0500627_0050487
616 Ga0587061_01413
617 2511231356
618 2522552752
619 2585141091
620 2585157376
621 2585161645
622 2586208155
623 2587677021
624 2587746453
625 2588211284
626 2588215655
627 2588219065
628 2588224560
629 2588447345
630 2590602982
631 2590609985
632 2722730499
633 2729201017
634 2738699686
635 2738756828
636 2738760073
637 2738855301
638 2739253435
639 2739305199
640 2739589280
641 2739614076
642 2739647018
643 2740034443
644 2740060217
645 2753674005
646 2765575469
647 2772604956
648 2776612051
649 2816875313
650 2819546751
651 2842087168
652 2842725495
653 2842904741
654 2842914638
655 2849282067
656 2852631765
657 2857629422
658 2871722655
659 2889294024
660 2896345517
661 2902052501
662 2904446923
663 2904785508
664 2905999203
665 2919182055
666 2919191383
667 2919401469
668 2939669698
669 2946002479
670 2954019353
671 3003235757
672 8055589994

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01050

MannoseP_isomer

Mannose-6-phosphate isomerase C-terminal

79

190

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2phd-assembly1.cif.gz_B crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.9477 65 143
6o2d-assembly1.cif.gz_B schizosaccharomyces pombe cnp3 cupin domain 0.9156 65 144
5wsf-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii 0.8972 65 142
5wse-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i 0.897 65 142
6l2f-assembly1.cif.gz_B crystal structure of a cupin protein (tm1459, h54ah58a mutant) in copper (cu) substituted form 0.8962 65 142
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9238 62 158 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.919 65 144 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9176 65 143 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9037 65 143 2.60.120.10
2dctB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9002 62 144 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A520B5E3-F1-model_v4 Phosphoheptose isomerase 0.987 1 138 GO:0005976
GO:0016779
GO:0016853
AF-A0A351PWS3-F1-model_v4 deleted 0.9751 4 165
AF-A0A520B5E3-F1-model_v4 Phosphoheptose isomerase 0.973 1 138 GO:0005976
GO:0016779
GO:0016853
AF-A0A351PWS3-F1-model_v4 deleted 0.9633 4 165
AF-A0A351BZX0-F1-model_v4 Phosphoheptose isomerase 0.9604 5 165 GO:0005976
GO:0016779
GO:0016853

Map