F412807

General Info

Members Datasets Scaffolds Average Seq Length
336 217 672 131

Family's Representative Sequence

Representative Sequence 3300046683|Ga0495658_0001961|Ga0495658_0001961_2305_2766
Length 153
Sequence LSFRSLSEQRLNHTLAITRLPGMSEQGQIARRSIGIVFSDGGLLALTSELPRGGAGIDDEQVTAVLCDPDGAPLTFEETLLSTEYGEDGVQRRATLELWPSVEEMRPLRGAGSLISSVRVRREGLDSQIAFFRWAVEGREGLGTYEVARTVDD

Samples

Sample ID Description Type Environment
1 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
114 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
122 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
123 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
124 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
125 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
132 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
141 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
178 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
208 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
212 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
213 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
214 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
215 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.08
Nodule 0
Rhizoplane 11.61
Rhizosphere 79.46
Stem 0
Stem Tuber 0
Unclassified 4.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495658_0001961 3300046683 Bacteria 10521
2 LJNas_1007353 3300000546 Bacteria 1189
3 JGI24740J21852_10010899 3300001979 Bacteria 3477
4 JGI24748J21848_1000342 3300002074 Bacteria 5373
5 JGI24034J26672_10000196 3300002239 Bacteria 8101
6 JGI24742J22300_10000222 3300002244 Bacteria 8493
7 rootH2_10229049 3300003320 Unclassified 2828
8 Ga0070658_10436717 3300005327 Bacteria 1127
9 Ga0070683_100000502 3300005329 Bacteria 27604
10 Ga0070683_100000527 3300005329 Bacteria 26899
11 Ga0070683_100409722 3300005329 Bacteria 1293
12 Ga0068869_101731186 3300005334 Bacteria 558
13 Ga0070682_100000061 3300005337 Bacteria 105134
14 Ga0068868_100000220 3300005338 Bacteria 38739
15 Ga0070689_100327175 3300005340 Bacteria 1281
16 Ga0070691_10000013 3300005341 Bacteria 50559
17 Ga0070691_10000169 3300005341 Bacteria 21336
18 Ga0070661_100000110 3300005344 Bacteria 68106
19 Ga0070661_100348030 3300005344 Bacteria 1162
20 Ga0070692_10042484 3300005345 Bacteria 2334
21 Ga0070668_100011266 3300005347 Bacteria 6658
22 Ga0070668_100058968 3300005347 Bacteria 2971
23 Ga0070675_100000091 3300005354 Bacteria 52149
24 Ga0070674_100000030 3300005356 Bacteria 69481
25 Ga0070688_100000053 3300005365 Bacteria 55064
26 Ga0070688_100000918 3300005365 Bacteria 14725
27 Ga0070688_100611627 3300005365 Bacteria 835
28 Ga0070659_100368008 3300005366 Bacteria 1209
29 Ga0070667_100009466 3300005367 Bacteria 8081
30 Ga0070714_100039823 3300005435 Bacteria 3959
31 Ga0070713_100000023 3300005436 Bacteria 98528
32 Ga0070713_100268303 3300005436 Bacteria 1562
33 Ga0070711_100271011 3300005439 Bacteria 1339
34 Ga0070678_100020905 3300005456 Bacteria 4303
35 Ga0070685_10000032 3300005466 Bacteria 84253
36 Ga0070685_10000086 3300005466 Bacteria 57017
37 Ga0070685_10101986 3300005466 Bacteria 1754
38 Ga0070684_100087613 3300005535 Bacteria 2764
39 Ga0070684_100172963 3300005535 Bacteria 1962
40 Ga0070684_100708063 3300005535 Bacteria 939
41 Ga0070672_100000005 3300005543 Bacteria 121014
42 Ga0070686_100456419 3300005544 Bacteria 983
43 Ga0070665_100108613 3300005548 Bacteria 2777
44 Ga0070665_100728122 3300005548 Bacteria 1005
45 Ga0068855_100048599 3300005563 Bacteria 5006
46 Ga0068854_100004036 3300005578 Bacteria 9217
47 Ga0068856_100001228 3300005614 Bacteria 26877
48 Ga0068856_100014788 3300005614 Bacteria 7534
49 Ga0068856_101549391 3300005614 Unclassified 676
50 Ga0070702_100128161 3300005615 Bacteria 1599
51 Ga0068852_100000037 3300005616 Bacteria 97602
52 Ga0068859_100427862 3300005617 Bacteria 1420
53 Ga0068859_101256087 3300005617 Unclassified 816
54 Ga0068864_100000043 3300005618 Bacteria 162928
55 Ga0068866_10000005 3300005718 Bacteria 196339
56 Ga0068866_10000130 3300005718 Bacteria 33217
57 Ga0068851_10000372 3300005834 Bacteria 20278
58 Ga0068870_10625888 3300005840 Unclassified 734
59 Ga0068863_100017589 3300005841 Bacteria 6848
60 Ga0068863_100093058 3300005841 Bacteria 2861
61 Ga0068863_100153338 3300005841 Bacteria 2205
62 Ga0068858_100425332 3300005842 Unclassified 1277
63 Ga0068860_100247554 3300005843 Bacteria 1735
64 Ga0068862_100000366 3300005844 Bacteria 49032
65 Ga0081455_10043693 3300005937 Bacteria 3916
66 Ga0081540_1000046 3300005983 Bacteria 131375
67 Ga0081539_10001074 3300005985 Bacteria 49797
68 Ga0070712_100031210 3300006175 Bacteria 3588
69 Ga0097621_101257464 3300006237 Bacteria 698
70 Ga0075430_100100132 3300006846 Bacteria 2420
71 Ga0068865_100000081 3300006881 Bacteria 51047
72 Ga0068865_100507015 3300006881 Bacteria 1007
73 Ga0097620_100427874 3300006931 Bacteria 1420
74 Ga0097620_101255923 3300006931 Unclassified 816
75 Ga0105245_10000303 3300009098 Bacteria 47259
76 Ga0105245_10114305 3300009098 Bacteria 2514
77 Ga0105245_13075908 3300009098 Bacteria 517
78 Ga0105247_10000148 3300009101 Bacteria 68936
79 Ga0105247_10125827 3300009101 Bacteria 1666
80 Ga0105247_10133889 3300009101 Bacteria 1618
81 Ga0105241_10798017 3300009174 Bacteria 869
82 Ga0105242_10000052 3300009176 Bacteria 79244
83 Ga0105242_10001217 3300009176 Bacteria 20313
84 Ga0105242_10012891 3300009176 Bacteria 6443
85 Ga0105242_10230516 3300009176 Bacteria 1659
86 Ga0105248_10000017 3300009177 Bacteria 298089
87 Ga0105248_10522237 3300009177 Bacteria 1339
88 Ga0105238_11388238 3300009551 Bacteria 729
89 Ga0105249_10000916 3300009553 Bacteria 26081
90 Ga0105249_10454881 3300009553 Bacteria 1319
91 Ga0099796_10428672 3300010159 Unclassified 585
92 Ga0105239_10022212 3300010375 Bacteria 6993
93 Ga0157371_10002739 3300013102 Bacteria 16585
94 Ga0157370_10003677 3300013104 Bacteria 17915
95 Ga0157370_10472288 3300013104 Bacteria 1153
96 Ga0157369_10000105 3300013105 Bacteria 117996
97 Ga0157378_10036731 3300013297 Bacteria 4335
98 Ga0157378_10047863 3300013297 Bacteria 3802
99 Ga0157378_10061322 3300013297 Bacteria 3356
100 Ga0163162_10577697 3300013306 Bacteria 1251
101 Ga0163162_11365937 3300013306 Bacteria 806
102 Ga0157372_10000284 3300013307 Bacteria 56386
103 Ga0157375_10000620 3300013308 Bacteria 31506
104 Ga0157375_10000945 3300013308 Bacteria 25164
105 Ga0157375_12999082 3300013308 Unclassified 564
106 Ga0163163_10272169 3300014325 Bacteria 1745
107 Ga0157380_10000186 3300014326 Bacteria 35981
108 Ga0157380_10786076 3300014326 Bacteria 967
109 Ga0157379_10727553 3300014968 Bacteria 933
110 Ga0157376_10097609 3300014969 Bacteria 2560
111 Ga0157376_10737699 3300014969 Bacteria 993
112 Ga0163161_10014293 3300017792 Bacteria 5526
113 Ga0207656_10000244 3300025321 Bacteria 18974
114 Ga0207642_10000005 3300025899 Bacteria 401934
115 Ga0207642_10000047 3300025899 Bacteria 35336
116 Ga0207710_10000096 3300025900 Bacteria 116063
117 Ga0207705_10031630 3300025909 Bacteria 3779
118 Ga0207654_10148892 3300025911 Bacteria 1500
119 Ga0207693_10043212 3300025915 Bacteria 3546
120 Ga0207663_10142308 3300025916 Bacteria 1672
121 Ga0207649_10000015 3300025920 Bacteria 245662
122 Ga0207650_10289809 3300025925 Bacteria 1335
123 Ga0207659_10000707 3300025926 Bacteria 19793
124 Ga0207687_10000040 3300025927 Bacteria 113598
125 Ga0207687_10011372 3300025927 Bacteria 5817
126 Ga0207700_10000003 3300025928 Bacteria 500797
127 Ga0207664_10311671 3300025929 Bacteria 1386
128 Ga0207690_10006804 3300025932 Bacteria 6781
129 Ga0207686_10000119 3300025934 Bacteria 64297
130 Ga0207686_10001615 3300025934 Bacteria 12620
131 Ga0207686_10010792 3300025934 Bacteria 4979
132 Ga0207686_10051942 3300025934 Bacteria 2556
133 Ga0207669_10000029 3300025937 Bacteria 88351
134 Ga0207669_10000047 3300025937 Bacteria 60937
135 Ga0207704_10000018 3300025938 Bacteria 153994
136 Ga0207704_10357170 3300025938 Bacteria 1140
137 Ga0207691_10000028 3300025940 Bacteria 121090
138 Ga0207711_10000011 3300025941 Bacteria 518817
139 Ga0207661_10000391 3300025944 Bacteria 28421
140 Ga0207661_10000438 3300025944 Bacteria 26840
141 Ga0207661_10013749 3300025944 Bacteria 5911
142 Ga0207667_10034807 3300025949 Bacteria 5406
143 Ga0207712_10000994 3300025961 Bacteria 20219
144 Ga0207668_10004404 3300025972 Bacteria 8272
145 Ga0207668_10367965 3300025972 Bacteria 1206
146 Ga0207640_10000954 3300025981 Bacteria 16092
147 Ga0207658_10050400 3300025986 Bacteria 3063
148 Ga0207658_10231307 3300025986 Bacteria 1561
149 Ga0207677_10000929 3300026023 Bacteria 16369
150 Ga0207703_10000030 3300026035 Bacteria 199014
151 Ga0207703_10046470 3300026035 Bacteria 3496
152 Ga0207703_10316601 3300026035 Bacteria 1428
153 Ga0207678_10149046 3300026067 Bacteria 1997
154 Ga0207678_10981891 3300026067 Bacteria 747
155 Ga0207708_10049477 3300026075 Bacteria 3200
156 Ga0207702_10000419 3300026078 Bacteria 48574
157 Ga0207702_10003974 3300026078 Bacteria 13277
158 Ga0207641_10018672 3300026088 Bacteria 5685
159 Ga0207641_10322071 3300026088 Bacteria 1466
160 Ga0207676_10000042 3300026095 Bacteria 163475
161 Ga0207675_100230213 3300026118 Bacteria 1788
162 Ga0207683_10012181 3300026121 Bacteria 7341
163 Ga0207698_10000015 3300026142 Bacteria 207368
164 Ga0268266_10279837 3300028379 Bacteria 1551
165 Ga0268266_10595233 3300028379 Bacteria 1062
166 Ga0268265_10003823 3300028380 Bacteria 10667
167 Ga0268264_10161901 3300028381 Bacteria 2017
168 Ga0265319_1000010 3300028563 Bacteria 188773
169 Ga0265336_10021567 3300028666 Bacteria 2058
170 Ga0265338_10000051 3300028800 Bacteria 211202
171 Ga0265324_10082465 3300029957 Bacteria 1094
172 Ga0265332_10321690 3300031238 Bacteria 638
173 Ga0265325_10055330 3300031241 Bacteria 2029
174 Ga0265331_10045209 3300031250 Bacteria 2126
175 Ga0307415_100008478 3300032126 Bacteria 5701
176 Ga0451791_1330042 3300041451 Bacteria 723
177 Ga0451804_0496889 3300041463 Bacteria 853
178 Ga0451807_2483056 3300041486 Bacteria 1768
179 Ga0451833_0961990 3300041491 Bacteria 2462
180 Ga0451849_1196561 3300041505 Bacteria 978
181 Ga0451853_1492241 3300041512 Bacteria 2616
182 Ga0451853_2139338 3300041512 Unclassified 2042
183 Ga0466963_0000012 3300044694 Bacteria 62839
184 Ga0466963_0023597 3300044694 Bacteria 3909
185 Ga0466957_0053812 3300044842 Bacteria 2455
186 Ga0466957_0296275 3300044842 Bacteria 1086
187 Ga0466957_1367152 3300044842 Unclassified 515
188 Ga0466967_0000012 3300045976 Bacteria 104270
189 Ga0466967_0449082 3300045976 Bacteria 1260
190 Ga0495629_0000899 3300046459 Bacteria 23864
191 Ga0495629_0006397 3300046459 Bacteria 8736
192 Ga0495629_0020943 3300046459 Bacteria 4667
193 Ga0495629_0543520 3300046459 Bacteria 780
194 Ga0495641_0045048 3300046461 Bacteria 2032
195 Ga0495641_0259644 3300046461 Bacteria 781
196 Ga0495594_0000012 3300046499 Bacteria 105133
197 Ga0495608_0000013 3300046511 Bacteria 228481
198 Ga0495610_0081787 3300046512 Unclassified 1482
199 Ga0495628_0006106 3300046516 Bacteria 10535
200 Ga0495628_0207884 3300046516 Bacteria 1473
201 Ga0495630_0001450 3300046517 Bacteria 16430
202 Ga0495630_0039333 3300046517 Bacteria 3537
203 Ga0495630_0042315 3300046517 Bacteria 3402
204 Ga0495652_0000018 3300046529 Bacteria 201634
205 Ga0495640_0003807 3300046533 Bacteria 12117
206 Ga0495587_0010082 3300046536 Bacteria 6029
207 Ga0495587_0043491 3300046536 Bacteria 2675
208 Ga0495598_0003920 3300046537 Bacteria 3191
209 Ga0495622_0000076 3300046557 Bacteria 86777
210 Ga0495625_0000395 3300046660 Bacteria 66640
211 Ga0495588_0000247 3300046674 Bacteria 45295
212 Ga0495657_0000003 3300046675 Bacteria 279680
213 Ga0495647_0000307 3300046681 Bacteria 13755
214 Ga0495613_0000132 3300046689 Bacteria 74233
215 Ga0495624_0000196 3300046690 Bacteria 46319
216 Ga0495600_0010574 3300046809 Bacteria 5730
217 Ga0495660_0060048 3300046810 Bacteria 2044
218 Ga0495604_0000448 3300047317 Bacteria 36537
219 Ga0495604_0005506 3300047317 Bacteria 10039
220 Ga0495674_0000039 3300047319 Bacteria 97645
221 Ga0495672_0101490 3300047320 Bacteria 1559
222 Ga0495672_0385291 3300047320 Bacteria 644
223 Ga0495676_0005595 3300047321 Bacteria 11530
224 Ga0495676_0045466 3300047321 Bacteria 3573
225 Ga0495680_0007059 3300047322 Bacteria 10353
226 Ga0495675_0000094 3300047444 Bacteria 63338
227 Ga0495675_0046300 3300047444 Bacteria 2769
228 Ga0495686_0170239 3300047472 Bacteria 1267
229 Ga0495602_0001025 3300048088 Bacteria 27203
230 Ga0495602_0006709 3300048088 Bacteria 12072
231 Ga0495602_0116722 3300048088 Bacteria 2156
232 Ga0496100_0000019 3300048903 Bacteria 149995
233 Ga0496101_0000005 3300048904 Bacteria 331455
234 Ga0496102_0000129 3300048905 Bacteria 104478
235 Ga0496102_0339523 3300048905 Bacteria 1415
236 Ga0496103_0000087 3300048906 Bacteria 104566
237 Ga0496103_0047770 3300048906 Bacteria 2645
238 Ga0496103_0228785 3300048906 Bacteria 1196
239 Ga0496104_0000010 3300048907 Bacteria 475255
240 Ga0496104_0013569 3300048907 Bacteria 7343
241 Ga0496104_0527504 3300048907 Bacteria 1092
242 Ga0496105_0000005 3300048908 Bacteria 475797
243 Ga0496106_0000156 3300048909 Bacteria 50301
244 Ga0496107_0000004 3300048910 Bacteria 297680
245 Ga0496107_0104614 3300048910 Bacteria 2078
246 Ga0496108_0000005 3300048911 Bacteria 535059
247 Ga0496108_0001236 3300048911 Bacteria 20040
248 Ga0496108_0003961 3300048911 Bacteria 11896
249 Ga0496108_1287411 3300048911 Bacteria 615
250 Ga0496109_0000002 3300048912 Bacteria 443393
251 Ga0496109_0000011 3300048912 Bacteria 234908
252 Ga0496109_0000589 3300048912 Bacteria 30428
253 Ga0496109_0242634 3300048912 Bacteria 1696
254 Ga0496110_0000185 3300048913 Bacteria 39094
255 Ga0496110_0096030 3300048913 Bacteria 2656
256 Ga0496110_0257616 3300048913 Bacteria 1588
257 Ga0496110_0872644 3300048913 Bacteria 805
258 Ga0496111_0002441 3300048914 Bacteria 11230
259 Ga0496111_0208039 3300048914 Bacteria 1454
260 Ga0496111_0599866 3300048914 Bacteria 806
261 Ga0496112_0001010 3300048915 Bacteria 20632
262 Ga0496113_0000017 3300048916 Bacteria 74327
263 Ga0496113_0053415 3300048916 Bacteria 3021
264 Ga0496114_0000003 3300048917 Bacteria 630981
265 Ga0496114_0042214 3300048917 Bacteria 3780
266 Ga0496115_0000022 3300048918 Bacteria 164224
267 Ga0496115_0000027 3300048918 Bacteria 145505
268 Ga0496116_0000120 3300048919 Bacteria 166804
269 Ga0496116_0389278 3300048919 Bacteria 622
270 Ga0496117_0001845 3300048920 Bacteria 28614
271 Ga0496117_0088520 3300048920 Bacteria 2003
272 Ga0496117_0181272 3300048920 Bacteria 1210
273 Ga0496118_0002153 3300048921 Bacteria 27471
274 Ga0496118_0038805 3300048921 Bacteria 3811
275 Ga0496118_0039670 3300048921 Bacteria 3755
276 Ga0496119_0005570 3300048922 Bacteria 11984
277 Ga0496119_0041355 3300048922 Bacteria 2936
278 Ga0496119_0069048 3300048922 Bacteria 2078
279 Ga0496120_0014583 3300048923 Bacteria 5231
280 Ga0496120_0056516 3300048923 Bacteria 2214
281 Ga0496121_0027386 3300048924 Bacteria 5334
282 Ga0496124_0369155 3300048927 Bacteria 1008
283 Ga0496124_0831925 3300048927 Unclassified 568
284 Ga0496125_0028914 3300048928 Bacteria 4992
285 Ga0496126_0568824 3300048929 Bacteria 897
286 Ga0501031_0972177 3300049568 Bacteria 543
287 Ga0501036_0444342 3300049572 Unclassified 1080
288 Ga0501039_0237033 3300049575 Bacteria 1435
289 Ga0501041_0230531 3300049577 Bacteria 1163
290 Ga0501042_0045383 3300049578 Bacteria 3132
291 Ga0501042_0227803 3300049578 Bacteria 1344
292 Ga0501043_0451172 3300049579 Bacteria 966
293 Ga0501043_0893644 3300049579 Bacteria 637
294 Ga0501047_0145836 3300049581 Bacteria 2244
295 Ga0501047_0240669 3300049581 Bacteria 1660
296 Ga0501048_0601371 3300049582 Bacteria 789
297 Ga0501068_0139058 3300049584 Bacteria 1522
298 Ga0501068_0143928 3300049584 Bacteria 1495
299 Ga0501069_0014783 3300049585 Bacteria 4176
300 Ga0501069_0141099 3300049585 Bacteria 1382
301 Ga0501070_0090004 3300049586 Bacteria 2540
302 Ga0501070_0262123 3300049586 Bacteria 1412
303 Ga0501071_0276103 3300049587 Bacteria 1271
304 Ga0501071_1310199 3300049587 Bacteria 559
305 Ga0501072_0032014 3300049588 Bacteria 4117
306 Ga0501074_0111472 3300049590 Bacteria 1957
307 Ga0501076_0609113 3300049592 Bacteria 901
308 Ga0501079_0121387 3300049741 Bacteria 2032
309 Ga0501080_0102070 3300049742 Bacteria 2661
310 Ga0501080_0211800 3300049742 Unclassified 1776
311 Ga0501081_1143003 3300049743 Unclassified 589
312 Ga0501083_0127711 3300049744 Bacteria 1666
313 Ga0501083_0174994 3300049744 Bacteria 1402
314 Ga0501044_0019507 3300049823 Bacteria 7250
315 Ga0501045_0526600 3300049824 Bacteria 877
316 nmdc:mga0qj67_118045_c1 3300050509 Bacteria 2144
317 nmdc:mga0rr50_760495_c1 3300050513 Bacteria 827
318 Ga0495601_0000029 3300053077 Bacteria 111437
319 Ga0495601_0056300 3300053077 Bacteria 2490
320 Ga0495612_0010530 3300053078 Bacteria 3738
321 Ga0495655_0000010 3300053083 Bacteria 125615
322 Ga0495655_0001176 3300053083 Bacteria 4048
323 Ga0495595_0000007 3300053084 Bacteria 228504
324 Ga0495595_0046927 3300053084 Bacteria 1991
325 Ga0495619_0000001 3300053085 Bacteria 586054
326 Ga0495619_0000067 3300053085 Bacteria 83418
327 Ga0495619_0000851 3300053085 Bacteria 20034
328 Ga0495619_0020030 3300053085 Bacteria 4256
329 Ga0500566_0008386 3300053094 Bacteria 6111
330 Ga0500566_0202816 3300053094 Unclassified 1000
331 Ga0500641_0004436 3300053096 Bacteria 4963
332 Ga0500595_160090 3300053119 Bacteria 627
333 Ga0500628_000024 3300053129 Bacteria 64538
334 Ga0500658_0130106 3300053134 Bacteria 1122
335 Ga0500568_0022468 3300053139 Bacteria 2697
336 Ga0501082_0185533 3300060353 Bacteria 1810
337 Ga0495658_0001961
338 LJNas_1007353
339 JGI24740J21852_10010899
340 JGI24748J21848_1000342
341 JGI24034J26672_10000196
342 JGI24742J22300_10000222
343 rootH2_10229049
344 Ga0070658_10436717
345 Ga0070683_100000502
346 Ga0070683_100000527
347 Ga0070683_100409722
348 Ga0068869_101731186
349 Ga0070682_100000061
350 Ga0068868_100000220
351 Ga0070689_100327175
352 Ga0070691_10000013
353 Ga0070691_10000169
354 Ga0070661_100000110
355 Ga0070661_100348030
356 Ga0070692_10042484
357 Ga0070668_100011266
358 Ga0070668_100058968
359 Ga0070675_100000091
360 Ga0070674_100000030
361 Ga0070688_100000053
362 Ga0070688_100000918
363 Ga0070688_100611627
364 Ga0070659_100368008
365 Ga0070667_100009466
366 Ga0070714_100039823
367 Ga0070713_100000023
368 Ga0070713_100268303
369 Ga0070711_100271011
370 Ga0070678_100020905
371 Ga0070685_10000032
372 Ga0070685_10000086
373 Ga0070685_10101986
374 Ga0070684_100087613
375 Ga0070684_100172963
376 Ga0070684_100708063
377 Ga0070672_100000005
378 Ga0070686_100456419
379 Ga0070665_100108613
380 Ga0070665_100728122
381 Ga0068855_100048599
382 Ga0068854_100004036
383 Ga0068856_100001228
384 Ga0068856_100014788
385 Ga0068856_101549391
386 Ga0070702_100128161
387 Ga0068852_100000037
388 Ga0068859_100427862
389 Ga0068859_101256087
390 Ga0068864_100000043
391 Ga0068866_10000005
392 Ga0068866_10000130
393 Ga0068851_10000372
394 Ga0068870_10625888
395 Ga0068863_100017589
396 Ga0068863_100093058
397 Ga0068863_100153338
398 Ga0068858_100425332
399 Ga0068860_100247554
400 Ga0068862_100000366
401 Ga0081455_10043693
402 Ga0081540_1000046
403 Ga0081539_10001074
404 Ga0070712_100031210
405 Ga0097621_101257464
406 Ga0075430_100100132
407 Ga0068865_100000081
408 Ga0068865_100507015
409 Ga0097620_100427874
410 Ga0097620_101255923
411 Ga0105245_10000303
412 Ga0105245_10114305
413 Ga0105245_13075908
414 Ga0105247_10000148
415 Ga0105247_10125827
416 Ga0105247_10133889
417 Ga0105241_10798017
418 Ga0105242_10000052
419 Ga0105242_10001217
420 Ga0105242_10012891
421 Ga0105242_10230516
422 Ga0105248_10000017
423 Ga0105248_10522237
424 Ga0105238_11388238
425 Ga0105249_10000916
426 Ga0105249_10454881
427 Ga0099796_10428672
428 Ga0105239_10022212
429 Ga0157371_10002739
430 Ga0157370_10003677
431 Ga0157370_10472288
432 Ga0157369_10000105
433 Ga0157378_10036731
434 Ga0157378_10047863
435 Ga0157378_10061322
436 Ga0163162_10577697
437 Ga0163162_11365937
438 Ga0157372_10000284
439 Ga0157375_10000620
440 Ga0157375_10000945
441 Ga0157375_12999082
442 Ga0163163_10272169
443 Ga0157380_10000186
444 Ga0157380_10786076
445 Ga0157379_10727553
446 Ga0157376_10097609
447 Ga0157376_10737699
448 Ga0163161_10014293
449 Ga0207656_10000244
450 Ga0207642_10000005
451 Ga0207642_10000047
452 Ga0207710_10000096
453 Ga0207705_10031630
454 Ga0207654_10148892
455 Ga0207693_10043212
456 Ga0207663_10142308
457 Ga0207649_10000015
458 Ga0207650_10289809
459 Ga0207659_10000707
460 Ga0207687_10000040
461 Ga0207687_10011372
462 Ga0207700_10000003
463 Ga0207664_10311671
464 Ga0207690_10006804
465 Ga0207686_10000119
466 Ga0207686_10001615
467 Ga0207686_10010792
468 Ga0207686_10051942
469 Ga0207669_10000029
470 Ga0207669_10000047
471 Ga0207704_10000018
472 Ga0207704_10357170
473 Ga0207691_10000028
474 Ga0207711_10000011
475 Ga0207661_10000391
476 Ga0207661_10000438
477 Ga0207661_10013749
478 Ga0207667_10034807
479 Ga0207712_10000994
480 Ga0207668_10004404
481 Ga0207668_10367965
482 Ga0207640_10000954
483 Ga0207658_10050400
484 Ga0207658_10231307
485 Ga0207677_10000929
486 Ga0207703_10000030
487 Ga0207703_10046470
488 Ga0207703_10316601
489 Ga0207678_10149046
490 Ga0207678_10981891
491 Ga0207708_10049477
492 Ga0207702_10000419
493 Ga0207702_10003974
494 Ga0207641_10018672
495 Ga0207641_10322071
496 Ga0207676_10000042
497 Ga0207675_100230213
498 Ga0207683_10012181
499 Ga0207698_10000015
500 Ga0268266_10279837
501 Ga0268266_10595233
502 Ga0268265_10003823
503 Ga0268264_10161901
504 Ga0265319_1000010
505 Ga0265336_10021567
506 Ga0265338_10000051
507 Ga0265324_10082465
508 Ga0265332_10321690
509 Ga0265325_10055330
510 Ga0265331_10045209
511 Ga0307415_100008478
512 Ga0451791_1330042
513 Ga0451804_0496889
514 Ga0451807_2483056
515 Ga0451833_0961990
516 Ga0451849_1196561
517 Ga0451853_1492241
518 Ga0451853_2139338
519 Ga0466963_0000012
520 Ga0466963_0023597
521 Ga0466957_0053812
522 Ga0466957_0296275
523 Ga0466957_1367152
524 Ga0466967_0000012
525 Ga0466967_0449082
526 Ga0495629_0000899
527 Ga0495629_0006397
528 Ga0495629_0020943
529 Ga0495629_0543520
530 Ga0495641_0045048
531 Ga0495641_0259644
532 Ga0495594_0000012
533 Ga0495608_0000013
534 Ga0495610_0081787
535 Ga0495628_0006106
536 Ga0495628_0207884
537 Ga0495630_0001450
538 Ga0495630_0039333
539 Ga0495630_0042315
540 Ga0495652_0000018
541 Ga0495640_0003807
542 Ga0495587_0010082
543 Ga0495587_0043491
544 Ga0495598_0003920
545 Ga0495622_0000076
546 Ga0495625_0000395
547 Ga0495588_0000247
548 Ga0495657_0000003
549 Ga0495647_0000307
550 Ga0495613_0000132
551 Ga0495624_0000196
552 Ga0495600_0010574
553 Ga0495660_0060048
554 Ga0495604_0000448
555 Ga0495604_0005506
556 Ga0495674_0000039
557 Ga0495672_0101490
558 Ga0495672_0385291
559 Ga0495676_0005595
560 Ga0495676_0045466
561 Ga0495680_0007059
562 Ga0495675_0000094
563 Ga0495675_0046300
564 Ga0495686_0170239
565 Ga0495602_0001025
566 Ga0495602_0006709
567 Ga0495602_0116722
568 Ga0496100_0000019
569 Ga0496101_0000005
570 Ga0496102_0000129
571 Ga0496102_0339523
572 Ga0496103_0000087
573 Ga0496103_0047770
574 Ga0496103_0228785
575 Ga0496104_0000010
576 Ga0496104_0013569
577 Ga0496104_0527504
578 Ga0496105_0000005
579 Ga0496106_0000156
580 Ga0496107_0000004
581 Ga0496107_0104614
582 Ga0496108_0000005
583 Ga0496108_0001236
584 Ga0496108_0003961
585 Ga0496108_1287411
586 Ga0496109_0000002
587 Ga0496109_0000011
588 Ga0496109_0000589
589 Ga0496109_0242634
590 Ga0496110_0000185
591 Ga0496110_0096030
592 Ga0496110_0257616
593 Ga0496110_0872644
594 Ga0496111_0002441
595 Ga0496111_0208039
596 Ga0496111_0599866
597 Ga0496112_0001010
598 Ga0496113_0000017
599 Ga0496113_0053415
600 Ga0496114_0000003
601 Ga0496114_0042214
602 Ga0496115_0000022
603 Ga0496115_0000027
604 Ga0496116_0000120
605 Ga0496116_0389278
606 Ga0496117_0001845
607 Ga0496117_0088520
608 Ga0496117_0181272
609 Ga0496118_0002153
610 Ga0496118_0038805
611 Ga0496118_0039670
612 Ga0496119_0005570
613 Ga0496119_0041355
614 Ga0496119_0069048
615 Ga0496120_0014583
616 Ga0496120_0056516
617 Ga0496121_0027386
618 Ga0496124_0369155
619 Ga0496124_0831925
620 Ga0496125_0028914
621 Ga0496126_0568824
622 Ga0501031_0972177
623 Ga0501036_0444342
624 Ga0501039_0237033
625 Ga0501041_0230531
626 Ga0501042_0045383
627 Ga0501042_0227803
628 Ga0501043_0451172
629 Ga0501043_0893644
630 Ga0501047_0145836
631 Ga0501047_0240669
632 Ga0501048_0601371
633 Ga0501068_0139058
634 Ga0501068_0143928
635 Ga0501069_0014783
636 Ga0501069_0141099
637 Ga0501070_0090004
638 Ga0501070_0262123
639 Ga0501071_0276103
640 Ga0501071_1310199
641 Ga0501072_0032014
642 Ga0501074_0111472
643 Ga0501076_0609113
644 Ga0501079_0121387
645 Ga0501080_0102070
646 Ga0501080_0211800
647 Ga0501081_1143003
648 Ga0501083_0127711
649 Ga0501083_0174994
650 Ga0501044_0019507
651 Ga0501045_0526600
652 nmdc:mga0qj67_118045_c1
653 nmdc:mga0rr50_760495_c1
654 Ga0495601_0000029
655 Ga0495601_0056300
656 Ga0495612_0010530
657 Ga0495655_0000010
658 Ga0495655_0001176
659 Ga0495595_0000007
660 Ga0495595_0046927
661 Ga0495619_0000001
662 Ga0495619_0000067
663 Ga0495619_0000851
664 Ga0495619_0020030
665 Ga0500566_0008386
666 Ga0500566_0202816
667 Ga0500641_0004436
668 Ga0500595_160090
669 Ga0500628_000024
670 Ga0500658_0130106
671 Ga0500568_0022468
672 Ga0501082_0185533

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e5t-assembly5.cif.gz_E crystal structure of fsa2 0.6744 6 129
7dmo-assembly1.cif.gz_B-2 crystal structures of two pericyclases catalyzing [4+2] cycloadditions 0.6683 9 130
7e5t-assembly4.cif.gz_D crystal structure of fsa2 0.6623 6 129
7e5v-assembly3.cif.gz_C crystal structure of phm7 in complex with inhibitor 0.6563 9 127
7e5t-assembly2.cif.gz_B crystal structure of fsa2 0.6561 6 129
ID Description Score Start End Superfamily
af_Q65X45_193_272_3.10.450.10 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8105 91 126 3.10.450.10
af_Q9V3E0_280_403_2.40.370.10 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.7493 6 128 2.40.370.10
af_O45136_1_426_2.40.160.10 Mainly Beta;Beta Barrel;Porin;Porin 0.744 7 130 2.40.160.10
af_Q9V3E0_280_403_2.40.370.10 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.7383 6 128 2.40.370.10
2qkpC00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.7344 94 124 3.30.450.20
ID Description Score Start End GO Terms
AF-A0A537YM20-F1-model_v4 Uncharacterized protein 0.9383 1 127
AF-A0A2W6BXU1-F1-model_v4 Uncharacterized protein 0.9128 9 130
AF-A0A537YM20-F1-model_v4 Uncharacterized protein 0.9106 1 127
AF-A0A7V9H838-F1-model_v4 DUF2804 family protein 0.909 7 130
AF-A0A7V9HQV8-F1-model_v4 Uncharacterized protein 0.9089 1 128

Map